F388607

General Info

Members Datasets Scaffolds Average Seq Length
288 197 287 80

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10000353|Ga0213876_1000035338
Length 95
Sequence MAADLTRGERLQIMLTAKELEALDTWRFSVRMPSRAAAVRELLKRGLAAEGFEHVLAGSQSRDFGVTGDSSDSPTRDRQDSEAVQTDARKESQKK

Samples

Sample ID Description Type Environment
1 2643221736 Bosea sp. Root483D1 Isolate Unclassified
2 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
6 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
102 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
159 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
160 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
161 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
162 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
163 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
164 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
165 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
166 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
167 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
168 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
169 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
170 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
174 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
175 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
176 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
177 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
187 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
188 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
192 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
193 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
194 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
195 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
196 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.61
Metatranscriptomes 1.04
Isolates 0.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.25
Nodule 0
Rhizoplane 0
Rhizosphere 92.01
Stem 0
Stem Tuber 0
Unclassified 1.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24032J14994_103303 3300001430 Unclassified 547
2 JGI24737J22298_10003091 3300001990 Bacteria 5896
3 JGI24738J21930_10040033 3300002075 Unclassified 952
4 JGI24035J26624_1001454 3300002126 Unclassified 2234
5 JGI24033J26618_1012455 3300002155 Unclassified 1024
6 JGI24034J26672_10004940 3300002239 Bacteria 1902
7 JGI25151J46595_10065294 3300003187 Bacteria 1134
8 rootH2_10183680 3300003320 Unclassified 1066
9 Ga0065715_10089111 3300005293 Bacteria 14157
10 Ga0070658_10257845 3300005327 Bacteria 1480
11 Ga0070676_10001093 3300005328 Bacteria 13538
12 Ga0070670_100001915 3300005331 Bacteria 17030
13 Ga0070677_10000673 3300005333 Bacteria 11446
14 Ga0070680_100002877 3300005336 Bacteria 12790
15 Ga0070680_101518242 3300005336 Unclassified 580
16 Ga0068868_100042108 3300005338 Bacteria 3562
17 Ga0070689_100001772 3300005340 Bacteria 13849
18 Ga0070691_10065777 3300005341 Bacteria 1751
19 Ga0070661_100012721 3300005344 Bacteria 5889
20 Ga0070661_100551393 3300005344 Bacteria 927
21 Ga0070661_100556687 3300005344 Unclassified 923
22 Ga0070692_10057453 3300005345 Bacteria 2040
23 Ga0070668_100004325 3300005347 Bacteria 10538
24 Ga0070675_100004322 3300005354 Bacteria 10833
25 Ga0070673_100044421 3300005364 Bacteria 3440
26 Ga0070673_101698534 3300005364 Unclassified 597
27 Ga0070667_100002086 3300005367 Bacteria 17652
28 Ga0070709_10063420 3300005434 Bacteria 2360
29 Ga0070709_10187486 3300005434 Bacteria 1457
30 Ga0070709_11217811 3300005434 Bacteria 605
31 Ga0070713_100148245 3300005436 Unclassified 2085
32 Ga0070713_100285540 3300005436 Unclassified 1515
33 Ga0070710_10105894 3300005437 Unclassified 1682
34 Ga0070711_100806889 3300005439 Bacteria 796
35 Ga0070711_101364568 3300005439 Unclassified 616
36 Ga0070705_100000846 3300005440 Bacteria 17178
37 Ga0070694_100001086 3300005444 Bacteria 15580
38 Ga0070694_100577350 3300005444 Bacteria 903
39 Ga0070708_101350130 3300005445 Unclassified 665
40 Ga0070663_100001915 3300005455 Bacteria 11618
41 Ga0070678_100035164 3300005456 Bacteria 3496
42 Ga0070678_100041959 3300005456 Bacteria 3248
43 Ga0070681_10002452 3300005458 Bacteria 16987
44 Ga0070681_10398433 3300005458 Unclassified 1288
