F388607
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 288 | 197 | 287 | 80 |
Family's Representative Sequence
| Representative Sequence | 3300021384|Ga0213876_10000353|Ga0213876_1000035338 |
| Length | 95 |
| Sequence | MAADLTRGERLQIMLTAKELEALDTWRFSVRMPSRAAAVRELLKRGLAAEGFEHVLAGSQSRDFGVTGDSSDSPTRDRQDSEAVQTDARKESQKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 2 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 6 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 7 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 8 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 62 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 65 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 66 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 74 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 92 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 96 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 101 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 159 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 160 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 162 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 164 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 165 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 166 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 168 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 169 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 170 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 172 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 173 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 174 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 175 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 176 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 187 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 188 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 189 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 192 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 193 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 194 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 195 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 196 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 197 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.61 |
| Metatranscriptomes | 1.04 |
| Isolates | 0.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.25 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 92.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24032J14994_103303 | 3300001430 | Unclassified | 547 |
| 2 | JGI24737J22298_10003091 | 3300001990 | Bacteria | 5896 |
| 3 | JGI24738J21930_10040033 | 3300002075 | Unclassified | 952 |
| 4 | JGI24035J26624_1001454 | 3300002126 | Unclassified | 2234 |
| 5 | JGI24033J26618_1012455 | 3300002155 | Unclassified | 1024 |
| 6 | JGI24034J26672_10004940 | 3300002239 | Bacteria | 1902 |
| 7 | JGI25151J46595_10065294 | 3300003187 | Bacteria | 1134 |
| 8 | rootH2_10183680 | 3300003320 | Unclassified | 1066 |
| 9 | Ga0065715_10089111 | 3300005293 | Bacteria | 14157 |
| 10 | Ga0070658_10257845 | 3300005327 | Bacteria | 1480 |
| 11 | Ga0070676_10001093 | 3300005328 | Bacteria | 13538 |
| 12 | Ga0070670_100001915 | 3300005331 | Bacteria | 17030 |
| 13 | Ga0070677_10000673 | 3300005333 | Bacteria | 11446 |
| 14 | Ga0070680_100002877 | 3300005336 | Bacteria | 12790 |
| 15 | Ga0070680_101518242 | 3300005336 | Unclassified | 580 |
| 16 | Ga0068868_100042108 | 3300005338 | Bacteria | 3562 |
| 17 | Ga0070689_100001772 | 3300005340 | Bacteria | 13849 |
| 18 | Ga0070691_10065777 | 3300005341 | Bacteria | 1751 |
| 19 | Ga0070661_100012721 | 3300005344 | Bacteria | 5889 |
| 20 | Ga0070661_100551393 | 3300005344 | Bacteria | 927 |
| 21 | Ga0070661_100556687 | 3300005344 | Unclassified | 923 |
| 22 | Ga0070692_10057453 | 3300005345 | Bacteria | 2040 |
| 23 | Ga0070668_100004325 | 3300005347 | Bacteria | 10538 |
| 24 | Ga0070675_100004322 | 3300005354 | Bacteria | 10833 |
| 25 | Ga0070673_100044421 | 3300005364 | Bacteria | 3440 |
| 26 | Ga0070673_101698534 | 3300005364 | Unclassified | 597 |
| 27 | Ga0070667_100002086 | 3300005367 | Bacteria | 17652 |
| 28 | Ga0070709_10063420 | 3300005434 | Bacteria | 2360 |
| 29 | Ga0070709_10187486 | 3300005434 | Bacteria | 1457 |
| 30 | Ga0070709_11217811 | 3300005434 | Bacteria | 605 |
| 31 | Ga0070713_100148245 | 3300005436 | Unclassified | 2085 |
| 32 | Ga0070713_100285540 | 3300005436 | Unclassified | 1515 |
| 33 | Ga0070710_10105894 | 3300005437 | Unclassified | 1682 |
| 34 | Ga0070711_100806889 | 3300005439 | Bacteria | 796 |
| 35 | Ga0070711_101364568 | 3300005439 | Unclassified | 616 |
| 36 | Ga0070705_100000846 | 3300005440 | Bacteria | 17178 |
| 37 | Ga0070694_100001086 | 3300005444 | Bacteria | 15580 |
| 38 | Ga0070694_100577350 | 3300005444 | Bacteria | 903 |
| 39 | Ga0070708_101350130 | 3300005445 | Unclassified | 665 |
| 40 | Ga0070663_100001915 | 3300005455 | Bacteria | 11618 |
| 41 | Ga0070678_100035164 | 3300005456 | Bacteria | 3496 |
| 42 | Ga0070678_100041959 | 3300005456 | Bacteria | 3248 |
| 43 | Ga0070681_10002452 | 3300005458 | Bacteria | 16987 |
| 44 | Ga0070681_10398433 | 3300005458 | Unclassified | 1288 |
