F388754

General Info

Members Datasets Scaffolds Average Seq Length
288 155 576 90

Family's Representative Sequence

Representative Sequence 3300044901|Ga0466960_0697812|Ga0466960_0697812_121_417
Length 93
Sequence MAANYSGRVGKASDWLREERRKVLGDWVAFCLRCGAARRWFEQFEAEVPDECPQCGGVLLRRAPFSSIAVVDCEAXGKPVRENELFGSKIRRG

Samples

Sample ID Description Type Environment
1 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
42 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
43 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
44 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
69 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
70 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
71 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
72 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
73 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
74 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
75 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
76 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
77 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
78 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
79 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
80 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
81 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
82 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
89 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
90 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
91 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
92 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
93 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
94 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
95 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
96 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
97 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
98 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
99 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
100 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
101 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
104 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
105 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
106 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
107 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
108 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
109 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
110 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
111 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
112 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
113 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
114 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
115 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
116 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
117 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
118 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
119 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
120 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
121 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
122 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
123 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
124 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
130 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
141 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
142 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
143 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
150 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
154 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
155 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.92
Metatranscriptomes 2.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.68
Rhizosphere 90.97
Stem 0
Stem Tuber 0
Unclassified 21.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466960_0697812 3300044901 Bacteria 609
2 Ga0070658_10020694 3300005327 Bacteria 5270
3 Ga0070658_10047875 3300005327 Bacteria 3460
4 Ga0070658_10243788 3300005327 Bacteria 1524
5 Ga0070658_10473161 3300005327 Bacteria 1081
6 Ga0070683_100039934 3300005329 Bacteria 4311
7 Ga0070683_100222559 3300005329 Bacteria 1794
8 Ga0070680_100272871 3300005336 Unclassified 1432
9 Ga0070660_100084593 3300005339 Bacteria 2493
10 Ga0070660_100171875 3300005339 Bacteria 1750
11 Ga0070660_100302699 3300005339 Unclassified 1311
12 Ga0070661_100189181 3300005344 Unclassified 1569
13 Ga0070692_10616650 3300005345 Bacteria 720
14 Ga0070659_100922609 3300005366 Bacteria 764
15 Ga0070709_11559556 3300005434 Unclassified 537
16 Ga0070714_100222671 3300005435 Unclassified 1735
17 Ga0070714_100309088 3300005435 Bacteria 1475
18 Ga0070714_100622614 3300005435 Bacteria 1038
19 Ga0070714_101002516 3300005435 Bacteria 813
20 Ga0070714_101048417 3300005435 Unclassified 794
21 Ga0070713_100336746 3300005436 Bacteria 1397
22 Ga0070713_101253887 3300005436 Unclassified 718
23 Ga0070710_10376552 3300005437 Bacteria 946
24 Ga0070711_101783437 3300005439 Unclassified 540
25 Ga0070708_101034733 3300005445 Bacteria 770
26 Ga0070681_10044852 3300005458 Bacteria 4426
27 Ga0070707_100841031 3300005468 Unclassified 882
28 Ga0070707_101637176 3300005468 Bacteria 611
29 Ga0070679_100035622 3300005530 Bacteria 4938
30 Ga0070679_100052641 3300005530 Bacteria 4054
31 Ga0070679_100055875 3300005530 Bacteria 3932
32 Ga0070684_100240086 3300005535 Bacteria 1656
33 Ga0070684_100335783 3300005535 Bacteria 1389
34 Ga0070684_100930028 3300005535 Unclassified 815
35 Ga0068853_100161722 3300005539 Bacteria 2021
36 Ga0068853_101237855 3300005539 Bacteria 721
37 Ga0070695_101462962 3300005545 Bacteria 568
38 Ga0070696_101819343 3300005546 Unclassified 526
39 Ga0068855_100258365 3300005563 Bacteria 1941
40 Ga0068855_100377594 3300005563 Bacteria 1557
41 Ga0068854_101979205 3300005578 Bacteria 537
42 Ga0068856_100473740 3300005614 Bacteria 1273
43 Ga0068856_102220280 3300005614 Unclassified 558
44 Ga0068852_100283693 3300005616 Unclassified 1597
45 Ga0070712_101038782 3300006175 Bacteria 710
46 Ga0070712_101521937 3300006175 Bacteria 585
47 Ga0075435_101942868 3300007076 Bacteria 516
48 Ga0105240_10023789 3300009093 Bacteria 8093
49 Ga0105240_11015524 3300009093 Bacteria 886
50 Ga0105245_12290516 3300009098 Unclassified 594
51 Ga0105245_12779798 3300009098 Bacteria 542
52 Ga0114129_10235519 3300009147 Bacteria 2463