45 Ga0070685_10002220 3300005466 Bacteria 10017
46 Ga0070679_100002448 3300005530 Bacteria 16825
47 Ga0070679_100012659 3300005530 Bacteria 8068
48 Ga0070684_100003685 3300005535 Bacteria 11560
49 Ga0070684_100911330 3300005535 Bacteria 824
50 Ga0068853_100021324 3300005539 Bacteria 5400
51 Ga0068853_100025723 3300005539 Bacteria 4940
52 Ga0068853_100051500 3300005539 Bacteria 3543
53 Ga0070695_100002314 3300005545 Bacteria 10922
54 Ga0070695_100009528 3300005545 Bacteria 5786
55 Ga0070696_100004825 3300005546 Bacteria 9010
56 Ga0070696_100125571 3300005546 Bacteria 1861
57 Ga0070693_100000440 3300005547 Bacteria 18687
58 Ga0070693_100012174 3300005547 Bacteria 4349
59 Ga0070693_100596358 3300005547 Bacteria 797
60 Ga0070665_100016534 3300005548 Bacteria 7398
61 Ga0070665_100986136 3300005548 Bacteria 855
62 Ga0070665_101871323 3300005548 Bacteria 606
63 Ga0070704_100001395 3300005549 Bacteria 12854
64 Ga0068855_100049862 3300005563 Bacteria 4936
65 Ga0068855_100056646 3300005563 Bacteria 4598
66 Ga0068855_100276708 3300005563 Bacteria 1865
67 Ga0068855_100954994 3300005563 Bacteria 903
68 Ga0070664_100232331 3300005564 Bacteria 1653
69 Ga0070664_100327182 3300005564 Bacteria 1390
70 Ga0068857_100003109 3300005577 Bacteria 13733
71 Ga0068854_100002460 3300005578 Bacteria 11468
72 Ga0068854_100096747 3300005578 Bacteria 2206
73 Ga0068856_100000981 3300005614 Bacteria 30429
74 Ga0070702_100000610 3300005615 Bacteria 13160
75 Ga0068852_100024523 3300005616 Bacteria 4877
76 Ga0068852_100561296 3300005616 Bacteria 1143
77 Ga0068859_100009878 3300005617 Bacteria 9636
78 Ga0068866_10001194 3300005718 Bacteria 11326
79 Ga0068861_100062271 3300005719 Bacteria 2865
80 Ga0068870_10000882 3300005840 Bacteria 11716
81 Ga0068858_100033902 3300005842 Bacteria 4736
82 Ga0068860_100065863 3300005843 Bacteria 3440
83 Ga0068862_100080749 3300005844 Bacteria 2820
84 Ga0081455_10100438 3300005937 Bacteria 2325
85 Ga0081455_10299321 3300005937 Bacteria 1155
86 Ga0081540_1048754 3300005983 Unclassified 2118
87 Ga0081539_10003119 3300005985 Bacteria 21171
88 Ga0075364_10294288 3300006051 Bacteria 1105
89 Ga0070715_10685478 3300006163 Bacteria 610
90 Ga0070716_100523087 3300006173 Bacteria 879
91 Ga0075362_10732232 3300006177 Bacteria 517
92 Ga0075367_10005767 3300006178 Bacteria 6193
93 Ga0075369_10008573 3300006186 Bacteria 3938
94 Ga0097621_100187587 3300006237 Bacteria 1789
95 Ga0097621_102260893 3300006237 Unclassified 520
96 Ga0075370_10703487 3300006353 Unclassified 614
97 Ga0075434_100027785 3300006871 Bacteria 5555
98 Ga0075434_100355273 3300006871 Bacteria 1486
99 Ga0068865_100002124 3300006881 Bacteria 11706
100 Ga0075436_100032538 3300006914 Bacteria 3595
101 Ga0075436_100328296 3300006914 Bacteria 1100
102 Ga0075436_101308913 3300006914 Bacteria 548
103 Ga0075436_101441672 3300006914 Unclassified 522
104 Ga0097620_100009878 3300006931 Bacteria 9636
105 Ga0075435_100045425 3300007076 Bacteria 3521
106 Ga0099794_10024910 3300007265 Bacteria 2750
107 Ga0105240_10002399 3300009093 Bacteria 30138
108 Ga0105240_10449103 3300009093 Bacteria 1443
109 Ga0105240_10967213 3300009093 Bacteria 912
110 Ga0105240_11097854 3300009093 Unclassified 847
111 Ga0105243_10213926 3300009148 Bacteria 1699
112 Ga0105241_10052353 3300009174 Bacteria 3116
113 Ga0105241_10163162 3300009174 Bacteria 1834
114 Ga0105242_10117328 3300009176 Bacteria 2278
115 Ga0105242_12708064 3300009176 Unclassified 546
116 Ga0105237_10008584 3300009545 Bacteria 11048
117 Ga0105237_10057156 3300009545 Bacteria 3905
118 Ga0105237_10072752 3300009545 Bacteria 3431
119 Ga0105237_12216414 3300009545 Bacteria 559
120 Ga0105238_10003010 3300009551 Bacteria 16825
121 Ga0105238_10024943 3300009551 Bacteria 6094
122 Ga0105238_10074983 3300009551 Bacteria 3375
123 Ga0105238_10497332 3300009551 Bacteria 1220
124 Ga0105238_10991726 3300009551 Bacteria 861
125 Ga0105238_11066513 3300009551 Unclassified 830
126 Ga0105239_10010784 3300010375 Bacteria 10208
127 Ga0105239_10021705 3300010375 Bacteria 7078
128 Ga0105239_11846798 3300010375 Bacteria 700
129 Ga0105246_10602450 3300011119 Bacteria 950
130 Ga0157373_10014747 3300013100 Bacteria 5724
131 Ga0157373_10105657 3300013100 Unclassified 1980
132 Ga0157370_10015096 3300013104 Bacteria 7870
133 Ga0157369_10055035 3300013105 Bacteria 4295