| 45 | Ga0070685_10002220 | 3300005466 | Bacteria | 10017 |
| 46 | Ga0070679_100002448 | 3300005530 | Bacteria | 16825 |
| 47 | Ga0070679_100012659 | 3300005530 | Bacteria | 8068 |
| 48 | Ga0070684_100003685 | 3300005535 | Bacteria | 11560 |
| 49 | Ga0070684_100911330 | 3300005535 | Bacteria | 824 |
| 50 | Ga0068853_100021324 | 3300005539 | Bacteria | 5400 |
| 51 | Ga0068853_100025723 | 3300005539 | Bacteria | 4940 |
| 52 | Ga0068853_100051500 | 3300005539 | Bacteria | 3543 |
| 53 | Ga0070695_100002314 | 3300005545 | Bacteria | 10922 |
| 54 | Ga0070695_100009528 | 3300005545 | Bacteria | 5786 |
| 55 | Ga0070696_100004825 | 3300005546 | Bacteria | 9010 |
| 56 | Ga0070696_100125571 | 3300005546 | Bacteria | 1861 |
| 57 | Ga0070693_100000440 | 3300005547 | Bacteria | 18687 |
| 58 | Ga0070693_100012174 | 3300005547 | Bacteria | 4349 |
| 59 | Ga0070693_100596358 | 3300005547 | Bacteria | 797 |
| 60 | Ga0070665_100016534 | 3300005548 | Bacteria | 7398 |
| 61 | Ga0070665_100986136 | 3300005548 | Bacteria | 855 |
| 62 | Ga0070665_101871323 | 3300005548 | Bacteria | 606 |
| 63 | Ga0070704_100001395 | 3300005549 | Bacteria | 12854 |
| 64 | Ga0068855_100049862 | 3300005563 | Bacteria | 4936 |
| 65 | Ga0068855_100056646 | 3300005563 | Bacteria | 4598 |
| 66 | Ga0068855_100276708 | 3300005563 | Bacteria | 1865 |
| 67 | Ga0068855_100954994 | 3300005563 | Bacteria | 903 |
| 68 | Ga0070664_100232331 | 3300005564 | Bacteria | 1653 |
| 69 | Ga0070664_100327182 | 3300005564 | Bacteria | 1390 |
| 70 | Ga0068857_100003109 | 3300005577 | Bacteria | 13733 |
| 71 | Ga0068854_100002460 | 3300005578 | Bacteria | 11468 |
| 72 | Ga0068854_100096747 | 3300005578 | Bacteria | 2206 |
| 73 | Ga0068856_100000981 | 3300005614 | Bacteria | 30429 |
| 74 | Ga0070702_100000610 | 3300005615 | Bacteria | 13160 |
| 75 | Ga0068852_100024523 | 3300005616 | Bacteria | 4877 |
| 76 | Ga0068852_100561296 | 3300005616 | Bacteria | 1143 |
| 77 | Ga0068859_100009878 | 3300005617 | Bacteria | 9636 |
| 78 | Ga0068866_10001194 | 3300005718 | Bacteria | 11326 |
| 79 | Ga0068861_100062271 | 3300005719 | Bacteria | 2865 |
| 80 | Ga0068870_10000882 | 3300005840 | Bacteria | 11716 |
| 81 | Ga0068858_100033902 | 3300005842 | Bacteria | 4736 |
| 82 | Ga0068860_100065863 | 3300005843 | Bacteria | 3440 |
| 83 | Ga0068862_100080749 | 3300005844 | Bacteria | 2820 |
| 84 | Ga0081455_10100438 | 3300005937 | Bacteria | 2325 |
| 85 | Ga0081455_10299321 | 3300005937 | Bacteria | 1155 |
| 86 | Ga0081540_1048754 | 3300005983 | Unclassified | 2118 |
| 87 | Ga0081539_10003119 | 3300005985 | Bacteria | 21171 |
| 88 | Ga0075364_10294288 | 3300006051 | Bacteria | 1105 |
| 89 | Ga0070715_10685478 | 3300006163 | Bacteria | 610 |
| 90 | Ga0070716_100523087 | 3300006173 | Bacteria | 879 |
| 91 | Ga0075362_10732232 | 3300006177 | Bacteria | 517 |
| 92 | Ga0075367_10005767 | 3300006178 | Bacteria | 6193 |
| 93 | Ga0075369_10008573 | 3300006186 | Bacteria | 3938 |
| 94 | Ga0097621_100187587 | 3300006237 | Bacteria | 1789 |
| 95 | Ga0097621_102260893 | 3300006237 | Unclassified | 520 |
| 96 | Ga0075370_10703487 | 3300006353 | Unclassified | 614 |
| 97 | Ga0075434_100027785 | 3300006871 | Bacteria | 5555 |
| 98 | Ga0075434_100355273 | 3300006871 | Bacteria | 1486 |
| 99 | Ga0068865_100002124 | 3300006881 | Bacteria | 11706 |
| 100 | Ga0075436_100032538 | 3300006914 | Bacteria | 3595 |
| 101 | Ga0075436_100328296 | 3300006914 | Bacteria | 1100 |
| 102 | Ga0075436_101308913 | 3300006914 | Bacteria | 548 |
| 103 | Ga0075436_101441672 | 3300006914 | Unclassified | 522 |
| 104 | Ga0097620_100009878 | 3300006931 | Bacteria | 9636 |
| 105 | Ga0075435_100045425 | 3300007076 | Bacteria | 3521 |
| 106 | Ga0099794_10024910 | 3300007265 | Bacteria | 2750 |
| 107 | Ga0105240_10002399 | 3300009093 | Bacteria | 30138 |
| 108 | Ga0105240_10449103 | 3300009093 | Bacteria | 1443 |
| 109 | Ga0105240_10967213 | 3300009093 | Bacteria | 912 |
| 110 | Ga0105240_11097854 | 3300009093 | Unclassified | 847 |
| 111 | Ga0105243_10213926 | 3300009148 | Bacteria | 1699 |
| 112 | Ga0105241_10052353 | 3300009174 | Bacteria | 3116 |
| 113 | Ga0105241_10163162 | 3300009174 | Bacteria | 1834 |
| 114 | Ga0105242_10117328 | 3300009176 | Bacteria | 2278 |
| 115 | Ga0105242_12708064 | 3300009176 | Unclassified | 546 |
| 116 | Ga0105237_10008584 | 3300009545 | Bacteria | 11048 |
| 117 | Ga0105237_10057156 | 3300009545 | Bacteria | 3905 |
| 118 | Ga0105237_10072752 | 3300009545 | Bacteria | 3431 |
| 119 | Ga0105237_12216414 | 3300009545 | Bacteria | 559 |
| 120 | Ga0105238_10003010 | 3300009551 | Bacteria | 16825 |
| 121 | Ga0105238_10024943 | 3300009551 | Bacteria | 6094 |
| 122 | Ga0105238_10074983 | 3300009551 | Bacteria | 3375 |
| 123 | Ga0105238_10497332 | 3300009551 | Bacteria | 1220 |
| 124 | Ga0105238_10991726 | 3300009551 | Bacteria | 861 |
| 125 | Ga0105238_11066513 | 3300009551 | Unclassified | 830 |
| 126 | Ga0105239_10010784 | 3300010375 | Bacteria | 10208 |
| 127 | Ga0105239_10021705 | 3300010375 | Bacteria | 7078 |
| 128 | Ga0105239_11846798 | 3300010375 | Bacteria | 700 |
| 129 | Ga0105246_10602450 | 3300011119 | Bacteria | 950 |
| 130 | Ga0157373_10014747 | 3300013100 | Bacteria | 5724 |
| 131 | Ga0157373_10105657 | 3300013100 | Unclassified | 1980 |