53 Ga0105243_10745289 3300009148 Bacteria 960
54 Ga0105241_12700629 3300009174 Unclassified 500
55 Ga0105242_11475205 3300009176 Bacteria 710
56 Ga0105242_11602223 3300009176 Bacteria 685
57 Ga0105242_12040883 3300009176 Bacteria 616
58 Ga0105238_10146483 3300009551 Bacteria 2338
59 Ga0105239_10813399 3300010375 Unclassified 1071
60 Ga0157371_10051935 3300013102 Bacteria 2912
61 Ga0157370_10252972 3300013104 Bacteria 1629
62 Ga0157369_10059853 3300013105 Bacteria 4108
63 Ga0157369_10060009 3300013105 Bacteria 4102
64 Ga0157369_10187492 3300013105 Bacteria 2175
65 Ga0157369_11088894 3300013105 Bacteria 817
66 Ga0157369_11359346 3300013105 Bacteria 723
67 Ga0157374_11999905 3300013296 Unclassified 606
68 Ga0157372_10263491 3300013307 Bacteria 2002
69 Ga0157372_10527581 3300013307 Unclassified 1376
70 Ga0157372_10540436 3300013307 Bacteria 1359
71 Ga0157372_11698602 3300013307 Unclassified 726
72 Ga0182008_10010325 3300014497 Bacteria 5000
73 Ga0182008_10369403 3300014497 Archaea 764
74 Ga0182006_1018204 3300015261 Bacteria 2972
75 Ga0182007_10010014 3300015262 Bacteria 3775
76 Ga0206356_11396819 3300020070 Unclassified 701
77 Ga0206356_11409377 3300020070 Bacteria 2136
78 Ga0206352_10493734 3300020078 Bacteria 565
79 Ga0206354_10881114 3300020081 Bacteria 3639
80 Ga0206353_10044304 3300020082 Bacteria 4463
81 Ga0206353_11318518 3300020082 Bacteria 3752
82 Ga0207699_11303676 3300025906 Unclassified 537
83 Ga0207705_10090889 3300025909 Bacteria 2235
84 Ga0207705_10153278 3300025909 Bacteria 1727
85 Ga0207705_10571876 3300025909 Unclassified 878
86 Ga0207705_10746898 3300025909 Bacteria 760
87 Ga0207707_10051677 3300025912 Bacteria 3579
88 Ga0207707_10325239 3300025912 Unclassified 1327
89 Ga0207695_10204489 3300025913 Bacteria 1888
90 Ga0207693_11014051 3300025915 Unclassified 633
91 Ga0207693_11050493 3300025915 Bacteria 620
92 Ga0207693_11429878 3300025915 Viruses 512
93 Ga0207663_10957479 3300025916 Unclassified 686
94 Ga0207657_10024563 3300025919 Bacteria 5574
95 Ga0207657_10112237 3300025919 Bacteria 2250
96 Ga0207657_10361519 3300025919 Unclassified 1144
97 Ga0207649_10208443 3300025920 Bacteria 1385
98 Ga0207649_10288874 3300025920 Bacteria 1195
99 Ga0207649_11472176 3300025920 Bacteria 539
100 Ga0207652_10058502 3300025921 Bacteria 3321
101 Ga0207652_10062049 3300025921 Bacteria 3230
102 Ga0207646_10215975 3300025922 Unclassified 1732
103 Ga0207694_10139277 3300025924 Bacteria 1950
104 Ga0207687_10395697 3300025927 Bacteria 1135
105 Ga0207664_10056221 3300025929 Bacteria 3125
106 Ga0207664_10160566 3300025929 Bacteria 1917
107 Ga0207664_10351591 3300025929 Unclassified 1304
108 Ga0207664_10579176 3300025929 Unclassified 1008
109 Ga0207664_11364037 3300025929 Bacteria 629
110 Ga0207670_11449025 3300025936 Bacteria 583
111 Ga0207704_11676334 3300025938 Bacteria 546
112 Ga0207661_10020376 3300025944 Bacteria 4956
113 Ga0207661_10194624 3300025944 Bacteria 1779
114 Ga0207667_10048849 3300025949 Bacteria 4473
115 Ga0207667_10883507 3300025949 Bacteria 886
116 Ga0207667_12166869 3300025949 Bacteria 513
117 Ga0207702_10058776 3300026078 Bacteria 3273
118 Ga0207702_10517031 3300026078 Bacteria 1165
119 Ga0207641_11186677 3300026088 Bacteria 763