134 Ga0157369_10128279 3300013105 Bacteria 2688
135 Ga0157369_10307104 3300013105 Bacteria 1650
136 Ga0157369_10800452 3300013105 Unclassified 968
137 Ga0157374_10019420 3300013296 Bacteria 6015
138 Ga0157378_11097047 3300013297 Bacteria 833
139 Ga0163162_10456792 3300013306 Bacteria 1409
140 Ga0157372_10022706 3300013307 Bacteria 6791
141 Ga0163163_10266595 3300014325 Bacteria 1764
142 Ga0182008_10259297 3300014497 Bacteria 899
143 Ga0157377_10804750 3300014745 Bacteria 693
144 Ga0157379_10000866 3300014968 Bacteria 24506
145 Ga0157379_10742246 3300014968 Bacteria 924
146 Ga0157376_12474914 3300014969 Unclassified 559
147 Ga0182007_10128483 3300015262 Bacteria 851
148 Ga0163161_10003041 3300017792 Bacteria 11844
149 Ga0206352_10014901 3300020078 Bacteria 1953
150 Ga0206350_10050191 3300020080 Bacteria 730
151 Ga0206353_11966671 3300020082 Unclassified 1112
152 Ga0213876_10000353 3300021384 Bacteria 39594
153 Ga0209233_1026773 3300025261 Bacteria 1405
154 Ga0207666_1000118 3300025271 Bacteria 12331
155 Ga0209025_1009372 3300025294 Bacteria 6842
156 Ga0207697_10018738 3300025315 Bacteria 2837
157 Ga0207696_1200462 3300025711 Unclassified 524
158 Ga0207653_10092490 3300025885 Bacteria 1061
159 Ga0207682_10028087 3300025893 Unclassified 2244
160 Ga0207642_10653086 3300025899 Unclassified 659
161 Ga0207688_10001670 3300025901 Bacteria 11744
162 Ga0207680_10008493 3300025903 Bacteria 5044
163 Ga0207647_10065846 3300025904 Unclassified 2198
164 Ga0207685_10687631 3300025905 Unclassified 556
165 Ga0207699_10027497 3300025906 Bacteria 3150
166 Ga0207699_10209030 3300025906 Bacteria 1326
167 Ga0207699_10879151 3300025906 Bacteria 661
168 Ga0207645_10003532 3300025907 Bacteria 11827
169 Ga0207705_10197407 3300025909 Bacteria 1524
170 Ga0207705_11544006 3300025909 Unclassified 502
171 Ga0207654_10007395 3300025911 Bacteria 5531
172 Ga0207654_10113188 3300025911 Bacteria 1692
173 Ga0207654_10227397 3300025911 Bacteria 1241
174 Ga0207654_10580077 3300025911 Unclassified 799
175 Ga0207695_10013007 3300025913 Bacteria 9942
176 Ga0207695_10016369 3300025913 Bacteria 8678
177 Ga0207695_10139360 3300025913 Bacteria 2376
178 Ga0207695_11408111 3300025913 Bacteria 577
179 Ga0207671_10056219 3300025914 Bacteria 2915
180 Ga0207671_10142134 3300025914 Bacteria 1850
181 Ga0207671_10228104 3300025914 Bacteria 1461
182 Ga0207671_10549533 3300025914 Bacteria 921
183 Ga0207660_10063758 3300025917 Bacteria 2658
184 Ga0207660_10489399 3300025917 Bacteria 997
185 Ga0207660_10913230 3300025917 Unclassified 716
186 Ga0207662_10001335 3300025918 Bacteria 11894
187 Ga0207657_10002335 3300025919 Bacteria 20572
188 Ga0207649_10010111 3300025920 Bacteria 5176
189 Ga0207652_10004859 3300025921 Bacteria 10884
190 Ga0207652_10214845 3300025921 Bacteria 1732
191 Ga0207694_10038806 3300025924 Bacteria 3662
192 Ga0207694_10040152 3300025924 Bacteria 3602
193 Ga0207694_10553074 3300025924 Bacteria 966
194 Ga0207650_10001608 3300025925 Bacteria 16135
195 Ga0207659_10002534 3300025926 Bacteria 10876
196 Ga0207700_10159691 3300025928 Unclassified 1871
197 Ga0207664_10406895 3300025929 Bacteria 1211
198 Ga0207644_10001533 3300025931 Bacteria 14887
199 Ga0207706_10219554 3300025933 Bacteria 1665
200 Ga0207686_10001672 3300025934 Bacteria 12348
201 Ga0207686_10015935 3300025934 Bacteria 4212
202 Ga0207709_10001657 3300025935 Bacteria 15039
203 Ga0207704_10043578 3300025938 Bacteria 2651
204 Ga0207691_10197305 3300025940 Unclassified 1753
205 Ga0207711_10012475 3300025941 Bacteria 7062
206 Ga0207689_10081433 3300025942 Bacteria 2661
207 Ga0207661_10001714 3300025944 Bacteria 14988
208 Ga0207679_10745717 3300025945 Unclassified 890
209 Ga0207667_10014360 3300025949 Bacteria 9033
210 Ga0207667_10016697 3300025949 Bacteria 8284
211 Ga0207667_10178136 3300025949 Bacteria 2183
212 Ga0207667_10236756 3300025949 Bacteria 1869
213 Ga0207667_10781180 3300025949 Bacteria 953
214 Ga0207712_10001926 3300025961 Bacteria 13642
215 Ga0207640_10212248 3300025981 Bacteria 1476
216 Ga0207658_10003452 3300025986 Bacteria 11185
217 Ga0207703_10004354 3300026035 Bacteria 11638
218 Ga0207639_10006880 3300026041 Bacteria 7745
219 Ga0207639_10195786 3300026041 Bacteria 1730
220 Ga0207639_10351147 3300026041 Unclassified 1317
221 Ga0207678_10086958 3300026067 Bacteria 2671
222 Ga0207708_10072775 3300026075 Bacteria 2634