| 132 | Ga0157370_10015096 | 3300013104 | Bacteria | 7870 |
| 133 | Ga0157369_10055035 | 3300013105 | Bacteria | 4295 |
| 134 | Ga0157369_10128279 | 3300013105 | Bacteria | 2688 |
| 135 | Ga0157369_10307104 | 3300013105 | Bacteria | 1650 |
| 136 | Ga0157369_10800452 | 3300013105 | Unclassified | 968 |
| 137 | Ga0157374_10019420 | 3300013296 | Bacteria | 6015 |
| 138 | Ga0157378_11097047 | 3300013297 | Bacteria | 833 |
| 139 | Ga0163162_10456792 | 3300013306 | Bacteria | 1409 |
| 140 | Ga0157372_10022706 | 3300013307 | Bacteria | 6791 |
| 141 | Ga0163163_10266595 | 3300014325 | Bacteria | 1764 |
| 142 | Ga0182008_10259297 | 3300014497 | Bacteria | 899 |
| 143 | Ga0157377_10804750 | 3300014745 | Bacteria | 693 |
| 144 | Ga0157379_10000866 | 3300014968 | Bacteria | 24506 |
| 145 | Ga0157379_10742246 | 3300014968 | Bacteria | 924 |
| 146 | Ga0157376_12474914 | 3300014969 | Unclassified | 559 |
| 147 | Ga0182007_10128483 | 3300015262 | Bacteria | 851 |
| 148 | Ga0163161_10003041 | 3300017792 | Bacteria | 11844 |
| 149 | Ga0206352_10014901 | 3300020078 | Bacteria | 1953 |
| 150 | Ga0206350_10050191 | 3300020080 | Bacteria | 730 |
| 151 | Ga0206353_11966671 | 3300020082 | Unclassified | 1112 |
| 152 | Ga0213876_10000353 | 3300021384 | Bacteria | 39594 |
| 153 | Ga0209233_1026773 | 3300025261 | Bacteria | 1405 |
| 154 | Ga0207666_1000118 | 3300025271 | Bacteria | 12331 |
| 155 | Ga0209025_1009372 | 3300025294 | Bacteria | 6842 |
| 156 | Ga0207697_10018738 | 3300025315 | Bacteria | 2837 |
| 157 | Ga0207696_1200462 | 3300025711 | Unclassified | 524 |
| 158 | Ga0207653_10092490 | 3300025885 | Bacteria | 1061 |
| 159 | Ga0207682_10028087 | 3300025893 | Unclassified | 2244 |
| 160 | Ga0207642_10653086 | 3300025899 | Unclassified | 659 |
| 161 | Ga0207688_10001670 | 3300025901 | Bacteria | 11744 |
| 162 | Ga0207680_10008493 | 3300025903 | Bacteria | 5044 |
| 163 | Ga0207647_10065846 | 3300025904 | Unclassified | 2198 |
| 164 | Ga0207685_10687631 | 3300025905 | Unclassified | 556 |
| 165 | Ga0207699_10027497 | 3300025906 | Bacteria | 3150 |
| 166 | Ga0207699_10209030 | 3300025906 | Bacteria | 1326 |
| 167 | Ga0207699_10879151 | 3300025906 | Bacteria | 661 |
| 168 | Ga0207645_10003532 | 3300025907 | Bacteria | 11827 |
| 169 | Ga0207705_10197407 | 3300025909 | Bacteria | 1524 |
| 170 | Ga0207705_11544006 | 3300025909 | Unclassified | 502 |
| 171 | Ga0207654_10007395 | 3300025911 | Bacteria | 5531 |
| 172 | Ga0207654_10113188 | 3300025911 | Bacteria | 1692 |
| 173 | Ga0207654_10227397 | 3300025911 | Bacteria | 1241 |
| 174 | Ga0207654_10580077 | 3300025911 | Unclassified | 799 |
| 175 | Ga0207695_10013007 | 3300025913 | Bacteria | 9942 |
| 176 | Ga0207695_10016369 | 3300025913 | Bacteria | 8678 |
| 177 | Ga0207695_10139360 | 3300025913 | Bacteria | 2376 |
| 178 | Ga0207695_11408111 | 3300025913 | Bacteria | 577 |
| 179 | Ga0207671_10056219 | 3300025914 | Bacteria | 2915 |
| 180 | Ga0207671_10142134 | 3300025914 | Bacteria | 1850 |
| 181 | Ga0207671_10228104 | 3300025914 | Bacteria | 1461 |
| 182 | Ga0207671_10549533 | 3300025914 | Bacteria | 921 |
| 183 | Ga0207660_10063758 | 3300025917 | Bacteria | 2658 |
| 184 | Ga0207660_10489399 | 3300025917 | Bacteria | 997 |
| 185 | Ga0207660_10913230 | 3300025917 | Unclassified | 716 |
| 186 | Ga0207662_10001335 | 3300025918 | Bacteria | 11894 |
| 187 | Ga0207657_10002335 | 3300025919 | Bacteria | 20572 |
| 188 | Ga0207649_10010111 | 3300025920 | Bacteria | 5176 |
| 189 | Ga0207652_10004859 | 3300025921 | Bacteria | 10884 |
| 190 | Ga0207652_10214845 | 3300025921 | Bacteria | 1732 |
| 191 | Ga0207694_10038806 | 3300025924 | Bacteria | 3662 |
| 192 | Ga0207694_10040152 | 3300025924 | Bacteria | 3602 |
| 193 | Ga0207694_10553074 | 3300025924 | Bacteria | 966 |
| 194 | Ga0207650_10001608 | 3300025925 | Bacteria | 16135 |
| 195 | Ga0207659_10002534 | 3300025926 | Bacteria | 10876 |
| 196 | Ga0207700_10159691 | 3300025928 | Unclassified | 1871 |
| 197 | Ga0207664_10406895 | 3300025929 | Bacteria | 1211 |
| 198 | Ga0207644_10001533 | 3300025931 | Bacteria | 14887 |
| 199 | Ga0207706_10219554 | 3300025933 | Bacteria | 1665 |
| 200 | Ga0207686_10001672 | 3300025934 | Bacteria | 12348 |
| 201 | Ga0207686_10015935 | 3300025934 | Bacteria | 4212 |
| 202 | Ga0207709_10001657 | 3300025935 | Bacteria | 15039 |
| 203 | Ga0207704_10043578 | 3300025938 | Bacteria | 2651 |
| 204 | Ga0207691_10197305 | 3300025940 | Unclassified | 1753 |
| 205 | Ga0207711_10012475 | 3300025941 | Bacteria | 7062 |
| 206 | Ga0207689_10081433 | 3300025942 | Bacteria | 2661 |
| 207 | Ga0207661_10001714 | 3300025944 | Bacteria | 14988 |
| 208 | Ga0207679_10745717 | 3300025945 | Unclassified | 890 |
| 209 | Ga0207667_10014360 | 3300025949 | Bacteria | 9033 |
| 210 | Ga0207667_10016697 | 3300025949 | Bacteria | 8284 |
| 211 | Ga0207667_10178136 | 3300025949 | Bacteria | 2183 |
| 212 | Ga0207667_10236756 | 3300025949 | Bacteria | 1869 |
| 213 | Ga0207667_10781180 | 3300025949 | Bacteria | 953 |
| 214 | Ga0207712_10001926 | 3300025961 | Bacteria | 13642 |
| 215 | Ga0207640_10212248 | 3300025981 | Bacteria | 1476 |
| 216 | Ga0207658_10003452 | 3300025986 | Bacteria | 11185 |
| 217 | Ga0207703_10004354 | 3300026035 | Bacteria | 11638 |
