F388455

General Info

Members Datasets Scaffolds Average Seq Length
288 165 288 154

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_101170118|Ga0070699_1011701181
Length 180
Sequence VAVIGPKDPRLSLRFYNPPAGTDVIPLLLTLLDEAYDRKSWHGPNLRGALRGTTVAQASWRPGAGRHNIWELTVHAAYWKYSVTRRLTGQSRGSFALKGSNWFSRPERGAANEAAWRADLALLGESHHALRAAVERLTRKDLETIPRGSRTTVRALVTGVAAHDLYHAGQIQLLKRLRSF

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
101 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
102 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
103 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
104 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
105 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
106 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
107 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
110 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
116 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
121 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
122 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
123 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
124 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
125 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
126 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
129 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
130 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
133 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
134 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
135 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
136 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
139 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
140 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
141 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
145 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
146 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
147 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
148 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
152 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
153 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
158 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
162 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
163 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
165 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.04
Rhizosphere 98.61
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100053739 3300005329 Bacteria 3733
2 Ga0070683_100063027 3300005329 Bacteria 3447
3 Ga0070683_100222857 3300005329 Bacteria 1792
4 Ga0068869_100272425 3300005334 Bacteria 1359
5 Ga0070682_100355235 3300005337 Bacteria 1094
6 Ga0070682_100434748 3300005337 Bacteria 1001
7 Ga0068868_100077978 3300005338 Unclassified 2651
8 Ga0070660_100090684 3300005339 Bacteria 2410
9 Ga0070661_100095238 3300005344 Bacteria 2208
10 Ga0070692_10539796 3300005345 Bacteria 762
11 Ga0070671_100298671 3300005355 Bacteria 1371
12 Ga0070673_100321534 3300005364 Bacteria 1367
13 Ga0070659_100064563 3300005366 Bacteria 2898
14 Ga0070667_100796451 3300005367 Bacteria 877
15 Ga0070713_100631371 3300005436 Bacteria 1019
16 Ga0070701_10807244 3300005438 Bacteria 640
17 Ga0070711_100048997 3300005439 Bacteria 2892
18 Ga0070705_100573995 3300005440 Unclassified 868
19 Ga0070700_100404495 3300005441 Unclassified 1027
20 Ga0070694_100343458 3300005444 Bacteria 1155
21 Ga0070681_10031100 3300005458 Bacteria 5357
22 Ga0070681_10069873 3300005458 Bacteria 3478
23 Ga0068867_100038650 3300005459 Bacteria 3475
24 Ga0070685_11008669 3300005466 Unclassified 625
25 Ga0070706_100486552 3300005467 Bacteria 1148
26 Ga0070698_100002770 3300005471 Bacteria 19279
27 Ga0070699_100350309 3300005518 Bacteria 1330
28 Ga0070699_101170118 3300005518 Unclassified 705
29 Ga0070679_100111957 3300005530 Bacteria 2715
30 Ga0070684_100026226 3300005535 Bacteria 4907
31 Ga0070697_100318468 3300005536 Bacteria 1339
32 Ga0070697_100534408 3300005536 Bacteria 1027
33 Ga0068853_100038700 3300005539 Bacteria 4063
34 Ga0068853_100817933 3300005539 Bacteria 893
35 Ga0068853_100893300 3300005539 Unclassified 853
36 Ga0070686_100060157 3300005544 Bacteria 2450
37 Ga0070695_100049138 3300005545 Bacteria 2700
38 Ga0070693_100084396 3300005547 Bacteria 1901
39 Ga0070665_100152852 3300005548 Bacteria 2310
40 Ga0068855_100022358 3300005563 Bacteria 7577