120 Ga0207698_10383406 3300026142 Bacteria 1338
121 Ga0207698_10629790 3300026142 Unclassified 1060
122 Ga0265319_1015811 3300028563 Bacteria 2910
123 Ga0265319_1137011 3300028563 Bacteria 760
124 Ga0265318_10006523 3300028577 Bacteria 5362
125 Ga0265322_10003434 3300028654 Bacteria 4789
126 Ga0265338_10007624 3300028800 Bacteria 13358
127 Ga0265338_10049826 3300028800 Bacteria 3791
128 Ga0265338_10764859 3300028800 Bacteria 663
129 Ga0265330_10021550 3300031235 Bacteria 2939
130 Ga0265320_10031890 3300031240 Bacteria 2703
131 Ga0265325_10073954 3300031241 Bacteria 1705
132 Ga0265329_10059070 3300031242 Bacteria 1214
133 Ga0265340_10020712 3300031247 Bacteria 3376
134 Ga0265331_10336175 3300031250 Bacteria 676
135 Ga0265316_10010198 3300031344 Bacteria 8580
136 Ga0265313_10258871 3300031595 Unclassified 708
137 Ga0265314_10029645 3300031711 Bacteria 4062
138 Ga0265342_10033446 3300031712 Bacteria 3161
139 Ga0373925_1708369 3300037068 Bacteria 514
140 Ga0395899_0095731 3300037312 Bacteria 2147
141 Ga0395899_0257362 3300037312 Bacteria 1195
142 Ga0395899_0671246 3300037312 Bacteria 653
143 Ga0395899_1011594 3300037312 Unclassified 501
144 Ga0395900_0054838 3300037418 Bacteria 4104
145 Ga0395900_0223418 3300037418 Bacteria 1897
146 Ga0395900_0461478 3300037418 Bacteria 1225
147 Ga0395900_0748287 3300037418 Bacteria 908
148 Ga0395900_1096354 3300037418 Unclassified 713
149 Ga0395900_1580437 3300037418 Bacteria 567
150 Ga0395900_1801743 3300037418 Bacteria 523
151 Ga0395900_1908406 3300037418 Unclassified 504
152 Ga0395898_0014022 3300037466 Bacteria 8236
153 Ga0395898_0295093 3300037466 Bacteria 1546
154 Ga0395898_0306259 3300037466 Bacteria 1515
155 Ga0395898_0589148 3300037466 Bacteria 1054
156 Ga0395898_0808167 3300037466 Bacteria 878
157 Ga0395905_0058810 3300037471 Bacteria 3594
158 Ga0395905_0184513 3300037471 Unclassified 1958
159 Ga0395905_0199159 3300037471 Bacteria 1878
160 Ga0395905_0613691 3300037471 Unclassified 990
161 Ga0395901_0001057 3300038443 Bacteria 29607
162 Ga0395901_0038952 3300038443 Bacteria 4917
163 Ga0395901_0057822 3300038443 Bacteria 4033
164 Ga0395901_0185212 3300038443 Unclassified 2183
165 Ga0395901_1072619 3300038443 Bacteria 777
166 Ga0395901_1122270 3300038443 Bacteria 756
167 Ga0436360_0795498 3300039438 Bacteria 3097
168 Ga0451839_1112806 3300041496 Unclassified 621
169 Ga0466969_0356334 3300044656 Bacteria 663
170 Ga0466972_0442099 3300044658 Unclassified 611
171 Ga0466965_0465893 3300044683 Unclassified 705
172 Ga0466966_0035796 3300044684 Bacteria 3206
173 Ga0466966_0594196 3300044684 Archaea 666
174 Ga0466963_0008724 3300044694 Bacteria 6086
175 Ga0466963_0010963 3300044694 Bacteria 5509
176 Ga0466963_0018488 3300044694 Bacteria 4359
177 Ga0466963_0192997 3300044694 Bacteria 1423
178 Ga0466963_0506659 3300044694 Bacteria 852
179 Ga0466963_0970969 3300044694 Unclassified 598
180 Ga0466964_0024100 3300044706 Unclassified 2369
181 Ga0466964_0079241 3300044706 Unclassified 1406
182 Ga0466964_0646521 3300044706 Bacteria 584
183 Ga0466968_0043363 3300044735 Unclassified 1904
184 Ga0466970_0501348 3300044765 Bacteria 699
185 Ga0466957_0386298 3300044842 Archaea 955
186 Ga0466960_0929407 3300044901 Bacteria 532
187 Ga0466959_0036133 3300045049 Bacteria 3650