| 218 | Ga0207639_10006880 | 3300026041 | Bacteria | 7745 |
| 219 | Ga0207639_10195786 | 3300026041 | Bacteria | 1730 |
| 220 | Ga0207639_10351147 | 3300026041 | Unclassified | 1317 |
| 221 | Ga0207678_10086958 | 3300026067 | Bacteria | 2671 |
| 222 | Ga0207708_10072775 | 3300026075 | Bacteria | 2634 |
| 223 | Ga0207702_10000920 | 3300026078 | Bacteria | 30428 |
| 224 | Ga0207702_10118564 | 3300026078 | Bacteria | 2365 |
| 225 | Ga0207702_11204366 | 3300026078 | Bacteria | 751 |
| 226 | Ga0207702_11953772 | 3300026078 | Unclassified | 577 |
| 227 | Ga0207648_10003605 | 3300026089 | Bacteria | 16194 |
| 228 | Ga0207674_10000059 | 3300026116 | Bacteria | 112995 |
| 229 | Ga0207674_10008622 | 3300026116 | Bacteria | 11753 |
| 230 | Ga0207675_100003889 | 3300026118 | Bacteria | 14515 |
| 231 | Ga0207683_10083581 | 3300026121 | Bacteria | 2837 |
| 232 | Ga0210002_1047030 | 3300027617 | Unclassified | 739 |
| 233 | Ga0209588_1070966 | 3300027671 | Unclassified | 1125 |
| 234 | Ga0209998_10135759 | 3300027717 | Unclassified | 626 |
| 235 | Ga0268266_10012084 | 3300028379 | Bacteria | 7472 |
| 236 | Ga0268265_10002822 | 3300028380 | Bacteria | 12777 |
| 237 | Ga0268264_10019774 | 3300028381 | Bacteria | 5500 |
| 238 | Ga0265337_1129876 | 3300028556 | Unclassified | 683 |
| 239 | Ga0265318_10000364 | 3300028577 | Bacteria | 35727 |
| 240 | Ga0265338_10110519 | 3300028800 | Bacteria | 2215 |
| 241 | Ga0265338_10156422 | 3300028800 | Bacteria | 1765 |
| 242 | Ga0265325_10003900 | 3300031241 | Bacteria | 9564 |
| 243 | Ga0265339_10007001 | 3300031249 | Bacteria | 7330 |
| 244 | Ga0265339_10042381 | 3300031249 | Bacteria | 2520 |
| 245 | Ga0265331_10087145 | 3300031250 | Bacteria | 1446 |
| 246 | Ga0265316_10076167 | 3300031344 | Bacteria | 2578 |
| 247 | Ga0265316_10305663 | 3300031344 | Bacteria | 1158 |
| 248 | Ga0265313_10030635 | 3300031595 | Bacteria | 2767 |
| 249 | Ga0265314_10041778 | 3300031711 | Bacteria | 3278 |
| 250 | Ga0326468_10091037 | 3300031889 | Unclassified | 545 |
| 251 | Ga0373928_0220842 | 3300035084 | Bacteria | 554 |
| 252 | Ga0373939_0373865 | 3300035114 | Unclassified | 585 |
| 253 | Ga0373942_0189847 | 3300035207 | Unclassified | 677 |
| 254 | Ga0373942_0347688 | 3300035207 | Bacteria | 523 |
| 255 | Ga0395899_0049735 | 3300037312 | Bacteria | 3115 |
| 256 | Ga0436365_1581020 | 3300039437 | Bacteria | 55576 |
| 257 | Ga0436365_1823749 | 3300039437 | Bacteria | 6522 |
| 258 | Ga0439465_0030256 | 3300041413 | Unclassified | 1722 |
| 259 | Ga0466966_1008539 | 3300044684 | Bacteria | 502 |
| 260 | Ga0466957_0404236 | 3300044842 | Bacteria | 934 |
| 261 | Ga0495592_0370596 | 3300046454 | Bacteria | 914 |
| 262 | Ga0495602_0297531 | 3300048088 | Bacteria | 1182 |
| 263 | Ga0501032_0113289 | 3300049569 | Bacteria | 1794 |
| 264 | Ga0501033_0188758 | 3300049570 | Bacteria | 1475 |
| 265 | Ga0501034_1680852 | 3300049571 | Bacteria | 507 |
| 266 | Ga0501037_0285954 | 3300049573 | Bacteria | 1148 |
| 267 | Ga0501043_0730082 | 3300049579 | Bacteria | 721 |
| 268 | Ga0501047_0040826 | 3300049581 | Bacteria | 4486 |
| 269 | Ga0501047_0152104 | 3300049581 | Bacteria | 2190 |
| 270 | Ga0501035_0001400 | 3300049822 | Bacteria | 24762 |
| 271 | Ga0501035_0194345 | 3300049822 | Bacteria | 1743 |
| 272 | Ga0501044_0008669 | 3300049823 | Bacteria | 11135 |
| 273 | Ga0501044_0011838 | 3300049823 | Bacteria | 9452 |
| 274 | Ga0501044_0105535 | 3300049823 | Bacteria | 2830 |
| 275 | nmdc:mga03683_21787_c1 | 3300050489 | Bacteria | 2476 |
| 276 | nmdc:mga00v17_326453_c1 | 3300050491 | Bacteria | 997 |
| 277 | nmdc:mga06z11_255414_c1 | 3300050494 | Bacteria | 1033 |
| 278 | nmdc:mga0n895_809237_c1 | 3300050512 | Bacteria | 927 |
| 279 | nmdc:mga0rr50_45051_c1 | 3300050513 | Unclassified | 3239 |
| 280 | nmdc:mga0sz30_39164_c1 | 3300050516 | Bacteria | 1687 |
| 281 | Ga0500651_0260699 | 3300053093 | Bacteria | 1005 |
| 282 | Ga0500559_0503985 | 3300053136 | Bacteria | 556 |
| 283 | Ga0500568_0035878 | 3300053139 | Bacteria | 2021 |
| 284 | Ga0500568_0316363 | 3300053139 | Bacteria | 566 |
| 285 | Ga0500616_0001792 | 3300053153 | Bacteria | 19568 |
| 286 | Ga0500636_0516788 | 3300053177 | Unclassified | 524 |
| 287 | Ga0501082_1323698 | 3300060353 | Unclassified | 629 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028800 | Ga0265338_10110519 | Ga0265338_101105192 | 68 |
| 2 | 3300005436 | Ga0070713_100285540 | Ga0070713_1002855403 | 69 |
| 3 | 3300009551 | Ga0105238_11066513 | Ga0105238_110665132 | 69 |
| 4 | 3300013105 | Ga0157369_10307104 | Ga0157369_103071044 | 69 |
| 5 | 3300005364 | Ga0070673_101698534 | Ga0070673_1016985342 | 70 |
| 6 | 3300005456 | Ga0070678_100035164 | Ga0070678_1000351644 | 70 |
| 7 | 3300006163 | Ga0070715_10685478 | Ga0070715_106854782 | 70 |
| 8 | 3300006237 | Ga0097621_102260893 | Ga0097621_1022608931 | 70 |
| 9 | 3300025261 | Ga0209233_1026773 | Ga0209233_10267733 | 71 |
| 10 | 3300028556 | Ga0265337_1129876 | Ga0265337_11298761 | 71 |
| 11 | 3300028577 | Ga0265318_10000364 | Ga0265318_1000036430 | 71 |
| 12 | iso_pu_bacteria | 2643221736 | 2644746416 | 71 |
| 13 | 3300009093 | Ga0105240_11097854 | Ga0105240_110978541 | 72 |
| 14 | 3300005344 | Ga0070661_100556687 | Ga0070661_1005566872 | 73 |