41 Ga0068855_101108615 3300005563 Unclassified 827
42 Ga0068857_100012995 3300005577 Bacteria 7255
43 Ga0068856_100023398 3300005614 Bacteria 6006
44 Ga0068856_102363661 3300005614 Unclassified 539
45 Ga0070702_101519807 3300005615 Bacteria 551
46 Ga0068852_100850774 3300005616 Bacteria 928
47 Ga0068859_100113598 3300005617 Bacteria 2772
48 Ga0068859_100220532 3300005617 Bacteria 1984
49 Ga0068859_101941451 3300005617 Unclassified 650
50 Ga0068864_100018005 3300005618 Bacteria 5895
51 Ga0068866_10028600 3300005718 Bacteria 2658
52 Ga0068866_10654447 3300005718 Bacteria 716
53 Ga0068863_100038986 3300005841 Bacteria 4521
54 Ga0068863_100639991 3300005841 Unclassified 1054
55 Ga0068858_100005450 3300005842 Bacteria 12456
56 Ga0068858_100010130 3300005842 Bacteria 8948
57 Ga0068858_100234804 3300005842 Bacteria 1739
58 Ga0068858_100392674 3300005842 Bacteria 1332
59 Ga0068858_100856064 3300005842 Bacteria 888
60 Ga0068860_100053966 3300005843 Bacteria 3820
61 Ga0068860_100241334 3300005843 Bacteria 1758
62 Ga0068860_100429378 3300005843 Bacteria 1311
63 Ga0068862_100514400 3300005844 Bacteria 1138
64 Ga0097621_100012205 3300006237 Bacteria 6357
65 Ga0097621_100081920 3300006237 Unclassified 2686
66 Ga0097621_100248574 3300006237 Bacteria 1557
67 Ga0068871_100027892 3300006358 Bacteria 4421
68 Ga0068871_100342863 3300006358 Unclassified 1320
69 Ga0068871_100691796 3300006358 Bacteria 934
70 Ga0075428_100200538 3300006844 Bacteria 2157
71 Ga0075428_101769582 3300006844 Unclassified 644
72 Ga0075433_10139205 3300006852 Unclassified 2157
73 Ga0068865_100397137 3300006881 Bacteria 1128
74 Ga0097620_100113596 3300006931 Bacteria 2772
75 Ga0097620_100220515 3300006931 Bacteria 1984
76 Ga0097620_101941886 3300006931 Unclassified 650
77 Ga0105240_10322309 3300009093 Bacteria 1761
78 Ga0105240_10496932 3300009093 Bacteria 1357
79 Ga0105240_10588858 3300009093 Bacteria 1226
80 Ga0105240_11277626 3300009093 Unclassified 775
81 Ga0105245_10008160 3300009098 Bacteria 9158
82 Ga0105245_10013374 3300009098 Bacteria 7154
83 Ga0105245_10086761 3300009098 Bacteria 2871
84 Ga0105245_10116231 3300009098 Bacteria 2494
85 Ga0105245_10184962 3300009098 Bacteria 1993
86 Ga0105245_10534362 3300009098 Bacteria 1193
87 Ga0105243_11056578 3300009148 Bacteria 818
88 Ga0105243_11470988 3300009148 Bacteria 704
89 Ga0105243_12643649 3300009148 Unclassified 542
90 Ga0105241_10019851 3300009174 Bacteria 4960
91 Ga0105241_10184002 3300009174 Bacteria 1735
92 Ga0105241_10254739 3300009174 Unclassified 1489
93 Ga0105241_11839437 3300009174 Unclassified 592
94 Ga0105242_10026425 3300009176 Bacteria 4602
95 Ga0105242_10045932 3300009176 Bacteria 3541
96 Ga0105242_10045984 3300009176 Bacteria 3540
97 Ga0105242_10110469 3300009176 Bacteria 2342
98 Ga0105242_10191879 3300009176 Unclassified 1809
99 Ga0105242_10249766 3300009176 Bacteria 1598
100 Ga0105242_10646045 3300009176 Unclassified 1028
101 Ga0105242_10740144 3300009176 Bacteria 967
102 Ga0105242_11026456 3300009176 Bacteria 834
103 Ga0105242_11299495 3300009176 Unclassified 751
104 Ga0105248_10011881 3300009177 Bacteria 9607
105 Ga0105248_10013197 3300009177 Bacteria 9096
106 Ga0105248_10022163 3300009177 Bacteria 7041
107 Ga0105248_10095236 3300009177 Bacteria 3352
108 Ga0105248_10140467 3300009177 Bacteria 2725
109 Ga0105248_10351158 3300009177 Bacteria 1660
110 Ga0105248_10462813 3300009177 Bacteria 1430
111 Ga0105248_10498297 3300009177 Bacteria 1373
112 Ga0105248_10530085 3300009177 Unclassified 1328
113 Ga0105248_10573006 3300009177 Unclassified 1274
114 Ga0105237_10057274 3300009545 Bacteria 3900
115 Ga0105237_10288216 3300009545 Bacteria 1645
116 Ga0105238_10069186 3300009551 Bacteria 3531
117 Ga0105238_10082520 3300009551 Bacteria 3204
118 Ga0105238_10112047 3300009551 Bacteria 2708
119 Ga0105249_10009706 3300009553 Bacteria 8436
120 Ga0105249_11951414 3300009553 Bacteria 660
121 Ga0105239_10005404 3300010375 Bacteria 14990
122 Ga0105239_10176348 3300010375 Bacteria 2391
123 Ga0105246_10097647 3300011119 Bacteria 2132
124 Ga0105246_10783557 3300011119 Unclassified 844
125 Ga0105246_11342449 3300011119 Unclassified 664
126 Ga0157371_10575868 3300013102 Bacteria 836
127 Ga0157374_10378272 3300013296 Bacteria 1410
128 Ga0157374_11350192 3300013296 Unclassified 735
129 Ga0157374_12195191 3300013296 Unclassified 579
130 Ga0157378_10101521 3300013297 Bacteria 2627
131 Ga0157378_10323320 3300013297 Unclassified 1499