188 Ga0466959_0040652 3300045049 Bacteria 3435
189 Ga0466959_0235232 3300045049 Bacteria 1267
190 Ga0451576_0993303 3300045051 Unclassified 880
191 Ga0466958_0010662 3300045836 Bacteria 5154
192 Ga0466958_0018889 3300045836 Bacteria 4006
193 Ga0466967_0026430 3300045976 Bacteria 4808
194 Ga0466967_0050317 3300045976 Bacteria 3648
195 Ga0466967_0060058 3300045976 Bacteria 3367
196 Ga0466967_0119737 3300045976 Bacteria 2430
197 Ga0466967_0157509 3300045976 Bacteria 2129
198 Ga0466967_0182884 3300045976 Unclassified 1978
199 Ga0466967_0218872 3300045976 Bacteria 1809
200 Ga0466967_0225857 3300045976 Bacteria 1781
201 Ga0466967_0269751 3300045976 Unclassified 1630
202 Ga0466967_0426082 3300045976 Bacteria 1294
203 Ga0466967_1553160 3300045976 Bacteria 659
204 Ga0466967_1700242 3300045976 Bacteria 628
205 Ga0466967_1717393 3300045976 Unclassified 625
206 Ga0466967_2139004 3300045976 Bacteria 556
207 Ga0495629_0303650 3300046459 Unclassified 1093
208 Ga0495629_0439774 3300046459 Bacteria 884
209 Ga0495664_0462126 3300046477 Unclassified 760
210 Ga0495664_0536041 3300046477 Unclassified 698
211 Ga0495584_0140005 3300046491 Bacteria 1229
212 Ga0495584_0557122 3300046491 Unclassified 584
213 Ga0495608_0405930 3300046511 Bacteria 833
214 Ga0495608_0562057 3300046511 Bacteria 687
215 Ga0495618_0919910 3300046514 Bacteria 504
216 Ga0495630_0289727 3300046517 Unclassified 1251
217 Ga0495663_0048366 3300046525 Bacteria 1311
218 Ga0495642_0254316 3300046528 Bacteria 768
219 Ga0495652_0122728 3300046529 Bacteria 2069
220 Ga0495652_0182466 3300046529 Bacteria 1609
221 Ga0495652_0442209 3300046529 Bacteria 912
222 Ga0495640_0269196 3300046533 Unclassified 1063
223 Ga0495609_0321133 3300046538 Unclassified 628
224 Ga0495667_0392349 3300046559 Bacteria 875
225 Ga0495667_0616334 3300046559 Bacteria 675
226 Ga0495656_0284814 3300046615 Bacteria 843
227 Ga0495635_0612994 3300046663 Bacteria 710
228 Ga0495635_1111761 3300046663 Bacteria 500
229 Ga0495659_0096827 3300046664 Unclassified 1139
230 Ga0495599_0257930 3300046678 Bacteria 1060
231 Ga0495599_0790085 3300046678 Unclassified 543
232 Ga0495613_0108606 3300046689 Bacteria 2001
233 Ga0495670_0033752 3300046691 Bacteria 2547
234 Ga0495589_0440045 3300046794 Bacteria 597
235 Ga0495589_0468968 3300046794 Unclassified 576
236 Ga0495600_0446833 3300046809 Bacteria 800
237 Ga0495680_0309504 3300047322 Bacteria 1107
238 Ga0495680_0339178 3300047322 Bacteria 1049
239 Ga0495684_0452633 3300047471 Bacteria 892
240 Ga0496102_0001216 3300048905 Bacteria 23348
241 Ga0496102_0026332 3300048905 Bacteria 5186
242 Ga0496102_1185530 3300048905 Bacteria 683
243 Ga0496102_1962037 3300048905 Bacteria 502
244 Ga0496103_0009008 3300048906 Bacteria 5912
245 Ga0496103_0462578 3300048906 Bacteria 813
246 Ga0496103_0969461 3300048906 Bacteria 531
247 Ga0496104_0056071 3300048907 Bacteria 3726
248 Ga0496105_0015103 3300048908 Bacteria 6146
249 Ga0496106_0163329 3300048909 Bacteria 1762
250 Ga0496107_0130920 3300048910 Bacteria 1852
251 Ga0496108_0028460 3300048911 Bacteria 4624
252 Ga0496108_0115064 3300048911 Bacteria 2303
253 Ga0496109_0204482 3300048912 Bacteria 1856
254 Ga0496109_0592036 3300048912 Bacteria 1045