| 15 | 3300005530 | Ga0070679_100012659 | Ga0070679_10001265912 | 73 |
| 16 | 3300005937 | Ga0081455_10100438 | Ga0081455_101004381 | 73 |
| 17 | 3300005983 | Ga0081540_1048754 | Ga0081540_10487544 | 73 |
| 18 | 3300005985 | Ga0081539_10003119 | Ga0081539_1000311914 | 73 |
| 19 | 3300013297 | Ga0157378_11097047 | Ga0157378_110970472 | 73 |
| 20 | 3300025909 | Ga0207705_11544006 | Ga0207705_115440061 | 73 |
| 21 | 3300025917 | Ga0207660_10489399 | Ga0207660_104893992 | 73 |
| 22 | 3300025921 | Ga0207652_10214845 | Ga0207652_102148454 | 73 |
| 23 | 3300026078 | Ga0207702_11953772 | Ga0207702_119537722 | 73 |
| 24 | 3300028800 | Ga0265338_10156422 | Ga0265338_101564223 | 73 |
| 25 | 3300031241 | Ga0265325_10003900 | Ga0265325_100039004 | 73 |
| 26 | 3300031249 | Ga0265339_10007001 | Ga0265339_100070017 | 73 |
| 27 | 3300031250 | Ga0265331_10087145 | Ga0265331_100871454 | 73 |
| 28 | 3300031344 | Ga0265316_10305663 | Ga0265316_103056633 | 73 |
| 29 | 3300031595 | Ga0265313_10030635 | Ga0265313_100306355 | 73 |
| 30 | 3300031711 | Ga0265314_10041778 | Ga0265314_100417785 | 73 |
| 31 | 3300005434 | Ga0070709_10187486 | Ga0070709_101874862 | 74 |
| 32 | 3300005434 | Ga0070709_11217811 | Ga0070709_112178111 | 74 |
| 33 | 3300005436 | Ga0070713_100148245 | Ga0070713_1001482455 | 74 |
| 34 | 3300005437 | Ga0070710_10105894 | Ga0070710_101058943 | 74 |
| 35 | 3300005439 | Ga0070711_100806889 | Ga0070711_1008068891 | 74 |
| 36 | 3300005458 | Ga0070681_10398433 | Ga0070681_103984332 | 74 |
| 37 | 3300006173 | Ga0070716_100523087 | Ga0070716_1005230871 | 74 |
| 38 | 3300006871 | Ga0075434_100027785 | Ga0075434_1000277852 | 74 |
| 39 | 3300006914 | Ga0075436_100328296 | Ga0075436_1003282962 | 74 |
| 40 | 3300006914 | Ga0075436_101308913 | Ga0075436_1013089131 | 74 |
| 41 | 3300007076 | Ga0075435_100045425 | Ga0075435_1000454253 | 74 |
| 42 | 3300007265 | Ga0099794_10024910 | Ga0099794_100249102 | 74 |
| 43 | 3300013100 | Ga0157373_10105657 | Ga0157373_101056573 | 74 |
| 44 | 3300013105 | Ga0157369_10800452 | Ga0157369_108004521 | 74 |
| 45 | 3300025905 | Ga0207685_10687631 | Ga0207685_106876311 | 74 |
| 46 | 3300025906 | Ga0207699_10209030 | Ga0207699_102090302 | 74 |
| 47 | 3300025906 | Ga0207699_10879151 | Ga0207699_108791511 | 74 |
| 48 | 3300025928 | Ga0207700_10159691 | Ga0207700_101596911 | 74 |
| 49 | 3300027671 | Ga0209588_1070966 | Ga0209588_10709662 | 74 |
| 50 | 3300031889 | Ga0326468_10091037 | Ga0326468_100910372 | 74 |
| 51 | 3300035084 | Ga0373928_0220842 | Ga0373928_0220842_303_536 | 74 |
| 52 | 3300035114 | Ga0373939_0373865 | Ga0373939_0373865_104_337 | 74 |
| 53 | 3300035207 | Ga0373942_0189847 | Ga0373942_0189847_171_437 | 74 |
| 54 | 3300041413 | Ga0439465_0030256 | Ga0439465_0030256_347_580 | 74 |
| 55 | 3300048088 | Ga0495602_0297531 | Ga0495602_0297531_882_1121 | 74 |
| 56 | 3300050512 | nmdc:mga0n895_809237_c1 | nmdc:mga0n895_809237_c1_77_307 | 74 |
| 57 | 3300050513 | nmdc:mga0rr50_45051_c1 | nmdc:mga0rr50_45051_c1_2785_3015 | 74 |
| 58 | 3300053139 | Ga0500568_0035878 | Ga0500568_0035878_954_1196 | 74 |
| 59 | 3300053177 | Ga0500636_0516788 | Ga0500636_0516788_239_472 | 74 |
| 60 | 3300003187 | JGI25151J46595_10065294 | JGI25151J46595_100652942 | 75 |
| 61 | 3300003320 | rootH2_10183680 | rootH2_101836801 | 75 |
| 62 | 3300005327 | Ga0070658_10257845 | Ga0070658_102578452 | 75 |
| 63 | 3300005439 | Ga0070711_101364568 | Ga0070711_1013645681 | 75 |
| 64 | 3300005535 | Ga0070684_100911330 | Ga0070684_1009113301 | 75 |
| 65 | 3300005539 | Ga0068853_100051500 | Ga0068853_1000515004 | 75 |
| 66 | 3300005547 | Ga0070693_100596358 | Ga0070693_1005963581 | 75 |
| 67 | 3300005548 | Ga0070665_100986136 | Ga0070665_1009861361 | 75 |
| 68 | 3300005548 | Ga0070665_101871323 | Ga0070665_1018713231 | 75 |
| 69 | 3300005563 | Ga0068855_100056646 | Ga0068855_1000566468 | 75 |
| 70 | 3300005563 | Ga0068855_100276708 | Ga0068855_1002767084 | 75 |
| 71 | 3300005616 | Ga0068852_100561296 | Ga0068852_1005612963 | 75 |
| 72 | 3300005937 | Ga0081455_10299321 | Ga0081455_102993214 | 75 |
| 73 | 3300006051 | Ga0075364_10294288 | Ga0075364_102942883 | 75 |
| 74 | 3300006177 | Ga0075362_10732232 | Ga0075362_107322321 | 75 |
| 75 | 3300006178 | Ga0075367_10005767 | Ga0075367_100057674 | 75 |
| 76 | 3300006186 | Ga0075369_10008573 | Ga0075369_100085735 | 75 |
| 77 | 3300009093 | Ga0105240_10449103 | Ga0105240_104491032 | 75 |
| 78 | 3300009093 | Ga0105240_10967213 | Ga0105240_109672131 | 75 |
| 79 | 3300009148 | Ga0105243_10213926 | Ga0105243_102139263 | 75 |
| 80 | 3300009174 | Ga0105241_10052353 | Ga0105241_100523534 | 75 |
| 81 | 3300009174 | Ga0105241_10163162 | Ga0105241_101631623 | 75 |
| 82 | 3300009176 | Ga0105242_12708064 | Ga0105242_127080641 | 75 |
| 83 | 3300009545 | Ga0105237_10057156 | Ga0105237_100571564 | 75 |
| 84 | 3300009545 | Ga0105237_10072752 | Ga0105237_100727524 | 75 |
| 85 | 3300009545 | Ga0105237_12216414 | Ga0105237_122164141 | 75 |
| 86 | 3300009551 | Ga0105238_10024943 | Ga0105238_100249439 | 75 |
| 87 | 3300009551 | Ga0105238_10074983 | Ga0105238_100749833 | 75 |
| 88 | 3300009551 | Ga0105238_10497332 | Ga0105238_104973321 | 75 |
| 89 | 3300010375 | Ga0105239_10021705 | Ga0105239_100217055 | 75 |
| 90 | 3300010375 | Ga0105239_11846798 | Ga0105239_118467982 | 75 |