223 Ga0207702_10000920 3300026078 Bacteria 30428
224 Ga0207702_10118564 3300026078 Bacteria 2365
225 Ga0207702_11204366 3300026078 Bacteria 751
226 Ga0207702_11953772 3300026078 Unclassified 577
227 Ga0207648_10003605 3300026089 Bacteria 16194
228 Ga0207674_10000059 3300026116 Bacteria 112995
229 Ga0207674_10008622 3300026116 Bacteria 11753
230 Ga0207675_100003889 3300026118 Bacteria 14515
231 Ga0207683_10083581 3300026121 Bacteria 2837
232 Ga0210002_1047030 3300027617 Unclassified 739
233 Ga0209588_1070966 3300027671 Unclassified 1125
234 Ga0209998_10135759 3300027717 Unclassified 626
235 Ga0268266_10012084 3300028379 Bacteria 7472
236 Ga0268265_10002822 3300028380 Bacteria 12777
237 Ga0268264_10019774 3300028381 Bacteria 5500
238 Ga0265337_1129876 3300028556 Unclassified 683
239 Ga0265318_10000364 3300028577 Bacteria 35727
240 Ga0265338_10110519 3300028800 Bacteria 2215
241 Ga0265338_10156422 3300028800 Bacteria 1765
242 Ga0265325_10003900 3300031241 Bacteria 9564
243 Ga0265339_10007001 3300031249 Bacteria 7330
244 Ga0265339_10042381 3300031249 Bacteria 2520
245 Ga0265331_10087145 3300031250 Bacteria 1446
246 Ga0265316_10076167 3300031344 Bacteria 2578
247 Ga0265316_10305663 3300031344 Bacteria 1158
248 Ga0265313_10030635 3300031595 Bacteria 2767
249 Ga0265314_10041778 3300031711 Bacteria 3278
250 Ga0326468_10091037 3300031889 Unclassified 545
251 Ga0373928_0220842 3300035084 Bacteria 554
252 Ga0373939_0373865 3300035114 Unclassified 585
253 Ga0373942_0189847 3300035207 Unclassified 677
254 Ga0373942_0347688 3300035207 Bacteria 523
255 Ga0395899_0049735 3300037312 Bacteria 3115
256 Ga0436365_1581020 3300039437 Bacteria 55576
257 Ga0436365_1823749 3300039437 Bacteria 6522
258 Ga0439465_0030256 3300041413 Unclassified 1722
259 Ga0466966_1008539 3300044684 Bacteria 502
260 Ga0466957_0404236 3300044842 Bacteria 934
261 Ga0495592_0370596 3300046454 Bacteria 914
262 Ga0495602_0297531 3300048088 Bacteria 1182
263 Ga0501032_0113289 3300049569 Bacteria 1794
264 Ga0501033_0188758 3300049570 Bacteria 1475
265 Ga0501034_1680852 3300049571 Bacteria 507
266 Ga0501037_0285954 3300049573 Bacteria 1148
267 Ga0501043_0730082 3300049579 Bacteria 721
268 Ga0501047_0040826 3300049581 Bacteria 4486
269 Ga0501047_0152104 3300049581 Bacteria 2190
270 Ga0501035_0001400 3300049822 Bacteria 24762
271 Ga0501035_0194345 3300049822 Bacteria 1743
272 Ga0501044_0008669 3300049823 Bacteria 11135
273 Ga0501044_0011838 3300049823 Bacteria 9452
274 Ga0501044_0105535 3300049823 Bacteria 2830
275 nmdc:mga03683_21787_c1 3300050489 Bacteria 2476
276 nmdc:mga00v17_326453_c1 3300050491 Bacteria 997
277 nmdc:mga06z11_255414_c1 3300050494 Bacteria 1033
278 nmdc:mga0n895_809237_c1 3300050512 Bacteria 927
279 nmdc:mga0rr50_45051_c1 3300050513 Unclassified 3239
280 nmdc:mga0sz30_39164_c1 3300050516 Bacteria 1687
281 Ga0500651_0260699 3300053093 Bacteria 1005
282 Ga0500559_0503985 3300053136 Bacteria 556
283 Ga0500568_0035878 3300053139 Bacteria 2021
284 Ga0500568_0316363 3300053139 Bacteria 566
285 Ga0500616_0001792 3300053153 Bacteria 19568
286 Ga0500636_0516788 3300053177 Unclassified 524
287 Ga0501082_1323698 3300060353 Unclassified 629

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028800 Ga0265338_10110519 Ga0265338_101105192 68
2 3300005436 Ga0070713_100285540 Ga0070713_1002855403 69
3 3300009551 Ga0105238_11066513 Ga0105238_110665132 69
4 3300013105 Ga0157369_10307104 Ga0157369_103071044 69
5 3300005364 Ga0070673_101698534 Ga0070673_1016985342 70
6 3300005456 Ga0070678_100035164 Ga0070678_1000351644 70
7 3300006163 Ga0070715_10685478 Ga0070715_106854782 70
8 3300006237 Ga0097621_102260893 Ga0097621_1022608931 70
9 3300025261 Ga0209233_1026773 Ga0209233_10267733 71
10 3300028556 Ga0265337_1129876 Ga0265337_11298761 71
11 3300028577 Ga0265318_10000364 Ga0265318_1000036430 71
12 iso_pu_bacteria 2643221736 2644746416 71
13 3300009093 Ga0105240_11097854 Ga0105240_110978541 72
14 3300005344 Ga0070661_100556687 Ga0070661_1005566872 73
15 3300005530 Ga0070679_100012659 Ga0070679_10001265912 73
16 3300005937 Ga0081455_10100438 Ga0081455_101004381 73
17 3300005983 Ga0081540_1048754 Ga0081540_10487544 73
18 3300005985 Ga0081539_10003119 Ga0081539_1000311914 73
19 3300013297 Ga0157378_11097047 Ga0157378_110970472 73