132 Ga0157378_10996911 3300013297 Bacteria 872
133 Ga0163162_10008743 3300013306 Bacteria 9851
134 Ga0163162_10335054 3300013306 Bacteria 1645
135 Ga0163162_10791323 3300013306 Bacteria 1066
136 Ga0163162_10841652 3300013306 Bacteria 1033
137 Ga0157372_10032138 3300013307 Bacteria 5752
138 Ga0157372_10146006 3300013307 Bacteria 2728
139 Ga0157372_11730160 3300013307 Bacteria 719
140 Ga0157375_10003180 3300013308 Bacteria 14268
141 Ga0157375_11037825 3300013308 Bacteria 958
142 Ga0163163_10002231 3300014325 Bacteria 16310
143 Ga0163163_10158542 3300014325 Bacteria 2308
144 Ga0163163_10164558 3300014325 Bacteria 2264
145 Ga0163163_11314048 3300014325 Bacteria 785
146 Ga0157377_11310194 3300014745 Unclassified 567
147 Ga0157379_11336137 3300014968 Bacteria 693
148 Ga0157376_10292300 3300014969 Bacteria 1539
149 Ga0207642_10066469 3300025899 Bacteria 1698
150 Ga0207710_10372366 3300025900 Unclassified 730
151 Ga0207680_10553341 3300025903 Bacteria 821
152 Ga0207654_10014525 3300025911 Bacteria 4069
153 Ga0207654_10264385 3300025911 Unclassified 1158
154 Ga0207707_10099584 3300025912 Bacteria 2540
155 Ga0207707_10765735 3300025912 Unclassified 806
156 Ga0207695_10315362 3300025913 Bacteria 1453
157 Ga0207695_11074833 3300025913 Unclassified 684
158 Ga0207671_10057074 3300025914 Bacteria 2893
159 Ga0207671_10383727 3300025914 Bacteria 1116
160 Ga0207657_10109717 3300025919 Bacteria 2280
161 Ga0207657_10760284 3300025919 Bacteria 750
162 Ga0207694_10002237 3300025924 Bacteria 15868
163 Ga0207694_10017541 3300025924 Bacteria 5412
164 Ga0207694_10034508 3300025924 Bacteria 3879
165 Ga0207694_10044866 3300025924 Bacteria 3413
166 Ga0207694_10198581 3300025924 Bacteria 1631
167 Ga0207687_10083292 3300025927 Bacteria 2315
168 Ga0207687_10296748 3300025927 Unclassified 1300
169 Ga0207687_10346252 3300025927 Bacteria 1209
170 Ga0207687_10376720 3300025927 Bacteria 1162
171 Ga0207700_10514810 3300025928 Bacteria 1060
172 Ga0207644_10176259 3300025931 Bacteria 1673
173 Ga0207644_10297700 3300025931 Bacteria 1299
174 Ga0207706_10050385 3300025933 Bacteria 3679
175 Ga0207686_10036794 3300025934 Bacteria 2950
176 Ga0207686_10217224 3300025934 Bacteria 1378
177 Ga0207686_10555362 3300025934 Bacteria 898
178 Ga0207686_10871339 3300025934 Bacteria 725
179 Ga0207686_11084282 3300025934 Unclassified 652
180 Ga0207704_10286754 3300025938 Bacteria 1254
181 Ga0207704_10990476 3300025938 Unclassified 710
182 Ga0207711_10016526 3300025941 Bacteria 6129
183 Ga0207711_10019461 3300025941 Bacteria 5651
184 Ga0207711_10042544 3300025941 Bacteria 3871
185 Ga0207711_10054546 3300025941 Bacteria 3431
186 Ga0207711_10087737 3300025941 Bacteria 2730
187 Ga0207711_10314491 3300025941 Bacteria 1446
188 Ga0207711_10819381 3300025941 Unclassified 867
189 Ga0207689_10213629 3300025942 Bacteria 1594
190 Ga0207661_10360836 3300025944 Bacteria 1312
191 Ga0207667_10348925 3300025949 Bacteria 1509
192 Ga0207667_11543985 3300025949 Unclassified 634
193 Ga0207651_10341820 3300025960 Bacteria 1257
194 Ga0207712_10018573 3300025961 Bacteria 4531
195 Ga0207712_10789605 3300025961 Bacteria 834
196 Ga0207658_10814563 3300025986 Bacteria 848
197 Ga0207703_10364180 3300026035 Bacteria 1334
198 Ga0207639_10242194 3300026041 Bacteria 1569
199 Ga0207639_10768570 3300026041 Unclassified 897
200 Ga0207641_10058630 3300026088 Bacteria 3277
201 Ga0207641_10735726 3300026088 Bacteria 973
202 Ga0207674_10047179 3300026116 Bacteria 4418
203 Ga0207698_11313023 3300026142 Bacteria 738
204 Ga0207698_11431948 3300026142 Unclassified 706
205 Ga0268266_10014272 3300028379 Bacteria 6832
206 Ga0268264_10139250 3300028381 Bacteria 2162
207 Ga0268264_11249203 3300028381 Unclassified 753
208 Ga0316578_10003157 3300031728 Bacteria 7454
209 Ga0373934_0035655 3300035086 Bacteria 1958
210 Ga0373944_0171481 3300035089 Bacteria 774
211 Ga0373953_0108577 3300035117 Bacteria 1172
212 Ga0373954_0002510 3300035118 Bacteria 7699
213 Ga0373956_0421515 3300035119 Bacteria 637
214 Ga0373943_0009293 3300035170 Bacteria 4405
215 Ga0373946_0018053 3300035171 Bacteria 2704
216 Ga0373935_0657288 3300035692 Unclassified 769
217 Ga0373927_0044252 3300035695 Bacteria 2881
218 Ga0373933_0179518 3300035724 Bacteria 1350
219 Ga0373933_0376752 3300035724 Bacteria 924
220 Ga0373947_0026696 3300035725 Bacteria 3377
221 Ga0373937_0010730 3300036401 Bacteria 8013
222 Ga0373937_0386275 3300036401 Unclassified 1328
223 Ga0373937_0455560 3300036401 Bacteria 1215