255 Ga0496109_1318875 3300048912 Bacteria 658
256 Ga0496110_0041901 3300048913 Bacteria 3996
257 Ga0496111_0451468 3300048914 Bacteria 948
258 Ga0496111_1055888 3300048914 Bacteria 580
259 Ga0496112_0099838 3300048915 Bacteria 2873
260 Ga0496112_0230522 3300048915 Bacteria 1806
261 Ga0496112_0326821 3300048915 Bacteria 1478
262 Ga0496114_0064254 3300048917 Bacteria 3073
263 Ga0496114_1385119 3300048917 Bacteria 591
264 Ga0496115_1147748 3300048918 Bacteria 586
265 Ga0501034_0009200 3300049571 Bacteria 10364
266 Ga0501047_0301959 3300049581 Bacteria 1443
267 Ga0501067_0035177 3300049583 Archaea 2781
268 Ga0501067_0343947 3300049583 Unclassified 831
269 Ga0501068_0548809 3300049584 Bacteria 751
270 Ga0501070_0027150 3300049586 Bacteria 4802
271 Ga0501070_0039262 3300049586 Bacteria 3949
272 Ga0501071_1020828 3300049587 Bacteria 639
273 Ga0501072_0035915 3300049588 Bacteria 3884
274 Ga0501073_0339696 3300049589 Bacteria 1037
275 Ga0501074_0164248 3300049590 Bacteria 1585
276 Ga0501074_0208900 3300049590 Bacteria 1391
277 Ga0501079_0003549 3300049741 Bacteria 11469
278 Ga0501079_0640200 3300049741 Unclassified 837
279 Ga0501080_0098497 3300049742 Bacteria 2713
280 Ga0501080_0279656 3300049742 Bacteria 1517
281 Ga0501080_1251868 3300049742 Bacteria 636
282 Ga0501083_0000739 3300049744 Bacteria 21326
283 nmdc:mga05p37_329018_c1 3300050507 Bacteria 1806
284 nmdc:mga0rr50_1317055_c1 3300050513 Unclassified 612
285 Ga0495595_0269994 3300053084 Bacteria 853
286 Ga0501084_1816247 3300054114 Unclassified 509
287 Ga0501082_0606035 3300060353 Bacteria 958
288 Ga0530510_0403477 3300061734 Archaea 1031
289 Ga0466960_0697812
290 Ga0070658_10020694
291 Ga0070658_10047875
292 Ga0070658_10243788
293 Ga0070658_10473161
294 Ga0070683_100039934
295 Ga0070683_100222559
296 Ga0070680_100272871
297 Ga0070660_100084593
298 Ga0070660_100171875
299 Ga0070660_100302699
300 Ga0070661_100189181
301 Ga0070692_10616650
302 Ga0070659_100922609
303 Ga0070709_11559556
304 Ga0070714_100222671
305 Ga0070714_100309088
306 Ga0070714_100622614
307 Ga0070714_101002516
308 Ga0070714_101048417
309 Ga0070713_100336746
310 Ga0070713_101253887
311 Ga0070710_10376552
312 Ga0070711_101783437
313 Ga0070708_101034733
314 Ga0070681_10044852
315 Ga0070707_100841031
316 Ga0070707_101637176
317 Ga0070679_100035622
318 Ga0070679_100052641
319 Ga0070679_100055875
320 Ga0070684_100240086
321 Ga0070684_100335783
322 Ga0070684_100930028
323 Ga0068853_100161722
324 Ga0068853_101237855
325 Ga0070695_101462962
326 Ga0070696_101819343
327 Ga0068855_100258365
328 Ga0068855_100377594
329 Ga0068854_101979205
330 Ga0068856_100473740
331 Ga0068856_102220280
332 Ga0068852_100283693
333 Ga0070712_101038782
334 Ga0070712_101521937
335 Ga0075435_101942868
336 Ga0105240_10023789
337 Ga0105240_11015524
338 Ga0105245_12290516
339 Ga0105245_12779798
340 Ga0114129_10235519
341 Ga0105243_10745289
342 Ga0105241_12700629
343 Ga0105242_11475205
344 Ga0105242_11602223
345 Ga0105242_12040883
346 Ga0105238_10146483
347 Ga0105239_10813399
348 Ga0157371_10051935
349 Ga0157370_10252972
350 Ga0157369_10059853
351 Ga0157369_10060009
352 Ga0157369_10187492
353 Ga0157369_11088894
354 Ga0157369_11359346
355 Ga0157374_11999905
356 Ga0157372_10263491
357 Ga0157372_10527581