20 3300025909 Ga0207705_11544006 Ga0207705_115440061 73
21 3300025917 Ga0207660_10489399 Ga0207660_104893992 73
22 3300025921 Ga0207652_10214845 Ga0207652_102148454 73
23 3300026078 Ga0207702_11953772 Ga0207702_119537722 73
24 3300028800 Ga0265338_10156422 Ga0265338_101564223 73
25 3300031241 Ga0265325_10003900 Ga0265325_100039004 73
26 3300031249 Ga0265339_10007001 Ga0265339_100070017 73
27 3300031250 Ga0265331_10087145 Ga0265331_100871454 73
28 3300031344 Ga0265316_10305663 Ga0265316_103056633 73
29 3300031595 Ga0265313_10030635 Ga0265313_100306355 73
30 3300031711 Ga0265314_10041778 Ga0265314_100417785 73
31 3300005434 Ga0070709_10187486 Ga0070709_101874862 74
32 3300005434 Ga0070709_11217811 Ga0070709_112178111 74
33 3300005436 Ga0070713_100148245 Ga0070713_1001482455 74
34 3300005437 Ga0070710_10105894 Ga0070710_101058943 74
35 3300005439 Ga0070711_100806889 Ga0070711_1008068891 74
36 3300005458 Ga0070681_10398433 Ga0070681_103984332 74
37 3300006173 Ga0070716_100523087 Ga0070716_1005230871 74
38 3300006871 Ga0075434_100027785 Ga0075434_1000277852 74
39 3300006914 Ga0075436_100328296 Ga0075436_1003282962 74
40 3300006914 Ga0075436_101308913 Ga0075436_1013089131 74
41 3300007076 Ga0075435_100045425 Ga0075435_1000454253 74
42 3300007265 Ga0099794_10024910 Ga0099794_100249102 74
43 3300013100 Ga0157373_10105657 Ga0157373_101056573 74
44 3300013105 Ga0157369_10800452 Ga0157369_108004521 74
45 3300025905 Ga0207685_10687631 Ga0207685_106876311 74
46 3300025906 Ga0207699_10209030 Ga0207699_102090302 74
47 3300025906 Ga0207699_10879151 Ga0207699_108791511 74
48 3300025928 Ga0207700_10159691 Ga0207700_101596911 74
49 3300027671 Ga0209588_1070966 Ga0209588_10709662 74
50 3300031889 Ga0326468_10091037 Ga0326468_100910372 74
51 3300035084 Ga0373928_0220842 Ga0373928_0220842_303_536 74
52 3300035114 Ga0373939_0373865 Ga0373939_0373865_104_337 74
53 3300035207 Ga0373942_0189847 Ga0373942_0189847_171_437 74
54 3300041413 Ga0439465_0030256 Ga0439465_0030256_347_580 74
55 3300048088 Ga0495602_0297531 Ga0495602_0297531_882_1121 74
56 3300050512 nmdc:mga0n895_809237_c1 nmdc:mga0n895_809237_c1_77_307 74
57 3300050513 nmdc:mga0rr50_45051_c1 nmdc:mga0rr50_45051_c1_2785_3015 74
58 3300053139 Ga0500568_0035878 Ga0500568_0035878_954_1196 74
59 3300053177 Ga0500636_0516788 Ga0500636_0516788_239_472 74
60 3300003187 JGI25151J46595_10065294 JGI25151J46595_100652942 75
61 3300003320 rootH2_10183680 rootH2_101836801 75
62 3300005327 Ga0070658_10257845 Ga0070658_102578452 75
63 3300005439 Ga0070711_101364568 Ga0070711_1013645681 75
64 3300005535 Ga0070684_100911330 Ga0070684_1009113301 75
65 3300005539 Ga0068853_100051500 Ga0068853_1000515004 75
66 3300005547 Ga0070693_100596358 Ga0070693_1005963581 75
67 3300005548 Ga0070665_100986136 Ga0070665_1009861361 75
68 3300005548 Ga0070665_101871323 Ga0070665_1018713231 75
69 3300005563 Ga0068855_100056646 Ga0068855_1000566468 75
70 3300005563 Ga0068855_100276708 Ga0068855_1002767084 75
71 3300005616 Ga0068852_100561296 Ga0068852_1005612963 75
72 3300005937 Ga0081455_10299321 Ga0081455_102993214 75
73 3300006051 Ga0075364_10294288 Ga0075364_102942883 75
74 3300006177 Ga0075362_10732232 Ga0075362_107322321 75
75 3300006178 Ga0075367_10005767 Ga0075367_100057674 75
76 3300006186 Ga0075369_10008573 Ga0075369_100085735 75
77 3300009093 Ga0105240_10449103 Ga0105240_104491032 75
78 3300009093 Ga0105240_10967213 Ga0105240_109672131 75
79 3300009148 Ga0105243_10213926 Ga0105243_102139263 75
80 3300009174 Ga0105241_10052353 Ga0105241_100523534 75
81 3300009174 Ga0105241_10163162 Ga0105241_101631623 75
82 3300009176 Ga0105242_12708064 Ga0105242_127080641 75
83 3300009545 Ga0105237_10057156 Ga0105237_100571564 75
84 3300009545 Ga0105237_10072752 Ga0105237_100727524 75
85 3300009545 Ga0105237_12216414 Ga0105237_122164141 75
86 3300009551 Ga0105238_10024943 Ga0105238_100249439 75
87 3300009551 Ga0105238_10074983 Ga0105238_100749833 75
88 3300009551 Ga0105238_10497332 Ga0105238_104973321 75
89 3300010375 Ga0105239_10021705 Ga0105239_100217055 75
90 3300010375 Ga0105239_11846798 Ga0105239_118467982 75
91 3300011119 Ga0105246_10602450 Ga0105246_106024501 75
92 3300013105 Ga0157369_10128279 Ga0157369_101282792 75
93 3300014745 Ga0157377_10804750 Ga0157377_108047501 75
94 3300014968 Ga0157379_10742246 Ga0157379_107422461 75