224 Ga0373937_1233474 3300036401 Unclassified 696
225 Ga0316582_0066844 3300036647 Bacteria 2318
226 Ga0373925_0022903 3300037068 Bacteria 4558
227 Ga0436363_1414326 3300039450 Bacteria 1220
228 Ga0451577_0901935 3300042876 Bacteria 796
229 Ga0451576_0007462 3300045051 Bacteria 13054
230 Ga0451576_0420155 3300045051 Bacteria 1403
231 Ga0495592_0028689 3300046454 Bacteria 4212
232 Ga0495629_0695471 3300046459 Bacteria 675
233 Ga0495651_0073985 3300046462 Bacteria 2585
234 Ga0495653_0082112 3300046463 Bacteria 2380
235 Ga0495580_0073371 3300046472 Bacteria 2389
236 Ga0495580_0373039 3300046472 Bacteria 965
237 Ga0495580_0523433 3300046472 Bacteria 790
238 Ga0495662_0010227 3300046476 Bacteria 4597
239 Ga0495664_0449151 3300046477 Bacteria 772
240 Ga0495594_0036678 3300046499 Bacteria 2674
241 Ga0495618_0451264 3300046514 Unclassified 780
242 Ga0495630_0065421 3300046517 Bacteria 2732
243 Ga0495630_0368995 3300046517 Bacteria 1099
244 Ga0495666_0181466 3300046526 Bacteria 972
245 Ga0495652_0070406 3300046529 Bacteria 2923
246 Ga0495665_0124438 3300046531 Bacteria 1350
247 Ga0495665_0209998 3300046531 Unclassified 1008
248 Ga0495665_0221563 3300046531 Bacteria 978
249 Ga0495640_0075960 3300046533 Bacteria 2242
250 Ga0495586_0091486 3300046535 Bacteria 1681
251 Ga0495587_0091813 3300046536 Bacteria 1753
252 Ga0495645_0005473 3300046543 Bacteria 8722
253 Ga0495667_0141612 3300046559 Bacteria 1549
254 Ga0495634_0072312 3300046642 Bacteria 2268
255 Ga0495635_0057770 3300046663 Bacteria 2669
256 Ga0495657_0109598 3300046675 Bacteria 1751
257 Ga0495599_0014247 3300046678 Bacteria 4922
258 Ga0495623_0047748 3300046679 Bacteria 2718
259 Ga0495646_0010904 3300046680 Bacteria 5773
260 Ga0495658_0756274 3300046683 Bacteria 622
261 Ga0495613_0031090 3300046689 Bacteria 3965
262 Ga0495624_0616770 3300046690 Bacteria 646
263 Ga0495670_0835180 3300046691 Unclassified 503
264 Ga0495600_0040185 3300046809 Bacteria 3046
265 Ga0495604_0012418 3300047317 Bacteria 6772
266 Ga0495636_0126817 3300047318 Bacteria 1133
267 Ga0495636_0624079 3300047318 Unclassified 528
268 Ga0495674_0044468 3300047319 Bacteria 3949
269 Ga0495674_0321233 3300047319 Unclassified 1261
270 Ga0495674_0668968 3300047319 Bacteria 817
271 Ga0495680_0021551 3300047322 Bacteria 5393
272 Ga0495675_0035023 3300047444 Bacteria 3207
273 Ga0495684_0085317 3300047471 Bacteria 2394
274 Ga0495684_0117465 3300047471 Bacteria 2005
275 Ga0495602_0042237 3300048088 Bacteria 4157
276 Ga0496104_1374391 3300048907 Unclassified 609
277 Ga0496112_0582873 3300048915 Bacteria 1051
278 Ga0496115_0060138 3300048918 Bacteria 3061
279 Ga0501068_0249803 3300049584 Bacteria 1130
280 Ga0501069_0273712 3300049585 Bacteria 987
281 nmdc:mga05p37_557541_c1 3300050507 Bacteria 1303
282 nmdc:mga06r32_488893_c1 3300050510 Unclassified 1208
283 Ga0495601_0140867 3300053077 Bacteria 1573
284 Ga0495601_0222492 3300053077 Bacteria 1233
285 Ga0495619_0406531 3300053085 Bacteria 940
286 Ga0501084_0202567 3300054114 Unclassified 1675
287 Ga0501082_1028384 3300060353 Bacteria 720
288 Ga0530510_0094377 3300061734 Bacteria 2185

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036401 Ga0373937_0455560 Ga0373937_0455560_725_1120 127
2 3300046472 Ga0495580_0073371 Ga0495580_0073371_323_832 128
3 3300035171 Ga0373946_0018053 Ga0373946_0018053_69_515 134
4 3300026142 Ga0207698_11431948 Ga0207698_114319482 137
5 3300005458 Ga0070681_10031100 Ga0070681_100311003 138
6 3300009177 Ga0105248_10351158 Ga0105248_103511582 140
7 3300005718 Ga0068866_10028600 Ga0068866_100286003 143
8 3300009176 Ga0105242_10045932 Ga0105242_100459323 143
9 3300009177 Ga0105248_10022163 Ga0105248_100221635 143
10 3300025899 Ga0207642_10066469 Ga0207642_100664693 143
11 3300025934 Ga0207686_10036794 Ga0207686_100367943 143
12 3300025941 Ga0207711_10016526 Ga0207711_100165262 143
13 3300005337 Ga0070682_100434748 Ga0070682_1004347482 144
14 3300005530 Ga0070679_100111957 Ga0070679_1001119573 144
15 3300005842 Ga0068858_100856064 Ga0068858_1008560642 144
16 3300006358 Ga0068871_100342863 Ga0068871_1003428633 144
17 3300009098 Ga0105245_10008160 Ga0105245_100081608 144
18 3300009148 Ga0105243_12643649 Ga0105243_126436491 144
19 3300009174 Ga0105241_10254739 Ga0105241_102547392 144
20 3300009176 Ga0105242_11026456 Ga0105242_110264562 144
21 3300009553 Ga0105249_11951414 Ga0105249_119514141 144
22 3300013297 Ga0157378_10323320 Ga0157378_103233202 144
23 3300025911 Ga0207654_10264385 Ga0207654_102643852 144
24 3300025912 Ga0207707_10099584 Ga0207707_100995843 144
25 3300025927 Ga0207687_10376720 Ga0207687_103767201 144
26 3300025931 Ga0207644_10297700 Ga0207644_102977001 144
27 3300025941 Ga0207711_10314491 Ga0207711_103144911 144
28 3300045051 Ga0451576_0420155 Ga0451576_0420155_537_995 144
29 3300046691 Ga0495670_0835180 Ga0495670_0835180_35_493 144
30 3300006852 Ga0075433_10139205 Ga0075433_101392053 145
31 3300009176 Ga0105242_10110469 Ga0105242_101104692 145
32 3300013306 Ga0163162_10008743 Ga0163162_100087435 145
33 3300025903 Ga0207680_10553341 Ga0207680_105533411 145
34 3300026035 Ga0207703_10364180 Ga0207703_103641802 145
35 3300026041 Ga0207639_10768570 Ga0207639_107685701 145
36 3300042876 Ga0451577_0901935 Ga0451577_0901935_22_465 145
37 3300046472 Ga0495580_0523433 Ga0495580_0523433_51_542 145
38 3300047319 Ga0495674_0668968 Ga0495674_0668968_220_711 145
39 3300009177 Ga0105248_10573006 Ga0105248_105730063 146
40 3300013307 Ga0157372_11730160 Ga0157372_117301602 146
41 3300025938 Ga0207704_10990476 Ga0207704_109904762 146
42 3300025941 Ga0207711_10819381 Ga0207711_108193812 146
43 3300039450 Ga0436363_1414326 Ga0436363_1414326_483_941 146
44 3300046517 Ga0495630_0368995 Ga0495630_0368995_532_972 146
45 3300046526 Ga0495666_0181466 Ga0495666_0181466_119_613 146
46 3300046531 Ga0495665_0221563 Ga0495665_0221563_470_910 146
47 3300036401 Ga0373937_1233474 Ga0373937_1233474_24_467 147
48 3300046454 Ga0495592_0028689 Ga0495592_0028689_2844_3287 147
49 3300046462 Ga0495651_0073985 Ga0495651_0073985_1893_2336 147
50 3300046463 Ga0495653_0082112 Ga0495653_0082112_1387_1830 147
51 3300046476 Ga0495662_0010227 Ga0495662_0010227_1523_1966 147
52 3300046514 Ga0495618_0451264 Ga0495618_0451264_186_629 147
53 3300046517 Ga0495630_0065421 Ga0495630_0065421_483_926 147
54 3300046529 Ga0495652_0070406 Ga0495652_0070406_1257_1700 147
55 3300046531 Ga0495665_0124438 Ga0495665_0124438_504_947 147
56 3300046533 Ga0495640_0075960 Ga0495640_0075960_1418_1861 147
57 3300046535 Ga0495586_0091486 Ga0495586_0091486_1091_1534 147
58 3300046536 Ga0495587_0091813 Ga0495587_0091813_381_824 147
59 3300046543 Ga0495645_0005473 Ga0495645_0005473_5086_5529 147
60 3300046559 Ga0495667_0141612 Ga0495667_0141612_318_761 147
61 3300046642 Ga0495634_0072312 Ga0495634_0072312_813_1256 147
62 3300046663 Ga0495635_0057770 Ga0495635_0057770_812_1255 147
63 3300046675 Ga0495657_0109598 Ga0495657_0109598_668_1111 147
64 3300046678 Ga0495599_0014247 Ga0495599_0014247_1330_1773 147
65 3300046679 Ga0495623_0047748 Ga0495623_0047748_1128_1571 147
66 3300046680 Ga0495646_0010904 Ga0495646_0010904_2913_3356 147
67 3300046689 Ga0495613_0031090 Ga0495613_0031090_2631_3074 147
68 3300046809 Ga0495600_0040185 Ga0495600_0040185_2313_2756 147
69 3300047317 Ga0495604_0012418 Ga0495604_0012418_4587_5030 147
70 3300047319 Ga0495674_0044468 Ga0495674_0044468_1763_2206 147
71 3300047322 Ga0495680_0021551 Ga0495680_0021551_1298_1741 147
72 3300047444 Ga0495675_0035023 Ga0495675_0035023_1454_1897 147
73 3300047471 Ga0495684_0085317 Ga0495684_0085317_1872_2315 147
74 3300048088 Ga0495602_0042237 Ga0495602_0042237_1905_2348 147
75 3300053077 Ga0495601_0222492 Ga0495601_0222492_81_524 147
76 3300053085 Ga0495619_0406531 Ga0495619_0406531_261_704 147
77 3300005471 Ga0070698_100002770 Ga0070698_1000027707 148
78 3300005518 Ga0070699_100350309 Ga0070699_1003503091 148
79 3300009098 Ga0105245_10534362 Ga0105245_105343622 148
80 3300009148 Ga0105243_11470988 Ga0105243_114709881 148
81 3300014968 Ga0157379_11336137 Ga0157379_113361371 148
82 3300025927 Ga0207687_10346252 Ga0207687_103462522 148
83 3300049584 Ga0501068_0249803 Ga0501068_0249803_484_957 148
84 3300049585 Ga0501069_0273712 Ga0501069_0273712_317_790 148
85 3300050507 nmdc:mga05p37_557541_c1 nmdc:mga05p37_557541_c1_662_1126 148
86 3300005615 Ga0070702_101519807 Ga0070702_1015198071 149
87 3300005617 Ga0068859_101941451 Ga0068859_1019414512 149
88 3300006931 Ga0097620_101941886 Ga0097620_1019418862 149
89 3300036647 Ga0316582_0066844 Ga0316582_0066844_618_1088 149
90 3300047318 Ga0495636_0126817 Ga0495636_0126817_427_876 149
91 3300005355 Ga0070671_100298671 Ga0070671_1002986711 150
92 3300005618 Ga0068864_100018005 Ga0068864_1000180054 150
93 3300005841 Ga0068863_100038986 Ga0068863_1000389862 150
94 3300005841 Ga0068863_100639991 Ga0068863_1006399912 150
95 3300005842 Ga0068858_100010130 Ga0068858_1000101304 150
96 3300005843 Ga0068860_100053966 Ga0068860_1000539662 150
97 3300005843 Ga0068860_100429378 Ga0068860_1004293782 150
98 3300005844 Ga0068862_100514400 Ga0068862_1005144002 150
99 3300006237 Ga0097621_100081920 Ga0097621_1000819204 150
100 3300009093 Ga0105240_10588858 Ga0105240_105888582 150
101 3300009098 Ga0105245_10184962 Ga0105245_101849623 150
102 3300009148 Ga0105243_11056578 Ga0105243_110565781 150
103 3300009176 Ga0105242_10026425 Ga0105242_100264252 150
104 3300009177 Ga0105248_10013197 Ga0105248_100131973 150
105 3300009177 Ga0105248_10498297 Ga0105248_104982972 150
106 3300014325 Ga0163163_10002231 Ga0163163_100022319 150
107 3300014325 Ga0163163_11314048 Ga0163163_113140482 150
108 3300025900 Ga0207710_10372366 Ga0207710_103723661 150
109 3300025913 Ga0207695_11074833 Ga0207695_110748331 150
110 3300025931 Ga0207644_10176259 Ga0207644_101762592 150
111 3300025934 Ga0207686_11084282 Ga0207686_110842821 150
112 3300025941 Ga0207711_10019461 Ga0207711_100194613 150
113 3300025961 Ga0207712_10789605 Ga0207712_107896052 150
114 3300026088 Ga0207641_10058630 Ga0207641_100586302 150
115 3300026088 Ga0207641_10735726 Ga0207641_107357262 150
116 3300028381 Ga0268264_10139250 Ga0268264_101392502 150
117 3300028381 Ga0268264_11249203 Ga0268264_112492031 150
118 3300035086 Ga0373934_0035655 Ga0373934_0035655_103_555 150
119 3300035117 Ga0373953_0108577 Ga0373953_0108577_295_747 150
120 3300035118 Ga0373954_0002510 Ga0373954_0002510_6286_6738 150
121 3300035692 Ga0373935_0657288 Ga0373935_0657288_194_658 150
122 3300035724 Ga0373933_0179518 Ga0373933_0179518_444_896 150
123 3300036401 Ga0373937_0010730 Ga0373937_0010730_5261_5713 150
124 3300036401 Ga0373937_0386275 Ga0373937_0386275_195_650 150
125 3300045051 Ga0451576_0007462 Ga0451576_0007462_11151_11624 150
126 3300046499 Ga0495594_0036678 Ga0495594_0036678_1759_2232 150
127 3300048918 Ga0496115_0060138 Ga0496115_0060138_1139_1615 150
128 3300050510 nmdc:mga06r32_488893_c1 nmdc:mga06r32_488893_c1_472_942 150
129 3300053077 Ga0495601_0140867 Ga0495601_0140867_289_741 150
130 3300054114 Ga0501084_0202567 Ga0501084_0202567_580_1065 150
131 3300060353 Ga0501082_1028384 Ga0501082_1028384_72_557 150
132 3300061734 Ga0530510_0094377 Ga0530510_0094377_406_891 150
133 3300005337 Ga0070682_100355235 Ga0070682_1003552352 151
134 3300005338 Ga0068868_100077978 Ga0068868_1000779783 151
135 3300005367 Ga0070667_100796451 Ga0070667_1007964512 151
136 3300005441 Ga0070700_100404495 Ga0070700_1004044951 151
137 3300005518 Ga0070699_101170118 Ga0070699_1011701181 151
138 3300005536 Ga0070697_100318468 Ga0070697_1003184683 151
139 3300005539 Ga0068853_100893300 Ga0068853_1008933002 151
140 3300005548 Ga0070665_100152852 Ga0070665_1001528522 151
141 3300005617 Ga0068859_100113598 Ga0068859_1001135982 151
142 3300005842 Ga0068858_100005450 Ga0068858_1000054504 151
143 3300005842 Ga0068858_100234804 Ga0068858_1002348042 151
144 3300005842 Ga0068858_100392674 Ga0068858_1003926742 151
145 3300005843 Ga0068860_100241334 Ga0068860_1002413343 151
146 3300006237 Ga0097621_100012205 Ga0097621_1000122057 151
147 3300006358 Ga0068871_100027892 Ga0068871_1000278924 151
148 3300006844 Ga0075428_101769582 Ga0075428_1017695821 151
149 3300006881 Ga0068865_100397137 Ga0068865_1003971371 151
150 3300006931 Ga0097620_100113596 Ga0097620_1001135962 151
151 3300009093 Ga0105240_10496932 Ga0105240_104969323 151
152 3300009098 Ga0105245_10013374 Ga0105245_100133746 151
153 3300009098 Ga0105245_10086761 Ga0105245_100867614 151
154 3300009174 Ga0105241_11839437 Ga0105241_118394371 151
155 3300009176 Ga0105242_10191879 Ga0105242_101918792 151
156 3300009176 Ga0105242_10249766 Ga0105242_102497663 151
157 3300009176 Ga0105242_10646045 Ga0105242_106460452 151
158 3300009176 Ga0105242_10740144 Ga0105242_107401441 151
159 3300009176 Ga0105242_11299495 Ga0105242_112994952 151
160 3300009177 Ga0105248_10095236 Ga0105248_100952363 151
161 3300009177 Ga0105248_10140467 Ga0105248_101404673 151
162 3300009177 Ga0105248_10462813 Ga0105248_104628131 151
163 3300009177 Ga0105248_10530085 Ga0105248_105300853 151
164 3300009545 Ga0105237_10057274 Ga0105237_100572743 151
165 3300009545 Ga0105237_10288216 Ga0105237_102882162 151
166 3300009551 Ga0105238_10112047 Ga0105238_101120472 151
167 3300009553 Ga0105249_10009706 Ga0105249_100097068 151
168 3300011119 Ga0105246_10097647 Ga0105246_100976472 151
169 3300011119 Ga0105246_11342449 Ga0105246_113424491 151
170 3300013296 Ga0157374_10378272 Ga0157374_103782722 151
171 3300013306 Ga0163162_10335054 Ga0163162_103350542 151
172 3300013306 Ga0163162_10841652 Ga0163162_108416521 151
173 3300013308 Ga0157375_10003180 Ga0157375_1000318011 151
174 3300013308 Ga0157375_11037825 Ga0157375_110378252 151
175 3300014325 Ga0163163_10158542 Ga0163163_101585421 151
176 3300014745 Ga0157377_11310194 Ga0157377_113101942 151
177 3300014969 Ga0157376_10292300 Ga0157376_102923002 151
178 3300025913 Ga0207695_10315362 Ga0207695_103153622 151
179 3300025914 Ga0207671_10057074 Ga0207671_100570743 151
180 3300025914 Ga0207671_10383727 Ga0207671_103837272 151
181 3300025924 Ga0207694_10002237 Ga0207694_1000223714 151
182 3300025924 Ga0207694_10044866 Ga0207694_100448664 151
183 3300025927 Ga0207687_10083292 Ga0207687_100832924 151
184 3300025927 Ga0207687_10296748 Ga0207687_102967483 151
185 3300025934 Ga0207686_10555362 Ga0207686_105553622 151
186 3300025934 Ga0207686_10871339 Ga0207686_108713391 151
187 3300025938 Ga0207704_10286754 Ga0207704_102867542 151
188 3300025941 Ga0207711_10054546 Ga0207711_100545463 151
189 3300025941 Ga0207711_10087737 Ga0207711_100877373 151
190 3300025961 Ga0207712_10018573 Ga0207712_100185732 151
191 3300025986 Ga0207658_10814563 Ga0207658_108145631 151
192 3300028379 Ga0268266_10014272 Ga0268266_100142724 151
193 3300031728 Ga0316578_10003157 Ga0316578_100031575 151
194 3300047318 Ga0495636_0624079 Ga0495636_0624079_17_475 151
195 3300005329 Ga0070683_100222857 Ga0070683_1002228572 152
196 3300005334 Ga0068869_100272425 Ga0068869_1002724252 152
197 3300005344 Ga0070661_100095238 Ga0070661_1000952383 152
198 3300005436 Ga0070713_100631371 Ga0070713_1006313711 152
199 3300005438 Ga0070701_10807244 Ga0070701_108072441 152
200 3300005440 Ga0070705_100573995 Ga0070705_1005739951 152
201 3300005444 Ga0070694_100343458 Ga0070694_1003434583 152
202 3300005467 Ga0070706_100486552 Ga0070706_1004865522 152
203 3300005536 Ga0070697_100534408 Ga0070697_1005344083 152
204 3300005545 Ga0070695_100049138 Ga0070695_1000491382 152
205 3300006844 Ga0075428_100200538 Ga0075428_1002005382 152
206 3300009093 Ga0105240_10322309 Ga0105240_103223092 152
207 3300009098 Ga0105245_10116231 Ga0105245_101162314 152
208 3300009551 Ga0105238_10082520 Ga0105238_100825202 152
209 3300010375 Ga0105239_10176348 Ga0105239_101763482 152
210 3300013296 Ga0157374_12195191 Ga0157374_121951911 152
211 3300013297 Ga0157378_10101521 Ga0157378_101015212 152
212 3300025924 Ga0207694_10017541 Ga0207694_100175414 152
213 3300025928 Ga0207700_10514810 Ga0207700_105148102 152
214 3300025942 Ga0207689_10213629 Ga0207689_102136292 152
215 3300025944 Ga0207661_10360836 Ga0207661_103608362 152
216 3300005329 Ga0070683_100053739 Ga0070683_1000537392 153
217 3300005329 Ga0070683_100063027 Ga0070683_1000630274 153
218 3300005339 Ga0070660_100090684 Ga0070660_1000906842 153
219 3300005345 Ga0070692_10539796 Ga0070692_105397962 153
220 3300005364 Ga0070673_100321534 Ga0070673_1003215342 153
221 3300005366 Ga0070659_100064563 Ga0070659_1000645634 153
222 3300005439 Ga0070711_100048997 Ga0070711_1000489972 153
223 3300005458 Ga0070681_10069873 Ga0070681_100698735 153
224 3300005459 Ga0068867_100038650 Ga0068867_1000386502 153
225 3300005466 Ga0070685_11008669 Ga0070685_110086691 153
226 3300005535 Ga0070684_100026226 Ga0070684_1000262262 153
227 3300005539 Ga0068853_100038700 Ga0068853_1000387003 153
228 3300005539 Ga0068853_100817933 Ga0068853_1008179332 153
229 3300005544 Ga0070686_100060157 Ga0070686_1000601573 153
230 3300005547 Ga0070693_100084396 Ga0070693_1000843962 153
231 3300005563 Ga0068855_100022358 Ga0068855_1000223585 153
232 3300005563 Ga0068855_101108615 Ga0068855_1011086152 153
233 3300005577 Ga0068857_100012995 Ga0068857_1000129954 153
234 3300005614 Ga0068856_100023398 Ga0068856_1000233986 153
235 3300005614 Ga0068856_102363661 Ga0068856_1023636611 153
236 3300005616 Ga0068852_100850774 Ga0068852_1008507742 153
237 3300005617 Ga0068859_100220532 Ga0068859_1002205323 153
238 3300005718 Ga0068866_10654447 Ga0068866_106544472 153
239 3300006237 Ga0097621_100248574 Ga0097621_1002485743 153
240 3300006358 Ga0068871_100691796 Ga0068871_1006917962 153
241 3300006931 Ga0097620_100220515 Ga0097620_1002205152 153
242 3300009093 Ga0105240_11277626 Ga0105240_112776262 153
243 3300009174 Ga0105241_10019851 Ga0105241_100198514 153
244 3300009174 Ga0105241_10184002 Ga0105241_101840022 153
245 3300009176 Ga0105242_10045984 Ga0105242_100459843 153
246 3300009177 Ga0105248_10011881 Ga0105248_1001188110 153
247 3300009551 Ga0105238_10069186 Ga0105238_100691863 153
248 3300010375 Ga0105239_10005404 Ga0105239_1000540415 153
249 3300011119 Ga0105246_10783557 Ga0105246_107835573 153
250 3300013102 Ga0157371_10575868 Ga0157371_105758682 153
251 3300013296 Ga0157374_11350192 Ga0157374_113501922 153
252 3300013297 Ga0157378_10996911 Ga0157378_109969112 153
253 3300013306 Ga0163162_10791323 Ga0163162_107913232 153
254 3300013307 Ga0157372_10032138 Ga0157372_100321382 153
255 3300013307 Ga0157372_10146006 Ga0157372_101460064 153
256 3300014325 Ga0163163_10164558 Ga0163163_101645582 153
257 3300025911 Ga0207654_10014525 Ga0207654_100145254 153
258 3300025912 Ga0207707_10765735 Ga0207707_107657352 153
259 3300025919 Ga0207657_10109717 Ga0207657_101097173 153
260 3300025919 Ga0207657_10760284 Ga0207657_107602842 153
261 3300025924 Ga0207694_10034508 Ga0207694_100345082 153
262 3300025924 Ga0207694_10198581 Ga0207694_101985812 153
263 3300025933 Ga0207706_10050385 Ga0207706_100503853 153
264 3300025934 Ga0207686_10217224 Ga0207686_102172242 153
265 3300025941 Ga0207711_10042544 Ga0207711_100425443 153
266 3300025949 Ga0207667_10348925 Ga0207667_103489252 153
267 3300025949 Ga0207667_11543985 Ga0207667_115439852 153
268 3300025960 Ga0207651_10341820 Ga0207651_103418202 153
269 3300026041 Ga0207639_10242194 Ga0207639_102421942 153
270 3300026116 Ga0207674_10047179 Ga0207674_100471795 153
271 3300026142 Ga0207698_11313023 Ga0207698_113130232 153
272 3300035089 Ga0373944_0171481 Ga0373944_0171481_228_731 153
273 3300035119 Ga0373956_0421515 Ga0373956_0421515_147_626 153
274 3300035170 Ga0373943_0009293 Ga0373943_0009293_2850_3353 153
275 3300035695 Ga0373927_0044252 Ga0373927_0044252_189_692 153
276 3300035724 Ga0373933_0376752 Ga0373933_0376752_326_829 153
277 3300035725 Ga0373947_0026696 Ga0373947_0026696_1784_2287 153
278 3300037068 Ga0373925_0022903 Ga0373925_0022903_2166_2669 153
279 3300046459 Ga0495629_0695471 Ga0495629_0695471_140_643 153
280 3300046472 Ga0495580_0373039 Ga0495580_0373039_226_729 153
281 3300046477 Ga0495664_0449151 Ga0495664_0449151_268_747 153
282 3300046531 Ga0495665_0209998 Ga0495665_0209998_341_844 153
283 3300046683 Ga0495658_0756274 Ga0495658_0756274_78_581 153
284 3300046690 Ga0495624_0616770 Ga0495624_0616770_110_613 153
285 3300047319 Ga0495674_0321233 Ga0495674_0321233_173_676 153
286 3300047471 Ga0495684_0117465 Ga0495684_0117465_1355_1858 153
287 3300048907 Ga0496104_1374391 Ga0496104_1374391_130_591 153
288 3300048915 Ga0496112_0582873 Ga0496112_0582873_98_559 153

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

39

171

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yqy-assembly1.cif.gz_A crystal structure of tt2238, a four-helix bundle protein 0.704 4 144
2yqy-assembly1.cif.gz_A crystal structure of tt2238, a four-helix bundle protein 0.6787 4 144
3cex-assembly1.cif.gz_A crystal structure of the conserved protein of locus ef_3021 from enterococcus faecalis 0.6679 1 148
3cex-assembly1.cif.gz_A crystal structure of the conserved protein of locus ef_3021 from enterococcus faecalis 0.6446 1 148
2qe9-assembly1.cif.gz_A crystal structure of a putative metal-dependent hydrolase (yiza, bsu10800) from bacillus subtilis at 1.90 a resolution 0.6344 1 147
ID Description Score Start End Superfamily
af_P9WM91_7_150_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.5769 4 142 1.20.120.450
af_O53728_4_171_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.5765 4 149 1.20.120.450
af_O07256_17_140_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.5699 4 142 1.20.120.450
2nsgA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.5595 3 142 1.20.120.450
5cogA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.5559 1 147 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A7S7NJX2-F1-model_v4 DinB family protein 0.9803 1 148
AF-A0A1Q7L6U6-F1-model_v4 DinB-like domain-containing protein 0.9749 2 113
AF-A0A2V8XQY7-F1-model_v4 DinB-like domain-containing protein 0.966 4 150
AF-A0A2V9HB78-F1-model_v4 DinB-like domain-containing protein 0.9659 4 150
AF-A0A4P5T2C5-F1-model_v4 DinB-like domain-containing protein 0.9654 1 152

Feature Viewer

pLDDT pTM Quality
93.02 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map