| 91 | 3300011119 | Ga0105246_10602450 | Ga0105246_106024501 | 75 |
| 92 | 3300013105 | Ga0157369_10128279 | Ga0157369_101282792 | 75 |
| 93 | 3300014745 | Ga0157377_10804750 | Ga0157377_108047501 | 75 |
| 94 | 3300014968 | Ga0157379_10742246 | Ga0157379_107422461 | 75 |
| 95 | 3300025294 | Ga0209025_1009372 | Ga0209025_10093723 | 75 |
| 96 | 3300025909 | Ga0207705_10197407 | Ga0207705_101974072 | 75 |
| 97 | 3300025911 | Ga0207654_10113188 | Ga0207654_101131882 | 75 |
| 98 | 3300025911 | Ga0207654_10580077 | Ga0207654_105800772 | 75 |
| 99 | 3300025913 | Ga0207695_10013007 | Ga0207695_100130072 | 75 |
| 100 | 3300025913 | Ga0207695_10016369 | Ga0207695_100163695 | 75 |
| 101 | 3300025913 | Ga0207695_11408111 | Ga0207695_114081112 | 75 |
| 102 | 3300025914 | Ga0207671_10056219 | Ga0207671_100562196 | 75 |
| 103 | 3300025914 | Ga0207671_10142134 | Ga0207671_101421344 | 75 |
| 104 | 3300025914 | Ga0207671_10549533 | Ga0207671_105495333 | 75 |
| 105 | 3300025924 | Ga0207694_10038806 | Ga0207694_100388061 | 75 |
| 106 | 3300025924 | Ga0207694_10553074 | Ga0207694_105530742 | 75 |
| 107 | 3300025929 | Ga0207664_10406895 | Ga0207664_104068953 | 75 |
| 108 | 3300025949 | Ga0207667_10014360 | Ga0207667_100143608 | 75 |
| 109 | 3300025949 | Ga0207667_10236756 | Ga0207667_102367561 | 75 |
| 110 | 3300026041 | Ga0207639_10195786 | Ga0207639_101957864 | 75 |
| 111 | 3300026078 | Ga0207702_11204366 | Ga0207702_112043663 | 75 |
| 112 | 3300026116 | Ga0207674_10008622 | Ga0207674_100086224 | 75 |
| 113 | 3300035207 | Ga0373942_0347688 | Ga0373942_0347688_136_411 | 75 |
| 114 | 3300037312 | Ga0395899_0049735 | Ga0395899_0049735_2848_3105 | 75 |
| 115 | 3300039437 | Ga0436365_1823749 | Ga0436365_1823749_475_756 | 75 |
| 116 | 3300044684 | Ga0466966_1008539 | Ga0466966_1008539_192_461 | 75 |
| 117 | 3300044842 | Ga0466957_0404236 | Ga0466957_0404236_58_321 | 75 |
| 118 | 3300049569 | Ga0501032_0113289 | Ga0501032_0113289_1263_1508 | 75 |
| 119 | 3300049570 | Ga0501033_0188758 | Ga0501033_0188758_305_550 | 75 |
| 120 | 3300049571 | Ga0501034_1680852 | Ga0501034_1680852_223_468 | 75 |
| 121 | 3300049581 | Ga0501047_0152104 | Ga0501047_0152104_1871_2116 | 75 |
| 122 | 3300049822 | Ga0501035_0001400 | Ga0501035_0001400_6387_6632 | 75 |
| 123 | 3300049823 | Ga0501044_0011838 | Ga0501044_0011838_2564_2809 | 75 |
| 124 | 3300049823 | Ga0501044_0105535 | Ga0501044_0105535_1617_1862 | 75 |
| 125 | 3300050489 | nmdc:mga03683_21787_c1 | nmdc:mga03683_21787_c1_36_269 | 75 |
| 126 | 3300050491 | nmdc:mga00v17_326453_c1 | nmdc:mga00v17_326453_c1_375_608 | 75 |
| 127 | 3300050494 | nmdc:mga06z11_255414_c1 | nmdc:mga06z11_255414_c1_620_853 | 75 |
| 128 | 3300050516 | nmdc:mga0sz30_39164_c1 | nmdc:mga0sz30_39164_c1_954_1187 | 75 |
| 129 | 3300053093 | Ga0500651_0260699 | Ga0500651_0260699_348_605 | 75 |
| 130 | 3300053136 | Ga0500559_0503985 | Ga0500559_0503985_229_486 | 75 |
| 131 | 3300053139 | Ga0500568_0316363 | Ga0500568_0316363_127_372 | 75 |
| 132 | 3300053153 | Ga0500616_0001792 | Ga0500616_0001792_1357_1590 | 75 |
| 133 | 3300001430 | JGI24032J14994_103303 | JGI24032J14994_1033031 | 76 |
| 134 | 3300001990 | JGI24737J22298_10003091 | JGI24737J22298_100030916 | 76 |
| 135 | 3300002075 | JGI24738J21930_10040033 | JGI24738J21930_100400332 | 76 |
| 136 | 3300002126 | JGI24035J26624_1001454 | JGI24035J26624_10014542 | 76 |
| 137 | 3300002155 | JGI24033J26618_1012455 | JGI24033J26618_10124551 | 76 |
| 138 | 3300002239 | JGI24034J26672_10004940 | JGI24034J26672_100049404 | 76 |
| 139 | 3300005293 | Ga0065715_10089111 | Ga0065715_1008911111 | 76 |
| 140 | 3300005328 | Ga0070676_10001093 | Ga0070676_100010936 | 76 |
| 141 | 3300005331 | Ga0070670_100001915 | Ga0070670_10000191514 | 76 |
| 142 | 3300005333 | Ga0070677_10000673 | Ga0070677_100006734 | 76 |
| 143 | 3300005336 | Ga0070680_100002877 | Ga0070680_10000287713 | 76 |
| 144 | 3300005336 | Ga0070680_101518242 | Ga0070680_1015182421 | 76 |
| 145 | 3300005338 | Ga0068868_100042108 | Ga0068868_1000421082 | 76 |
| 146 | 3300005340 | Ga0070689_100001772 | Ga0070689_10000177212 | 76 |
| 147 | 3300005341 | Ga0070691_10065777 | Ga0070691_100657773 | 76 |
| 148 | 3300005344 | Ga0070661_100012721 | Ga0070661_1000127218 | 76 |
| 149 | 3300005344 | Ga0070661_100551393 | Ga0070661_1005513931 | 76 |
| 150 | 3300005345 | Ga0070692_10057453 | Ga0070692_100574533 | 76 |
| 151 | 3300005347 | Ga0070668_100004325 | Ga0070668_1000043253 | 76 |
| 152 | 3300005354 | Ga0070675_100004322 | Ga0070675_10000432211 | 76 |
| 153 | 3300005364 | Ga0070673_100044421 | Ga0070673_1000444215 | 76 |
| 154 | 3300005367 | Ga0070667_100002086 | Ga0070667_1000020869 | 76 |
| 155 | 3300005434 | Ga0070709_10063420 | Ga0070709_100634204 | 76 |
| 156 | 3300005440 | Ga0070705_100000846 | Ga0070705_10000084612 | 76 |
| 157 | 3300005444 | Ga0070694_100001086 | Ga0070694_1000010867 | 76 |
| 158 | 3300005444 | Ga0070694_100577350 | Ga0070694_1005773501 | 76 |
| 159 | 3300005445 | Ga0070708_101350130 | Ga0070708_1013501301 | 76 |
| 160 | 3300005455 | Ga0070663_100001915 | Ga0070663_10000191511 | 76 |
| 161 | 3300005456 | Ga0070678_100041959 | Ga0070678_1000419592 | 76 |
| 162 | 3300005458 | Ga0070681_10002452 | Ga0070681_100024528 | 76 |