358 Ga0157372_10540436
359 Ga0157372_11698602
360 Ga0182008_10010325
361 Ga0182008_10369403
362 Ga0182006_1018204
363 Ga0182007_10010014
364 Ga0206356_11396819
365 Ga0206356_11409377
366 Ga0206352_10493734
367 Ga0206354_10881114
368 Ga0206353_10044304
369 Ga0206353_11318518
370 Ga0207699_11303676
371 Ga0207705_10090889
372 Ga0207705_10153278
373 Ga0207705_10571876
374 Ga0207705_10746898
375 Ga0207707_10051677
376 Ga0207707_10325239
377 Ga0207695_10204489
378 Ga0207693_11014051
379 Ga0207693_11050493
380 Ga0207693_11429878
381 Ga0207663_10957479
382 Ga0207657_10024563
383 Ga0207657_10112237
384 Ga0207657_10361519
385 Ga0207649_10208443
386 Ga0207649_10288874
387 Ga0207649_11472176
388 Ga0207652_10058502
389 Ga0207652_10062049
390 Ga0207646_10215975
391 Ga0207694_10139277
392 Ga0207687_10395697
393 Ga0207664_10056221
394 Ga0207664_10160566
395 Ga0207664_10351591
396 Ga0207664_10579176
397 Ga0207664_11364037
398 Ga0207670_11449025
399 Ga0207704_11676334
400 Ga0207661_10020376
401 Ga0207661_10194624
402 Ga0207667_10048849
403 Ga0207667_10883507
404 Ga0207667_12166869
405 Ga0207702_10058776
406 Ga0207702_10517031
407 Ga0207641_11186677
408 Ga0207698_10383406
409 Ga0207698_10629790
410 Ga0265319_1015811
411 Ga0265319_1137011
412 Ga0265318_10006523
413 Ga0265322_10003434
414 Ga0265338_10007624
415 Ga0265338_10049826
416 Ga0265338_10764859
417 Ga0265330_10021550
418 Ga0265320_10031890
419 Ga0265325_10073954
420 Ga0265329_10059070
421 Ga0265340_10020712
422 Ga0265331_10336175
423 Ga0265316_10010198
424 Ga0265313_10258871
425 Ga0265314_10029645
426 Ga0265342_10033446
427 Ga0373925_1708369
428 Ga0395899_0095731
429 Ga0395899_0257362
430 Ga0395899_0671246
431 Ga0395899_1011594
432 Ga0395900_0054838
433 Ga0395900_0223418
434 Ga0395900_0461478
435 Ga0395900_0748287
436 Ga0395900_1096354
437 Ga0395900_1580437
438 Ga0395900_1801743
439 Ga0395900_1908406
440 Ga0395898_0014022
441 Ga0395898_0295093
442 Ga0395898_0306259
443 Ga0395898_0589148
444 Ga0395898_0808167
445 Ga0395905_0058810
446 Ga0395905_0184513
447 Ga0395905_0199159
448 Ga0395905_0613691
449 Ga0395901_0001057
450 Ga0395901_0038952
451 Ga0395901_0057822
452 Ga0395901_0185212
453 Ga0395901_1072619
454 Ga0395901_1122270
455 Ga0436360_0795498
456 Ga0451839_1112806
457 Ga0466969_0356334
458 Ga0466972_0442099
459 Ga0466965_0465893
460 Ga0466966_0035796
461 Ga0466966_0594196
462 Ga0466963_0008724
463 Ga0466963_0010963
464 Ga0466963_0018488
465 Ga0466963_0192997
466 Ga0466963_0506659
467 Ga0466963_0970969
468 Ga0466964_0024100
469 Ga0466964_0079241
470 Ga0466964_0646521
471 Ga0466968_0043363
472 Ga0466970_0501348
473 Ga0466957_0386298
474 Ga0466960_0929407
475 Ga0466959_0036133
476 Ga0466959_0040652
477 Ga0466959_0235232
478 Ga0451576_0993303
479 Ga0466958_0010662
480 Ga0466958_0018889
481 Ga0466967_0026430
482 Ga0466967_0050317
483 Ga0466967_0060058
484 Ga0466967_0119737
485 Ga0466967_0157509
486 Ga0466967_0182884
487 Ga0466967_0218872
488 Ga0466967_0225857
489 Ga0466967_0269751
490 Ga0466967_0426082
491 Ga0466967_1553160
492 Ga0466967_1700242
493 Ga0466967_1717393
494 Ga0466967_2139004
495 Ga0495629_0303650
496 Ga0495629_0439774
497 Ga0495664_0462126
498 Ga0495664_0536041
499 Ga0495584_0140005
500 Ga0495584_0557122
501 Ga0495608_0405930
502 Ga0495608_0562057
503 Ga0495618_0919910
504 Ga0495630_0289727
505 Ga0495663_0048366
506 Ga0495642_0254316
507 Ga0495652_0122728
508 Ga0495652_0182466
509 Ga0495652_0442209
510 Ga0495640_0269196
511 Ga0495609_0321133
512 Ga0495667_0392349
513 Ga0495667_0616334
514 Ga0495656_0284814
515 Ga0495635_0612994
516 Ga0495635_1111761
517 Ga0495659_0096827
518 Ga0495599_0257930
519 Ga0495599_0790085
520 Ga0495613_0108606
521 Ga0495670_0033752
522 Ga0495589_0440045
523 Ga0495589_0468968
524 Ga0495600_0446833
525 Ga0495680_0309504
526 Ga0495680_0339178
527 Ga0495684_0452633
528 Ga0496102_0001216
529 Ga0496102_0026332
530 Ga0496102_1185530
531 Ga0496102_1962037
532 Ga0496103_0009008
533 Ga0496103_0462578
534 Ga0496103_0969461
535 Ga0496104_0056071
536 Ga0496105_0015103
537 Ga0496106_0163329
538 Ga0496107_0130920
539 Ga0496108_0028460
540 Ga0496108_0115064
541 Ga0496109_0204482
542 Ga0496109_0592036
543 Ga0496109_1318875
544 Ga0496110_0041901
545 Ga0496111_0451468
546 Ga0496111_1055888
547 Ga0496112_0099838
548 Ga0496112_0230522
549 Ga0496112_0326821
550 Ga0496114_0064254
551 Ga0496114_1385119
552 Ga0496115_1147748
553 Ga0501034_0009200
554 Ga0501047_0301959
555 Ga0501067_0035177
556 Ga0501067_0343947
557 Ga0501068_0548809
558 Ga0501070_0027150
559 Ga0501070_0039262
560 Ga0501071_1020828
561 Ga0501072_0035915
562 Ga0501073_0339696
563 Ga0501074_0164248
564 Ga0501074_0208900
565 Ga0501079_0003549
566 Ga0501079_0640200
567 Ga0501080_0098497
568 Ga0501080_0279656
569 Ga0501080_1251868
570 Ga0501083_0000739
571 nmdc:mga05p37_329018_c1
572 nmdc:mga0rr50_1317055_c1
573 Ga0495595_0269994
574 Ga0501084_1816247
575 Ga0501082_0606035
576 Ga0530510_0403477

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mns-assembly1.cif.gz_B crystal structure of the znf4 of nucleoporin nup358/ranbp2 in complex with ran-gdp 0.8736 54 76
7mnu-assembly1.cif.gz_B crystal structure of the znf7 of nucleoporin nup358/ranbp2 in complex with ran-gdp 0.8721 54 78
3gj3-assembly1.cif.gz_B crystal structure of human rangdp-nup153znf2 complex 0.8691 54 77
7mo2-assembly2.cif.gz_D crystal structure of the znf2 of nucleoporin nup153 in complex with ran-gdp 0.8649 54 77
7mo3-assembly2.cif.gz_D crystal structure of the znf3 of nucleoporin nup153 in complex with ran-gdp, resolution 2.05 angstrom 0.862 54 77
ID Description Score Start End Superfamily
af_Q53700_9_242_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.7846 20 52 3.40.50.1220
af_Q57839_1_59_2.20.28.90 Mainly Beta;Single Sheet;Rubrerythrin, domain 2; 0.7788 21 54 2.20.28.90
af_Q8CFI5_61_358_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.7659 20 52 3.30.930.10
4xxbB00 Mainly Beta;Roll;SH3 type barrels.;Zn-finger domain of Sec23/24 0.7127 54 82 2.30.30.380
af_Q920R0_3_242_2.130.10.30 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II 0.7074 40 52 2.130.10.30
ID Description Score Start End GO Terms
AF-A0A7W1N3X0-F1-model_v4 Uncharacterized protein 0.931 1 92
AF-A0A7W1LH73-F1-model_v4 Zinc ribbon domain-containing protein 0.9292 7 89
AF-A0A7W1N3X0-F1-model_v4 Uncharacterized protein 0.9214 1 92
AF-A0A7M2YXJ1-F1-model_v4 Uncharacterized protein 0.9187 7 92
AF-A0A537YUM4-F1-model_v4 Uncharacterized protein 0.8827 30 93

Map