95 3300025294 Ga0209025_1009372 Ga0209025_10093723 75
96 3300025909 Ga0207705_10197407 Ga0207705_101974072 75
97 3300025911 Ga0207654_10113188 Ga0207654_101131882 75
98 3300025911 Ga0207654_10580077 Ga0207654_105800772 75
99 3300025913 Ga0207695_10013007 Ga0207695_100130072 75
100 3300025913 Ga0207695_10016369 Ga0207695_100163695 75
101 3300025913 Ga0207695_11408111 Ga0207695_114081112 75
102 3300025914 Ga0207671_10056219 Ga0207671_100562196 75
103 3300025914 Ga0207671_10142134 Ga0207671_101421344 75
104 3300025914 Ga0207671_10549533 Ga0207671_105495333 75
105 3300025924 Ga0207694_10038806 Ga0207694_100388061 75
106 3300025924 Ga0207694_10553074 Ga0207694_105530742 75
107 3300025929 Ga0207664_10406895 Ga0207664_104068953 75
108 3300025949 Ga0207667_10014360 Ga0207667_100143608 75
109 3300025949 Ga0207667_10236756 Ga0207667_102367561 75
110 3300026041 Ga0207639_10195786 Ga0207639_101957864 75
111 3300026078 Ga0207702_11204366 Ga0207702_112043663 75
112 3300026116 Ga0207674_10008622 Ga0207674_100086224 75
113 3300035207 Ga0373942_0347688 Ga0373942_0347688_136_411 75
114 3300037312 Ga0395899_0049735 Ga0395899_0049735_2848_3105 75
115 3300039437 Ga0436365_1823749 Ga0436365_1823749_475_756 75
116 3300044684 Ga0466966_1008539 Ga0466966_1008539_192_461 75
117 3300044842 Ga0466957_0404236 Ga0466957_0404236_58_321 75
118 3300049569 Ga0501032_0113289 Ga0501032_0113289_1263_1508 75
119 3300049570 Ga0501033_0188758 Ga0501033_0188758_305_550 75
120 3300049571 Ga0501034_1680852 Ga0501034_1680852_223_468 75
121 3300049581 Ga0501047_0152104 Ga0501047_0152104_1871_2116 75
122 3300049822 Ga0501035_0001400 Ga0501035_0001400_6387_6632 75
123 3300049823 Ga0501044_0011838 Ga0501044_0011838_2564_2809 75
124 3300049823 Ga0501044_0105535 Ga0501044_0105535_1617_1862 75
125 3300050489 nmdc:mga03683_21787_c1 nmdc:mga03683_21787_c1_36_269 75
126 3300050491 nmdc:mga00v17_326453_c1 nmdc:mga00v17_326453_c1_375_608 75
127 3300050494 nmdc:mga06z11_255414_c1 nmdc:mga06z11_255414_c1_620_853 75
128 3300050516 nmdc:mga0sz30_39164_c1 nmdc:mga0sz30_39164_c1_954_1187 75
129 3300053093 Ga0500651_0260699 Ga0500651_0260699_348_605 75
130 3300053136 Ga0500559_0503985 Ga0500559_0503985_229_486 75
131 3300053139 Ga0500568_0316363 Ga0500568_0316363_127_372 75
132 3300053153 Ga0500616_0001792 Ga0500616_0001792_1357_1590 75
133 3300001430 JGI24032J14994_103303 JGI24032J14994_1033031 76
134 3300001990 JGI24737J22298_10003091 JGI24737J22298_100030916 76
135 3300002075 JGI24738J21930_10040033 JGI24738J21930_100400332 76
136 3300002126 JGI24035J26624_1001454 JGI24035J26624_10014542 76
137 3300002155 JGI24033J26618_1012455 JGI24033J26618_10124551 76
138 3300002239 JGI24034J26672_10004940 JGI24034J26672_100049404 76
139 3300005293 Ga0065715_10089111 Ga0065715_1008911111 76
140 3300005328 Ga0070676_10001093 Ga0070676_100010936 76
141 3300005331 Ga0070670_100001915 Ga0070670_10000191514 76
142 3300005333 Ga0070677_10000673 Ga0070677_100006734 76
143 3300005336 Ga0070680_100002877 Ga0070680_10000287713 76
144 3300005336 Ga0070680_101518242 Ga0070680_1015182421 76
145 3300005338 Ga0068868_100042108 Ga0068868_1000421082 76
146 3300005340 Ga0070689_100001772 Ga0070689_10000177212 76
147 3300005341 Ga0070691_10065777 Ga0070691_100657773 76
148 3300005344 Ga0070661_100012721 Ga0070661_1000127218 76
149 3300005344 Ga0070661_100551393 Ga0070661_1005513931 76
150 3300005345 Ga0070692_10057453 Ga0070692_100574533 76
151 3300005347 Ga0070668_100004325 Ga0070668_1000043253 76
152 3300005354 Ga0070675_100004322 Ga0070675_10000432211 76
153 3300005364 Ga0070673_100044421 Ga0070673_1000444215 76
154 3300005367 Ga0070667_100002086 Ga0070667_1000020869 76
155 3300005434 Ga0070709_10063420 Ga0070709_100634204 76
156 3300005440 Ga0070705_100000846 Ga0070705_10000084612 76
157 3300005444 Ga0070694_100001086 Ga0070694_1000010867 76
158 3300005444 Ga0070694_100577350 Ga0070694_1005773501 76
159 3300005445 Ga0070708_101350130 Ga0070708_1013501301 76
160 3300005455 Ga0070663_100001915 Ga0070663_10000191511 76
161 3300005456 Ga0070678_100041959 Ga0070678_1000419592 76
162 3300005458 Ga0070681_10002452 Ga0070681_100024528 76
163 3300005466 Ga0070685_10002220 Ga0070685_100022209 76
164 3300005530 Ga0070679_100002448 Ga0070679_1000024488 76
165 3300005535 Ga0070684_100003685 Ga0070684_1000036854 76
166 3300005539 Ga0068853_100021324 Ga0068853_1000213248 76
167 3300005539 Ga0068853_100025723 Ga0068853_1000257239 76
168 3300005545 Ga0070695_100002314 Ga0070695_10000231411 76
169 3300005545 Ga0070695_100009528 Ga0070695_1000095287 76
170 3300005546 Ga0070696_100004825 Ga0070696_1000048258 76
171 3300005546 Ga0070696_100125571 Ga0070696_1001255711 76
172 3300005547 Ga0070693_100000440 Ga0070693_10000044010 76
173 3300005547 Ga0070693_100012174 Ga0070693_1000121748 76
174 3300005548 Ga0070665_100016534 Ga0070665_1000165344 76
175 3300005549 Ga0070704_100001395 Ga0070704_1000013954 76
176 3300005563 Ga0068855_100049862 Ga0068855_1000498622 76
177 3300005563 Ga0068855_100954994 Ga0068855_1009549942 76
178 3300005564 Ga0070664_100232331 Ga0070664_1002323312 76
179 3300005564 Ga0070664_100327182 Ga0070664_1003271823 76
180 3300005577 Ga0068857_100003109 Ga0068857_10000310910 76
181 3300005578 Ga0068854_100002460 Ga0068854_10000246011 76
182 3300005578 Ga0068854_100096747 Ga0068854_1000967472 76
183 3300005614 Ga0068856_100000981 Ga0068856_1000009817 76
184 3300005615 Ga0070702_100000610 Ga0070702_10000061013 76
185 3300005616 Ga0068852_100024523 Ga0068852_1000245234 76
186 3300005617 Ga0068859_100009878 Ga0068859_1000098784 76
187 3300005718 Ga0068866_10001194 Ga0068866_100011944 76
188 3300005719 Ga0068861_100062271 Ga0068861_1000622715 76
189 3300005840 Ga0068870_10000882 Ga0068870_100008825 76
190 3300005842 Ga0068858_100033902 Ga0068858_1000339022 76
191 3300005843 Ga0068860_100065863 Ga0068860_1000658632 76
192 3300005844 Ga0068862_100080749 Ga0068862_1000807494 76
193 3300006237 Ga0097621_100187587 Ga0097621_1001875872 76
194 3300006353 Ga0075370_10703487 Ga0075370_107034872 76
195 3300006871 Ga0075434_100355273 Ga0075434_1003552732 76
196 3300006881 Ga0068865_100002124 Ga0068865_1000021244 76
197 3300006914 Ga0075436_100032538 Ga0075436_1000325382 76
198 3300006914 Ga0075436_101441672 Ga0075436_1014416721 76
199 3300006931 Ga0097620_100009878 Ga0097620_1000098784 76
200 3300009093 Ga0105240_10002399 Ga0105240_100023999 76
201 3300009176 Ga0105242_10117328 Ga0105242_101173282 76
202 3300009545 Ga0105237_10008584 Ga0105237_1000858414 76
203 3300009551 Ga0105238_10003010 Ga0105238_1000301012 76
204 3300009551 Ga0105238_10991726 Ga0105238_109917262 76
205 3300010375 Ga0105239_10010784 Ga0105239_100107842 76
206 3300013100 Ga0157373_10014747 Ga0157373_100147472 76
207 3300013104 Ga0157370_10015096 Ga0157370_1001509611 76
208 3300013105 Ga0157369_10055035 Ga0157369_100550355 76
209 3300013296 Ga0157374_10019420 Ga0157374_1001942011 76
210 3300013306 Ga0163162_10456792 Ga0163162_104567922 76
211 3300013307 Ga0157372_10022706 Ga0157372_1002270610 76
212 3300014325 Ga0163163_10266595 Ga0163163_102665952 76
213 3300014497 Ga0182008_10259297 Ga0182008_102592971 76
214 3300014968 Ga0157379_10000866 Ga0157379_1000086611 76
215 3300014969 Ga0157376_12474914 Ga0157376_124749142 76
216 3300015262 Ga0182007_10128483 Ga0182007_101284832 76
217 3300017792 Ga0163161_10003041 Ga0163161_1000304112 76
218 3300020078 Ga0206352_10014901 Ga0206352_100149011 76
219 3300020080 Ga0206350_10050191 Ga0206350_100501912 76
220 3300020082 Ga0206353_11966671 Ga0206353_119666712 76
221 3300021384 Ga0213876_10000353 Ga0213876_1000035338 76
222 3300025271 Ga0207666_1000118 Ga0207666_10001184 76
223 3300025315 Ga0207697_10018738 Ga0207697_100187385 76
224 3300025711 Ga0207696_1200462 Ga0207696_12004621 76
225 3300025885 Ga0207653_10092490 Ga0207653_100924901 76
226 3300025893 Ga0207682_10028087 Ga0207682_100280874 76
227 3300025899 Ga0207642_10653086 Ga0207642_106530861 76
228 3300025901 Ga0207688_10001670 Ga0207688_1000167011 76
229 3300025903 Ga0207680_10008493 Ga0207680_100084932 76
230 3300025904 Ga0207647_10065846 Ga0207647_100658464 76
231 3300025906 Ga0207699_10027497 Ga0207699_100274971 76
232 3300025907 Ga0207645_10003532 Ga0207645_1000353212 76
233 3300025911 Ga0207654_10007395 Ga0207654_100073957 76
234 3300025911 Ga0207654_10227397 Ga0207654_102273972 76
235 3300025913 Ga0207695_10139360 Ga0207695_101393604 76
236 3300025914 Ga0207671_10228104 Ga0207671_102281044 76
237 3300025917 Ga0207660_10063758 Ga0207660_100637584 76
238 3300025917 Ga0207660_10913230 Ga0207660_109132301 76
239 3300025918 Ga0207662_10001335 Ga0207662_1000133512 76
240 3300025919 Ga0207657_10002335 Ga0207657_100023359 76
241 3300025920 Ga0207649_10010111 Ga0207649_100101112 76
242 3300025921 Ga0207652_10004859 Ga0207652_100048593 76
243 3300025924 Ga0207694_10040152 Ga0207694_100401521 76
244 3300025925 Ga0207650_10001608 Ga0207650_100016088 76
245 3300025926 Ga0207659_10002534 Ga0207659_100025343 76
246 3300025931 Ga0207644_10001533 Ga0207644_100015337 76
247 3300025933 Ga0207706_10219554 Ga0207706_102195543 76
248 3300025934 Ga0207686_10001672 Ga0207686_1000167212 76
249 3300025934 Ga0207686_10015935 Ga0207686_100159352 76
250 3300025935 Ga0207709_10001657 Ga0207709_1000165713 76
251 3300025938 Ga0207704_10043578 Ga0207704_100435782 76
252 3300025940 Ga0207691_10197305 Ga0207691_101973053 76
253 3300025941 Ga0207711_10012475 Ga0207711_100124753 76
254 3300025942 Ga0207689_10081433 Ga0207689_100814334 76
255 3300025944 Ga0207661_10001714 Ga0207661_1000171411 76
256 3300025945 Ga0207679_10745717 Ga0207679_107457172 76
257 3300025949 Ga0207667_10016697 Ga0207667_1001669711 76
258 3300025949 Ga0207667_10178136 Ga0207667_101781363 76
259 3300025949 Ga0207667_10781180 Ga0207667_107811802 76
260 3300025961 Ga0207712_10001926 Ga0207712_100019263 76
261 3300025981 Ga0207640_10212248 Ga0207640_102122481 76
262 3300025986 Ga0207658_10003452 Ga0207658_100034524 76
263 3300026035 Ga0207703_10004354 Ga0207703_1000435411 76
264 3300026041 Ga0207639_10006880 Ga0207639_100068806 76
265 3300026041 Ga0207639_10351147 Ga0207639_103511472 76
266 3300026067 Ga0207678_10086958 Ga0207678_100869582 76
267 3300026075 Ga0207708_10072775 Ga0207708_100727754 76
268 3300026078 Ga0207702_10000920 Ga0207702_100009207 76
269 3300026078 Ga0207702_10118564 Ga0207702_101185642 76
270 3300026089 Ga0207648_10003605 Ga0207648_1000360511 76
271 3300026116 Ga0207674_10000059 Ga0207674_1000005943 76
272 3300026118 Ga0207675_100003889 Ga0207675_10000388914 76
273 3300026121 Ga0207683_10083581 Ga0207683_100835815 76
274 3300027617 Ga0210002_1047030 Ga0210002_10470301 76
275 3300027717 Ga0209998_10135759 Ga0209998_101357591 76
276 3300028379 Ga0268266_10012084 Ga0268266_100120844 76
277 3300028380 Ga0268265_10002822 Ga0268265_1000282212 76
278 3300028381 Ga0268264_10019774 Ga0268264_100197747 76
279 3300031249 Ga0265339_10042381 Ga0265339_100423812 76
280 3300031344 Ga0265316_10076167 Ga0265316_100761674 76
281 3300039437 Ga0436365_1581020 Ga0436365_1581020_5550_5837 76
282 3300046454 Ga0495592_0370596 Ga0495592_0370596_589_849 76
283 3300049573 Ga0501037_0285954 Ga0501037_0285954_701_988 76
284 3300049579 Ga0501043_0730082 Ga0501043_0730082_284_571 76
285 3300049581 Ga0501047_0040826 Ga0501047_0040826_112_399 76
286 3300049822 Ga0501035_0194345 Ga0501035_0194345_1381_1668 76
287 3300049823 Ga0501044_0008669 Ga0501044_0008669_2196_2483 76
288 3300060353 Ga0501082_1323698 Ga0501082_1323698_34_264 76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1q5v-assembly1.cif.gz_A apo-nikr 0.9499 8 51
1q5v-assembly1.cif.gz_C apo-nikr 0.9494 8 48
1q5v-assembly1.cif.gz_D apo-nikr 0.9016 8 50
2wve-assembly1.cif.gz_B structural and mechanistic insights into helicobacter pylori nikr function 0.8956 7 51
2wvd-assembly2.cif.gz_B structural and mechanistic insights into helicobacter pylori nikr function 0.8909 7 51
ID Description Score Start End Superfamily
1q5vA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.9499 8 51 1.10.1220.10
1q5vC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.9434 8 50 1.10.1220.10
1q5vB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.9177 8 50 1.10.1220.10
1q5vD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.9016 8 50 1.10.1220.10
1q5vA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.8934 8 51 1.10.1220.10
ID Description Score Start End GO Terms
AF-A0A662PMB4-F1-model_v4 Ribbon-helix-helix protein CopG domain-containing protein 0.8856 4 51 GO:0006355
AF-A0A7D5VC07-F1-model_v4 Ribbon-helix-helix protein, CopG family 0.8727 2 52 GO:0006355
AF-A0A133V033-F1-model_v4 Ribbon-helix-helix protein CopG domain-containing protein 0.8667 2 55
AF-A0A1W1UMR2-F1-model_v4 Ribbon-helix-helix protein, copG family 0.8536 2 55
AF-Q07R59-F1-model_v4 Ribbon-helix-helix protein CopG domain-containing protein 0.8491 4 66

Feature Viewer

pLDDT pTM Quality
79.99 0.59 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map