| 163 | 3300005466 | Ga0070685_10002220 | Ga0070685_100022209 | 76 |
| 164 | 3300005530 | Ga0070679_100002448 | Ga0070679_1000024488 | 76 |
| 165 | 3300005535 | Ga0070684_100003685 | Ga0070684_1000036854 | 76 |
| 166 | 3300005539 | Ga0068853_100021324 | Ga0068853_1000213248 | 76 |
| 167 | 3300005539 | Ga0068853_100025723 | Ga0068853_1000257239 | 76 |
| 168 | 3300005545 | Ga0070695_100002314 | Ga0070695_10000231411 | 76 |
| 169 | 3300005545 | Ga0070695_100009528 | Ga0070695_1000095287 | 76 |
| 170 | 3300005546 | Ga0070696_100004825 | Ga0070696_1000048258 | 76 |
| 171 | 3300005546 | Ga0070696_100125571 | Ga0070696_1001255711 | 76 |
| 172 | 3300005547 | Ga0070693_100000440 | Ga0070693_10000044010 | 76 |
| 173 | 3300005547 | Ga0070693_100012174 | Ga0070693_1000121748 | 76 |
| 174 | 3300005548 | Ga0070665_100016534 | Ga0070665_1000165344 | 76 |
| 175 | 3300005549 | Ga0070704_100001395 | Ga0070704_1000013954 | 76 |
| 176 | 3300005563 | Ga0068855_100049862 | Ga0068855_1000498622 | 76 |
| 177 | 3300005563 | Ga0068855_100954994 | Ga0068855_1009549942 | 76 |
| 178 | 3300005564 | Ga0070664_100232331 | Ga0070664_1002323312 | 76 |
| 179 | 3300005564 | Ga0070664_100327182 | Ga0070664_1003271823 | 76 |
| 180 | 3300005577 | Ga0068857_100003109 | Ga0068857_10000310910 | 76 |
| 181 | 3300005578 | Ga0068854_100002460 | Ga0068854_10000246011 | 76 |
| 182 | 3300005578 | Ga0068854_100096747 | Ga0068854_1000967472 | 76 |
| 183 | 3300005614 | Ga0068856_100000981 | Ga0068856_1000009817 | 76 |
| 184 | 3300005615 | Ga0070702_100000610 | Ga0070702_10000061013 | 76 |
| 185 | 3300005616 | Ga0068852_100024523 | Ga0068852_1000245234 | 76 |
| 186 | 3300005617 | Ga0068859_100009878 | Ga0068859_1000098784 | 76 |
| 187 | 3300005718 | Ga0068866_10001194 | Ga0068866_100011944 | 76 |
| 188 | 3300005719 | Ga0068861_100062271 | Ga0068861_1000622715 | 76 |
| 189 | 3300005840 | Ga0068870_10000882 | Ga0068870_100008825 | 76 |
| 190 | 3300005842 | Ga0068858_100033902 | Ga0068858_1000339022 | 76 |
| 191 | 3300005843 | Ga0068860_100065863 | Ga0068860_1000658632 | 76 |
| 192 | 3300005844 | Ga0068862_100080749 | Ga0068862_1000807494 | 76 |
| 193 | 3300006237 | Ga0097621_100187587 | Ga0097621_1001875872 | 76 |
| 194 | 3300006353 | Ga0075370_10703487 | Ga0075370_107034872 | 76 |
| 195 | 3300006871 | Ga0075434_100355273 | Ga0075434_1003552732 | 76 |
| 196 | 3300006881 | Ga0068865_100002124 | Ga0068865_1000021244 | 76 |
| 197 | 3300006914 | Ga0075436_100032538 | Ga0075436_1000325382 | 76 |
| 198 | 3300006914 | Ga0075436_101441672 | Ga0075436_1014416721 | 76 |
| 199 | 3300006931 | Ga0097620_100009878 | Ga0097620_1000098784 | 76 |
| 200 | 3300009093 | Ga0105240_10002399 | Ga0105240_100023999 | 76 |
| 201 | 3300009176 | Ga0105242_10117328 | Ga0105242_101173282 | 76 |
| 202 | 3300009545 | Ga0105237_10008584 | Ga0105237_1000858414 | 76 |
| 203 | 3300009551 | Ga0105238_10003010 | Ga0105238_1000301012 | 76 |
| 204 | 3300009551 | Ga0105238_10991726 | Ga0105238_109917262 | 76 |
| 205 | 3300010375 | Ga0105239_10010784 | Ga0105239_100107842 | 76 |
| 206 | 3300013100 | Ga0157373_10014747 | Ga0157373_100147472 | 76 |
| 207 | 3300013104 | Ga0157370_10015096 | Ga0157370_1001509611 | 76 |
| 208 | 3300013105 | Ga0157369_10055035 | Ga0157369_100550355 | 76 |
| 209 | 3300013296 | Ga0157374_10019420 | Ga0157374_1001942011 | 76 |
| 210 | 3300013306 | Ga0163162_10456792 | Ga0163162_104567922 | 76 |
| 211 | 3300013307 | Ga0157372_10022706 | Ga0157372_1002270610 | 76 |
| 212 | 3300014325 | Ga0163163_10266595 | Ga0163163_102665952 | 76 |
| 213 | 3300014497 | Ga0182008_10259297 | Ga0182008_102592971 | 76 |
| 214 | 3300014968 | Ga0157379_10000866 | Ga0157379_1000086611 | 76 |
| 215 | 3300014969 | Ga0157376_12474914 | Ga0157376_124749142 | 76 |
| 216 | 3300015262 | Ga0182007_10128483 | Ga0182007_101284832 | 76 |
| 217 | 3300017792 | Ga0163161_10003041 | Ga0163161_1000304112 | 76 |
| 218 | 3300020078 | Ga0206352_10014901 | Ga0206352_100149011 | 76 |
| 219 | 3300020080 | Ga0206350_10050191 | Ga0206350_100501912 | 76 |
| 220 | 3300020082 | Ga0206353_11966671 | Ga0206353_119666712 | 76 |
| 221 | 3300021384 | Ga0213876_10000353 | Ga0213876_1000035338 | 76 |
| 222 | 3300025271 | Ga0207666_1000118 | Ga0207666_10001184 | 76 |
| 223 | 3300025315 | Ga0207697_10018738 | Ga0207697_100187385 | 76 |
| 224 | 3300025711 | Ga0207696_1200462 | Ga0207696_12004621 | 76 |
| 225 | 3300025885 | Ga0207653_10092490 | Ga0207653_100924901 | 76 |
| 226 | 3300025893 | Ga0207682_10028087 | Ga0207682_100280874 | 76 |
| 227 | 3300025899 | Ga0207642_10653086 | Ga0207642_106530861 | 76 |
| 228 | 3300025901 | Ga0207688_10001670 | Ga0207688_1000167011 | 76 |
| 229 | 3300025903 | Ga0207680_10008493 | Ga0207680_100084932 | 76 |
| 230 | 3300025904 | Ga0207647_10065846 | Ga0207647_100658464 | 76 |
| 231 | 3300025906 | Ga0207699_10027497 | Ga0207699_100274971 | 76 |
| 232 | 3300025907 | Ga0207645_10003532 | Ga0207645_1000353212 | 76 |
| 233 | 3300025911 | Ga0207654_10007395 | Ga0207654_100073957 | 76 |
| 234 | 3300025911 | Ga0207654_10227397 | Ga0207654_102273972 | 76 |
| 235 | 3300025913 | Ga0207695_10139360 | Ga0207695_101393604 | 76 |
| 236 | 3300025914 | Ga0207671_10228104 | Ga0207671_102281044 | 76 |
| 237 | 3300025917 | Ga0207660_10063758 | Ga0207660_100637584 | 76 |
| 238 | 3300025917 | Ga0207660_10913230 | Ga0207660_109132301 | 76 |
| 239 | 3300025918 | Ga0207662_10001335 | Ga0207662_1000133512 | 76 |
| 240 | 3300025919 | Ga0207657_10002335 | Ga0207657_100023359 | 76 |
| 241 | 3300025920 | Ga0207649_10010111 | Ga0207649_100101112 | 76 |
| 242 | 3300025921 | Ga0207652_10004859 | Ga0207652_100048593 | 76 |
| 243 | 3300025924 | Ga0207694_10040152 | Ga0207694_100401521 | 76 |
| 244 | 3300025925 | Ga0207650_10001608 | Ga0207650_100016088 | 76 |
| 245 | 3300025926 | Ga0207659_10002534 | Ga0207659_100025343 | 76 |
| 246 | 3300025931 | Ga0207644_10001533 | Ga0207644_100015337 | 76 |
| 247 | 3300025933 | Ga0207706_10219554 | Ga0207706_102195543 | 76 |
| 248 | 3300025934 | Ga0207686_10001672 | Ga0207686_1000167212 | 76 |
| 249 | 3300025934 | Ga0207686_10015935 | Ga0207686_100159352 | 76 |
| 250 | 3300025935 | Ga0207709_10001657 | Ga0207709_1000165713 | 76 |
| 251 | 3300025938 | Ga0207704_10043578 | Ga0207704_100435782 | 76 |
| 252 | 3300025940 | Ga0207691_10197305 | Ga0207691_101973053 | 76 |
| 253 | 3300025941 | Ga0207711_10012475 | Ga0207711_100124753 | 76 |
| 254 | 3300025942 | Ga0207689_10081433 | Ga0207689_100814334 | 76 |
| 255 | 3300025944 | Ga0207661_10001714 | Ga0207661_1000171411 | 76 |
| 256 | 3300025945 | Ga0207679_10745717 | Ga0207679_107457172 | 76 |
| 257 | 3300025949 | Ga0207667_10016697 | Ga0207667_1001669711 | 76 |
| 258 | 3300025949 | Ga0207667_10178136 | Ga0207667_101781363 | 76 |
| 259 | 3300025949 | Ga0207667_10781180 | Ga0207667_107811802 | 76 |
| 260 | 3300025961 | Ga0207712_10001926 | Ga0207712_100019263 | 76 |
| 261 | 3300025981 | Ga0207640_10212248 | Ga0207640_102122481 | 76 |
| 262 | 3300025986 | Ga0207658_10003452 | Ga0207658_100034524 | 76 |
| 263 | 3300026035 | Ga0207703_10004354 | Ga0207703_1000435411 | 76 |
| 264 | 3300026041 | Ga0207639_10006880 | Ga0207639_100068806 | 76 |
| 265 | 3300026041 | Ga0207639_10351147 | Ga0207639_103511472 | 76 |
| 266 | 3300026067 | Ga0207678_10086958 | Ga0207678_100869582 | 76 |
| 267 | 3300026075 | Ga0207708_10072775 | Ga0207708_100727754 | 76 |
| 268 | 3300026078 | Ga0207702_10000920 | Ga0207702_100009207 | 76 |
| 269 | 3300026078 | Ga0207702_10118564 | Ga0207702_101185642 | 76 |
| 270 | 3300026089 | Ga0207648_10003605 | Ga0207648_1000360511 | 76 |
| 271 | 3300026116 | Ga0207674_10000059 | Ga0207674_1000005943 | 76 |
| 272 | 3300026118 | Ga0207675_100003889 | Ga0207675_10000388914 | 76 |
| 273 | 3300026121 | Ga0207683_10083581 | Ga0207683_100835815 | 76 |
| 274 | 3300027617 | Ga0210002_1047030 | Ga0210002_10470301 | 76 |
| 275 | 3300027717 | Ga0209998_10135759 | Ga0209998_101357591 | 76 |
| 276 | 3300028379 | Ga0268266_10012084 | Ga0268266_100120844 | 76 |
| 277 | 3300028380 | Ga0268265_10002822 | Ga0268265_1000282212 | 76 |
| 278 | 3300028381 | Ga0268264_10019774 | Ga0268264_100197747 | 76 |
| 279 | 3300031249 | Ga0265339_10042381 | Ga0265339_100423812 | 76 |
| 280 | 3300031344 | Ga0265316_10076167 | Ga0265316_100761674 | 76 |
| 281 | 3300039437 | Ga0436365_1581020 | Ga0436365_1581020_5550_5837 | 76 |
| 282 | 3300046454 | Ga0495592_0370596 | Ga0495592_0370596_589_849 | 76 |
| 283 | 3300049573 | Ga0501037_0285954 | Ga0501037_0285954_701_988 | 76 |
| 284 | 3300049579 | Ga0501043_0730082 | Ga0501043_0730082_284_571 | 76 |
| 285 | 3300049581 | Ga0501047_0040826 | Ga0501047_0040826_112_399 | 76 |
| 286 | 3300049822 | Ga0501035_0194345 | Ga0501035_0194345_1381_1668 | 76 |
| 287 | 3300049823 | Ga0501044_0008669 | Ga0501044_0008669_2196_2483 | 76 |
| 288 | 3300060353 | Ga0501082_1323698 | Ga0501082_1323698_34_264 | 76 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1q5v-assembly1.cif.gz_A | apo-nikr | 0.9499 | 8 | 51 |
| 1q5v-assembly1.cif.gz_C | apo-nikr | 0.9494 | 8 | 48 |
| 1q5v-assembly1.cif.gz_D | apo-nikr | 0.9016 | 8 | 50 |
| 2wve-assembly1.cif.gz_B | structural and mechanistic insights into helicobacter pylori nikr function | 0.8956 | 7 | 51 |
| 2wvd-assembly2.cif.gz_B | structural and mechanistic insights into helicobacter pylori nikr function | 0.8909 | 7 | 51 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1q5vA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like | 0.9499 | 8 | 51 | 1.10.1220.10 |
| 1q5vC01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like | 0.9434 | 8 | 50 | 1.10.1220.10 |
| 1q5vB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like | 0.9177 | 8 | 50 | 1.10.1220.10 |
| 1q5vD01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like | 0.9016 | 8 | 50 | 1.10.1220.10 |
| 1q5vA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like | 0.8934 | 8 | 51 | 1.10.1220.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A662PMB4-F1-model_v4 | Ribbon-helix-helix protein CopG domain-containing protein | 0.8856 | 4 | 51 |
GO:0006355
|
| AF-A0A7D5VC07-F1-model_v4 | Ribbon-helix-helix protein, CopG family | 0.8727 | 2 | 52 |
GO:0006355
|
| AF-A0A133V033-F1-model_v4 | Ribbon-helix-helix protein CopG domain-containing protein | 0.8667 | 2 | 55 |
|
| AF-A0A1W1UMR2-F1-model_v4 | Ribbon-helix-helix protein, copG family | 0.8536 | 2 | 55 |
|
| AF-Q07R59-F1-model_v4 | Ribbon-helix-helix protein CopG domain-containing protein | 0.8491 | 4 | 66 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar