F388250

General Info

Members Datasets Scaffolds Average Seq Length
287 152 574 204

Family's Representative Sequence

Representative Sequence 3300049589|Ga0501073_0019179|Ga0501073_0019179_1607_2296
Length 229
Sequence LRQAEAFARGGEQRDEPYYNQARMEPRRHFSMLREFQLADLVTLLNGFAGTGALFSFMRFLVDGKAWCFWLGTSLLPVALAMDILDGRVARSRSEASLLGQELDSLADIVSFGVGPAAMAFAAGMRGGWDALCLMYFVACGISRLARYNVTAATLSDQAGKVRYFEGLPIPSSLLLVLLLAVLAGLGRWQSELPLGALSLGPATLHPLALLYVLHGSAMISKTLRIKKL

Samples

Sample ID Description Type Environment
1 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
48 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
51 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
71 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
72 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
73 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
74 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
75 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
76 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
77 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
78 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
79 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
82 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
83 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
84 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
87 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
88 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
89 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
90 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
91 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
92 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
93 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
94 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
95 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
96 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
97 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
98 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
99 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
100 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
101 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
102 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
103 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
106 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
107 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
123 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
124 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
127 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
128 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
129 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
130 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
131 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
132 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
133 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
134 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
137 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
138 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
139 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
140 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
141 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
142 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
143 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
144 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
145 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
146 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
147 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
148 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
149 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
150 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
151 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
152 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 0
Isolates 1.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.5
Nodule 1.05
Rhizoplane 3.83
Rhizosphere 80.49
Stem 0
Stem Tuber 0
Unclassified 1.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501073_0019179 3300049589 Bacteria 4942
2 JGI25151J46595_10000965 3300003187 Bacteria 21865
3 JGI25151J46595_10009708 3300003187 Bacteria 4534
4 JGI25151J46595_10013465 3300003187 Bacteria 3680
5 JGI25151J46595_10015490 3300003187 Bacteria 3357
6 rootH2_10041485 3300003320 Bacteria 21931
7 rootL2_10063360 3300003322 Bacteria 2568
8 rootL2_10070487 3300003322 Bacteria 6396
9 rootH1_10329290 3300003323 Bacteria 1981
10 Ga0055526_1002315 3300003771 Bacteria 12979
11 Ga0055526_1003272 3300003771 Bacteria 10400
12 Ga0055526_1021862 3300003771 Bacteria 2203
13 Ga0055537_1005002 3300003773 Bacteria 3638
14 Ga0055524_1002325 3300003775 Bacteria 9891
15 Ga0055524_1007575 3300003775 Bacteria 4592
16 Ga0055536_1000090 3300003781 Bacteria 77889
17 Ga0055534_1002544 3300003784 Bacteria 6254
18 Ga0055534_1005085 3300003784 Bacteria 3622
19 Ga0070677_10002822 3300005333 Bacteria 5566
20 Ga0070689_100006668 3300005340 Bacteria 8022
21 Ga0070691_10266370 3300005341 Bacteria 924
22 Ga0070675_100070590 3300005354 Bacteria 2895
23 Ga0070675_100233872 3300005354 Bacteria 1604
24 Ga0070673_100008049 3300005364 Bacteria 6985
25 Ga0070688_100001280 3300005365 Bacteria 12529
26 Ga0070667_100206316 3300005367 Bacteria 1745
27 Ga0070703_10106755 3300005406 Bacteria 995
28 Ga0070705_100156267 3300005440 Bacteria 1519
29 Ga0070694_100233193 3300005444 Bacteria 1385
30 Ga0070708_100096947 3300005445 Bacteria 2695
31 Ga0070685_10014596 3300005466 Bacteria 4163
32 Ga0070707_100428588 3300005468 Bacteria 1283
33 Ga0070707_100447716 3300005468 Bacteria 1252
34 Ga0070707_100684778 3300005468 Bacteria 988
35 Ga0070698_100288378 3300005471 Bacteria 1572
36 Ga0070672_100034265 3300005543 Unclassified 3853
37 Ga0070686_100153664 3300005544 Bacteria 1614
38 Ga0070704_100000613 3300005549 Bacteria 17180
39 Ga0070704_100280060 3300005549 Bacteria 1381
40 Ga0070704_100399447 3300005549 Bacteria 1173
41 Ga0068856_100158251 3300005614 Bacteria 2275
42 Ga0081455_10033430 3300005937 Bacteria 4621
43 Ga0097621_100254342 3300006237 Bacteria 1539
44 Ga0068871_100184150 3300006358 Bacteria 1796
45 Ga0075428_100069544 3300006844 Bacteria 3849
46 Ga0075428_100806028 3300006844 Bacteria 998
47 Ga0075431_100340409 3300006847 Bacteria 1509
48 Ga0075433_10028917 3300006852 Bacteria 4716
49 Ga0075433_10208306 3300006852 Bacteria 1738
50 Ga0075434_100008057 3300006871 Bacteria 9773
51 Ga0075429_100000762 3300006880 Bacteria 25370
52 Ga0075435_100003673 3300007076 Bacteria 10451
53 Ga0111539_10020326 3300009094 Bacteria 8179
54 Ga0111539_10378750 3300009094 Bacteria 1647
55 Ga0111539_10650273 3300009094 Bacteria 1228
56 Ga0111539_11058141 3300009094 Bacteria 943
57 Ga0111539_11375796 3300009094 Bacteria 819
58 Ga0114129_10020604 3300009147 Bacteria 9376
59 Ga0105238_10853120 3300009551 Bacteria 928
60 Ga0105249_10258735 3300009553 Bacteria 1728
61 Ga0157374_10144740 3300013296 Bacteria 2308
62 Ga0157378_10824076 3300013297 Bacteria 955
63 Ga0163163_10308561 3300014325 Bacteria 1635
64 Ga0157379_10109093 3300014968 Bacteria 2485
65 Ga0209565_1000109 3300025263 Bacteria 120345
66 Ga0209565_1002589 3300025263 Bacteria 6417
67 Ga0209130_1025200 3300025284 Bacteria 1290
68 Ga0209675_1000291 3300025291 Bacteria 46848
69 Ga0209675_1002300 3300025291 Bacteria 9913
70 Ga0209675_1003065 3300025291 Bacteria 8194
71 Ga0209676_1000059 3300025292 Bacteria 344882
72 Ga0209025_1000307 3300025294 Bacteria 108704
73 Ga0209025_1000879 3300025294 Bacteria 47123
74 Ga0209025_1001123 3300025294 Bacteria 38329
75 Ga0209025_1002346 3300025294 Bacteria 20392
76 Ga0209025_1046238 3300025294 Bacteria 1793
77 Ga0209564_1000623 3300025295 Bacteria 53919
78 Ga0209564_1001597 3300025295 Bacteria 22104
79 Ga0209564_1003792 3300025295 Bacteria 9828
80 Ga0209256_1000355 3300025299 Bacteria 74710
81 Ga0209256_1002908 3300025299 Bacteria 12916
82 Ga0209051_1008928 3300025303 Bacteria 5235
83 Ga0209051_1038986 3300025303 Bacteria 1722
84 Ga0207682_10028849 3300025893 Bacteria 2217
85 Ga0207680_10059170 3300025903 Bacteria 2326
86 Ga0207662_10014519 3300025918 Bacteria 4422
87 Ga0207662_10202037 3300025918 Bacteria 1287
88 Ga0207646_10327529 3300025922 Bacteria 1384
89 Ga0207646_10359503 3300025922 Bacteria 1315
90 Ga0207646_10581462 3300025922 Bacteria 1006
91 Ga0207659_10062257 3300025926 Bacteria 2693
92 Ga0207659_10194784 3300025926 Bacteria 1615
93 Ga0207659_10319383 3300025926 Bacteria 1281
94 Ga0207709_10099455 3300025935 Bacteria 1919
95 Ga0207670_10117988 3300025936 Bacteria 1924
96 Ga0207691_10042176 3300025940 Unclassified 4206
97 Ga0207661_10782113 3300025944 Bacteria 879
98 Ga0207651_10070125 3300025960 Bacteria 2478
99 Ga0207658_10186890 3300025986 Bacteria 1719
100 Ga0207678_10608919 3300026067 Bacteria 958
101 Ga0207702_10392718 3300026078 Bacteria 1336
102 Ga0207683_10554384 3300026121 Bacteria 1063
103 Ga0207683_11285698 3300026121 Bacteria 677
104 Ga0207698_10546673 3300026142 Bacteria 1134
105 Ga0207428_10067430 3300027907 Bacteria 2817
106 Ga0207428_10537872 3300027907 Bacteria 846
107 Ga0307515_10105753 3300028794 Bacteria 3347
108 Ga0265338_10251563 3300028800 Bacteria 1303
109 Ga0265325_10002214 3300031241 Bacteria 13195
110 Ga0265325_10030069 3300031241 Bacteria 2915
111 Ga0265329_10122479 3300031242 Bacteria 834
112 Ga0265340_10001044 3300031247 Bacteria 15778
113 Ga0265340_10009306 3300031247 Bacteria 5277
114 Ga0265331_10006100 3300031250 Bacteria 7172
115 Ga0265331_10161377 3300031250 Bacteria 1016
116 Ga0265316_10161673 3300031344 Bacteria 1674
117 Ga0307508_10000209 3300031616 Bacteria 71055
118 Ga0265314_10000017 3300031711 Bacteria 340498
119 Ga0265342_10000457 3300031712 Bacteria 44579
120 Ga0307410_10774145 3300031852 Bacteria 814
121 Ga0373954_0007582 3300035118 Bacteria 4751
122 Ga0373956_0018706 3300035119 Bacteria 2935
123 Ga0373955_0268674 3300035172 Bacteria 1025
124 Ga0373933_0009046 3300035724 Bacteria 5434
125 Ga0373937_0003335 3300036401 Bacteria 13482
126 Ga0373937_0380608 3300036401 Bacteria 1338
127 Ga0373937_1053594 3300036401 Bacteria 762
128 Ga0451802_2190096 3300041460 Bacteria 1079
129 Ga0451807_1278270 3300041486 Bacteria 775
130 Ga0451849_0395837 3300041505 Bacteria 1982
131 Ga0451853_0887152 3300041512 Bacteria 20727
132 Ga0451853_1579252 3300041512 Bacteria 1064
133 Ga0453683_0185720 3300044673 Bacteria 1319
134 Ga0451576_1125250 3300045051 Bacteria 821
135 Ga0495641_0189917 3300046461 Bacteria 920
136 Ga0495580_0001846 3300046472 Bacteria 18631
137 Ga0495652_0356091 3300046529 Bacteria 1047
138 Ga0495622_0066007 3300046557 Bacteria 1673
139 Ga0495647_0493474 3300046681 Unclassified 569
140 Ga0495658_0601597 3300046683 Bacteria 704
141 Ga0495636_0001921 3300047318 Bacteria 7955
142 Ga0495680_0030868 3300047322 Bacteria 4367
143 Ga0495680_0368009 3300047322 Bacteria 998
144 Ga0496102_0357059 3300048905 Bacteria 1376
145 Ga0496104_0199837 3300048907 Bacteria 1911
146 Ga0496106_0291135 3300048909 Bacteria 1309
147 Ga0496107_0376966 3300048910 Bacteria 1055
148 Ga0496107_0656851 3300048910 Bacteria 773
149 Ga0496109_0273350 3300048912 Bacteria 1592
150 Ga0496114_0002284 3300048917 Bacteria 14604
151 Ga0496114_0004523 3300048917 Bacteria 10794
152 Ga0496115_0075016 3300048918 Bacteria 2747
153 Ga0501031_0051281 3300049568 Bacteria 2687
154 Ga0501032_0000339 3300049569 Bacteria 39056
155 Ga0501032_0031237 3300049569 Bacteria 3652
156 Ga0501033_0003421 3300049570 Bacteria 13068
157 Ga0501033_0008578 3300049570 Bacteria 7909
158 Ga0501033_0249684 3300049570 Bacteria 1258
159 Ga0501033_0631475 3300049570 Bacteria 733
160 Ga0501034_0000128 3300049571 Bacteria 140568
161 Ga0501034_0645974 3300049571 Bacteria 960
162 Ga0501036_0002780 3300049572 Bacteria 13855
163 Ga0501037_0039400 3300049573 Bacteria 3479
164 Ga0501037_0156617 3300049573 Bacteria 1625
165 Ga0501038_0002211 3300049574 Bacteria 18095
166 Ga0501038_0171798 3300049574 Bacteria 1754
167 Ga0501039_0014211 3300049575 Bacteria 6095
168 Ga0501039_0025497 3300049575 Bacteria 4543
169 Ga0501039_0028703 3300049575 Bacteria 4284
170 Ga0501039_0035399 3300049575 Bacteria 3853
171 Ga0501040_0019728 3300049576 Bacteria 4486
172 Ga0501040_0033690 3300049576 Bacteria 3471
173 Ga0501040_0083260 3300049576 Bacteria 2219
174 Ga0501041_0003167 3300049577 Bacteria 9467
175 Ga0501041_0033407 3300049577 Bacteria 3113
176 Ga0501041_0150744 3300049577 Bacteria 1452
177 Ga0501041_0430123 3300049577 Bacteria 837
178 Ga0501042_0002937 3300049578 Bacteria 10584
179 Ga0501042_0027858 3300049578 Bacteria 3975
180 Ga0501043_0006370 3300049579 Bacteria 9482
181 Ga0501043_0119163 3300049579 Bacteria 2070
182 Ga0501043_0156869 3300049579 Bacteria 1780
183 Ga0501043_0308504 3300049579 Bacteria 1208
184 Ga0501046_0000113 3300049580 Bacteria 85473
185 Ga0501046_0001005 3300049580 Bacteria 27585
186 Ga0501046_0008578 3300049580 Bacteria 8894
187 Ga0501046_0009534 3300049580 Bacteria 8386
188 Ga0501046_0066780 3300049580 Bacteria 2802
189 Ga0501046_0375931 3300049580 Bacteria 1029
190 Ga0501047_0005201 3300049581 Bacteria 12214
191 Ga0501047_0101063 3300049581 Unclassified 2763
192 Ga0501047_0104875 3300049581 Bacteria 2707
193 Ga0501047_0111864 3300049581 Bacteria 2613
194 Ga0501048_0018436 3300049582 Bacteria 5132
195 Ga0501048_0043615 3300049582 Bacteria 3210
196 Ga0501048_0113058 3300049582 Bacteria 1918
197 Ga0501068_0007365 3300049584 Bacteria 6094
198 Ga0501070_0233036 3300049586 Bacteria 1508
199 Ga0501070_0266943 3300049586 Bacteria 1398
200 Ga0501070_0335138 3300049586 Bacteria 1229
201 Ga0501071_0029871 3300049587 Bacteria 3850
202 Ga0501071_0051320 3300049587 Bacteria 2971
203 Ga0501071_0281187 3300049587 Bacteria 1259
204 Ga0501071_0397547 3300049587 Bacteria 1052
205 Ga0501071_0402487 3300049587 Bacteria 1045
206 Ga0501072_0011490 3300049588 Bacteria 6768
207 Ga0501072_0016215 3300049588 Bacteria 5715
208 Ga0501072_0059013 3300049588 Bacteria 3025
209 Ga0501072_0304274 3300049588 Bacteria 1267
210 Ga0501073_0002411 3300049589 Bacteria 13994
211 Ga0501073_0678211 3300049589 Bacteria 711
212 Ga0501074_0012716 3300049590 Bacteria 6119
213 Ga0501074_0033036 3300049590 Bacteria 3750
214 Ga0501074_0033698 3300049590 Bacteria 3712
215 Ga0501074_0617921 3300049590 Bacteria 766
216 Ga0501075_0005822 3300049591 Bacteria 8437
217 Ga0501075_0006887 3300049591 Bacteria 7851
218 Ga0501075_0064853 3300049591 Bacteria 2755
219 Ga0501075_0103894 3300049591 Bacteria 2159
220 Ga0501075_0434967 3300049591 Bacteria 1000
221 Ga0501076_0003636 3300049592 Bacteria 10832
222 Ga0501076_0068083 3300049592 Bacteria 2843
223 Ga0501076_0090552 3300049592 Bacteria 2460
224 Ga0501076_0191852 3300049592 Bacteria 1667
225 Ga0501076_0302788 3300049592 Unclassified 1311
226 Ga0501077_0007945 3300049593 Bacteria 6554
227 Ga0501077_0015549 3300049593 Bacteria 4791
228 Ga0501079_0000151 3300049741 Bacteria 37825
229 Ga0501079_0002078 3300049741 Bacteria 14359
230 Ga0501079_0007269 3300049741 Bacteria 8363
231 Ga0501079_0087083 3300049741 Bacteria 2418
232 Ga0501079_0102206 3300049741 Bacteria 2223
233 Ga0501079_0345489 3300049741 Bacteria 1166
234 Ga0501080_0012423 3300049742 Bacteria 7807
235 Ga0501080_0040753 3300049742 Bacteria 4331
236 Ga0501080_0823362 3300049742 Bacteria 813
237 Ga0501081_0001227 3300049743 Bacteria 15607
238 Ga0501081_0008415 3300049743 Bacteria 6701
239 Ga0501081_0132146 3300049743 Bacteria 1784
240 Ga0501081_0198355 3300049743 Bacteria 1455
241 Ga0501081_0243028 3300049743 Bacteria 1313
242 Ga0501083_0013838 3300049744 Bacteria 5642
243 Ga0501083_0053603 3300049744 Bacteria 2707
244 Ga0501083_0114237 3300049744 Bacteria 1773
245 Ga0501083_0363620 3300049744 Bacteria 941
246 Ga0501035_0000135 3300049822 Bacteria 89774
247 Ga0501035_0000394 3300049822 Bacteria 49952
248 Ga0501035_0244052 3300049822 Bacteria 1527
249 Ga0501035_0328640 3300049822 Bacteria 1283
250 Ga0501044_0000204 3300049823 Bacteria 75175
251 Ga0501044_0007744 3300049823 Bacteria 11808
252 Ga0501045_0017304 3300049824 Bacteria 5116
253 Ga0501045_0259813 3300049824 Bacteria 1292
254 nmdc:mga0k408_2431_c1 3300050493 Bacteria 7118
255 nmdc:mga05p37_931_c1 3300050507 Bacteria 32975
256 nmdc:mga09592_75_c1 3300050508 Bacteria 56459
257 nmdc:mga06r32_15504_c1 3300050510 Bacteria 6920
258 nmdc:mga06r32_568844_c1 3300050510 Bacteria 1106
259 nmdc:mga06r32_62760_c1 3300050510 Bacteria 3580
260 nmdc:mga06r32_643734_c1 3300050510 Bacteria 1028
261 nmdc:mga08y16_2482_c1 3300050511 Bacteria 18949
262 nmdc:mga08y16_384723_c1 3300050511 Bacteria 1438
263 nmdc:mga08y16_665330_c1 3300050511 Bacteria 1044
264 nmdc:mga0n895_12757_c1 3300050512 Bacteria 7547
265 nmdc:mga0n895_167566_c1 3300050512 Bacteria 2229
266 nmdc:mga0rr50_21149_c1 3300050513 Bacteria 4435
267 nmdc:mga08x19_54074_c1 3300050514 Bacteria 2584
268 nmdc:mga0a205_13980_c1 3300050515 Bacteria 7486
269 nmdc:mga0a205_50635_c1 3300050515 Bacteria 4010
270 Ga0501084_0005718 3300054114 Bacteria 10219
271 Ga0501084_0011309 3300054114 Bacteria 7390
272 Ga0501084_0035141 3300054114 Bacteria 4189
273 Ga0501084_0061149 3300054114 Bacteria 3153
274 Ga0501084_0067149 3300054114 Bacteria 3001
275 Ga0501084_0465505 3300054114 Bacteria 1069
276 Ga0590071_017662 3300059421 Bacteria 1676
277 Ga0501082_0001193 3300060353 Bacteria 22862
278 Ga0501082_0003488 3300060353 Bacteria 13722
279 Ga0501082_0077620 3300060353 Bacteria 2864
280 Ga0501082_0085300 3300060353 Bacteria 2724
281 Ga0501082_0317457 3300060353 Bacteria 1357
282 Ga0530510_0005750 3300061734 Bacteria 8592
283 Ga0530510_0011138 3300061734 Bacteria 6308
284 Ga0530510_0357499 3300061734 Bacteria 1097
285 2513952394 2513237150 Bacteria 6553639
286 2514041717 2513237165 Bacteria 6771773
287 644750988 644736347 Bacteria 6476522
288 Ga0501073_0019179
289 JGI25151J46595_10000965
290 JGI25151J46595_10009708
291 JGI25151J46595_10013465
292 JGI25151J46595_10015490
293 rootH2_10041485
294 rootL2_10063360
295 rootL2_10070487
296 rootH1_10329290
297 Ga0055526_1002315
298 Ga0055526_1003272
299 Ga0055526_1021862
300 Ga0055537_1005002
301 Ga0055524_1002325
302 Ga0055524_1007575
303 Ga0055536_1000090
304 Ga0055534_1002544
305 Ga0055534_1005085
306 Ga0070677_10002822
307 Ga0070689_100006668
308 Ga0070691_10266370
309 Ga0070675_100070590
310 Ga0070675_100233872
311 Ga0070673_100008049
312 Ga0070688_100001280
313 Ga0070667_100206316
314 Ga0070703_10106755
315 Ga0070705_100156267
316 Ga0070694_100233193
317 Ga0070708_100096947
318 Ga0070685_10014596
319 Ga0070707_100428588
320 Ga0070707_100447716
321 Ga0070707_100684778
322 Ga0070698_100288378
323 Ga0070672_100034265
324 Ga0070686_100153664
325 Ga0070704_100000613
326 Ga0070704_100280060
327 Ga0070704_100399447
328 Ga0068856_100158251
329 Ga0081455_10033430
330 Ga0097621_100254342
331 Ga0068871_100184150
332 Ga0075428_100069544
333 Ga0075428_100806028
334 Ga0075431_100340409
335 Ga0075433_10028917
336 Ga0075433_10208306
337 Ga0075434_100008057
338 Ga0075429_100000762
339 Ga0075435_100003673
340 Ga0111539_10020326
341 Ga0111539_10378750
342 Ga0111539_10650273
343 Ga0111539_11058141
344 Ga0111539_11375796
345 Ga0114129_10020604
346 Ga0105238_10853120
347 Ga0105249_10258735
348 Ga0157374_10144740
349 Ga0157378_10824076
350 Ga0163163_10308561
351 Ga0157379_10109093
352 Ga0209565_1000109
353 Ga0209565_1002589
354 Ga0209130_1025200
355 Ga0209675_1000291
356 Ga0209675_1002300
357 Ga0209675_1003065
358 Ga0209676_1000059
359 Ga0209025_1000307
360 Ga0209025_1000879
361 Ga0209025_1001123
362 Ga0209025_1002346
363 Ga0209025_1046238
364 Ga0209564_1000623
365 Ga0209564_1001597
366 Ga0209564_1003792
367 Ga0209256_1000355
368 Ga0209256_1002908
369 Ga0209051_1008928
370 Ga0209051_1038986
371 Ga0207682_10028849
372 Ga0207680_10059170
373 Ga0207662_10014519
374 Ga0207662_10202037
375 Ga0207646_10327529
376 Ga0207646_10359503
377 Ga0207646_10581462
378 Ga0207659_10062257
379 Ga0207659_10194784
380 Ga0207659_10319383
381 Ga0207709_10099455
382 Ga0207670_10117988
383 Ga0207691_10042176
384 Ga0207661_10782113
385 Ga0207651_10070125
386 Ga0207658_10186890
387 Ga0207678_10608919
388 Ga0207702_10392718
389 Ga0207683_10554384
390 Ga0207683_11285698
391 Ga0207698_10546673
392 Ga0207428_10067430
393 Ga0207428_10537872
394 Ga0307515_10105753
395 Ga0265338_10251563
396 Ga0265325_10002214
397 Ga0265325_10030069
398 Ga0265329_10122479
399 Ga0265340_10001044
400 Ga0265340_10009306
401 Ga0265331_10006100
402 Ga0265331_10161377
403 Ga0265316_10161673
404 Ga0307508_10000209
405 Ga0265314_10000017
406 Ga0265342_10000457
407 Ga0307410_10774145
408 Ga0373954_0007582
409 Ga0373956_0018706
410 Ga0373955_0268674
411 Ga0373933_0009046
412 Ga0373937_0003335
413 Ga0373937_0380608
414 Ga0373937_1053594
415 Ga0451802_2190096
416 Ga0451807_1278270
417 Ga0451849_0395837
418 Ga0451853_0887152
419 Ga0451853_1579252
420 Ga0453683_0185720
421 Ga0451576_1125250
422 Ga0495641_0189917
423 Ga0495580_0001846
424 Ga0495652_0356091
425 Ga0495622_0066007
426 Ga0495647_0493474
427 Ga0495658_0601597
428 Ga0495636_0001921
429 Ga0495680_0030868
430 Ga0495680_0368009
431 Ga0496102_0357059
432 Ga0496104_0199837
433 Ga0496106_0291135
434 Ga0496107_0376966
435 Ga0496107_0656851
436 Ga0496109_0273350
437 Ga0496114_0002284
438 Ga0496114_0004523
439 Ga0496115_0075016
440 Ga0501031_0051281
441 Ga0501032_0000339
442 Ga0501032_0031237
443 Ga0501033_0003421
444 Ga0501033_0008578
445 Ga0501033_0249684
446 Ga0501033_0631475
447 Ga0501034_0000128
448 Ga0501034_0645974
449 Ga0501036_0002780
450 Ga0501037_0039400
451 Ga0501037_0156617
452 Ga0501038_0002211
453 Ga0501038_0171798
454 Ga0501039_0014211
455 Ga0501039_0025497
456 Ga0501039_0028703
457 Ga0501039_0035399
458 Ga0501040_0019728
459 Ga0501040_0033690
460 Ga0501040_0083260
461 Ga0501041_0003167
462 Ga0501041_0033407
463 Ga0501041_0150744
464 Ga0501041_0430123
465 Ga0501042_0002937
466 Ga0501042_0027858
467 Ga0501043_0006370
468 Ga0501043_0119163
469 Ga0501043_0156869
470 Ga0501043_0308504
471 Ga0501046_0000113
472 Ga0501046_0001005
473 Ga0501046_0008578
474 Ga0501046_0009534
475 Ga0501046_0066780
476 Ga0501046_0375931
477 Ga0501047_0005201
478 Ga0501047_0101063
479 Ga0501047_0104875
480 Ga0501047_0111864
481 Ga0501048_0018436
482 Ga0501048_0043615
483 Ga0501048_0113058
484 Ga0501068_0007365
485 Ga0501070_0233036
486 Ga0501070_0266943
487 Ga0501070_0335138
488 Ga0501071_0029871
489 Ga0501071_0051320
490 Ga0501071_0281187
491 Ga0501071_0397547
492 Ga0501071_0402487
493 Ga0501072_0011490
494 Ga0501072_0016215
495 Ga0501072_0059013
496 Ga0501072_0304274
497 Ga0501073_0002411
498 Ga0501073_0678211
499 Ga0501074_0012716
500 Ga0501074_0033036
501 Ga0501074_0033698
502 Ga0501074_0617921
503 Ga0501075_0005822
504 Ga0501075_0006887
505 Ga0501075_0064853
506 Ga0501075_0103894
507 Ga0501075_0434967
508 Ga0501076_0003636
509 Ga0501076_0068083
510 Ga0501076_0090552
511 Ga0501076_0191852
512 Ga0501076_0302788
513 Ga0501077_0007945
514 Ga0501077_0015549
515 Ga0501079_0000151
516 Ga0501079_0002078
517 Ga0501079_0007269
518 Ga0501079_0087083
519 Ga0501079_0102206
520 Ga0501079_0345489
521 Ga0501080_0012423
522 Ga0501080_0040753
523 Ga0501080_0823362
524 Ga0501081_0001227
525 Ga0501081_0008415
526 Ga0501081_0132146
527 Ga0501081_0198355
528 Ga0501081_0243028
529 Ga0501083_0013838
530 Ga0501083_0053603
531 Ga0501083_0114237
532 Ga0501083_0363620
533 Ga0501035_0000135
534 Ga0501035_0000394
535 Ga0501035_0244052
536 Ga0501035_0328640
537 Ga0501044_0000204
538 Ga0501044_0007744
539 Ga0501045_0017304
540 Ga0501045_0259813
541 nmdc:mga0k408_2431_c1
542 nmdc:mga05p37_931_c1
543 nmdc:mga09592_75_c1
544 nmdc:mga06r32_15504_c1
545 nmdc:mga06r32_568844_c1
546 nmdc:mga06r32_62760_c1
547 nmdc:mga06r32_643734_c1
548 nmdc:mga08y16_2482_c1
549 nmdc:mga08y16_384723_c1
550 nmdc:mga08y16_665330_c1
551 nmdc:mga0n895_12757_c1
552 nmdc:mga0n895_167566_c1
553 nmdc:mga0rr50_21149_c1
554 nmdc:mga08x19_54074_c1
555 nmdc:mga0a205_13980_c1
556 nmdc:mga0a205_50635_c1
557 Ga0501084_0005718
558 Ga0501084_0011309
559 Ga0501084_0035141
560 Ga0501084_0061149
561 Ga0501084_0067149
562 Ga0501084_0465505
563 Ga0590071_017662
564 Ga0501082_0001193
565 Ga0501082_0003488
566 Ga0501082_0077620
567 Ga0501082_0085300
568 Ga0501082_0317457
569 Ga0530510_0005750
570 Ga0530510_0011138
571 Ga0530510_0357499
572 2513952394
573 2514041717
574 644750988

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

36

213

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b1l-assembly1.cif.gz_A crystal structure of phosphatidyl serine synthase (pss) in the closed conformation with bound citrate. 0.7732 11 212
4q7c-assembly1.cif.gz_B structure of af2299, a cdp-alcohol phosphotransferase 0.7333 20 201
4q7c-assembly1.cif.gz_A structure of af2299, a cdp-alcohol phosphotransferase 0.7307 20 202
4o6m-assembly1.cif.gz_A structure of af2299, a cdp-alcohol phosphotransferase (cmp-bound) 0.73 20 202
4mnd-assembly1.cif.gz_A-2 crystal structure of archaeoglobus fulgidus ipct-dipps bifunctional membrane protein 0.7242 20 203
ID Description Score Start End Superfamily
af_O94584_24_237_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.924 6 209 1.20.120.1760
af_A0A1D8PF32_71_260_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8957 10 198 1.20.120.1760
af_A0A1D8PF32_71_260_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8867 10 198 1.20.120.1760
af_O94584_24_237_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8861 6 209 1.20.120.1760
af_E7F188_23_199_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8635 20 210 1.20.120.1760
ID Description Score Start End GO Terms
AF-A0A841RXP0-F1-model_v4 deleted 0.9634 7 212
AF-Q5H0P8-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.958 6 212 GO:0008654
GO:0016020
GO:0016780
AF-A0A4Y6Q2U0-F1-model_v4 CDP-diacylglycerol--serine O-phosphatidyltransferase 0.9539 13 212 GO:0008654
GO:0016020
GO:0016780
AF-A0A6G8CW73-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) (EC 2.7.8.8) (CDP-diacylglycerol--serine O-phosphatidyltransferase) (Phosphatidylserine synthase) 0.9531 6 212 GO:0003882
GO:0008654
GO:0012505
GO:0016020
AF-A0A0D1X4C3-F1-model_v4 CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8) (Phosphatidylserine synthase) 0.9529 18 212 GO:0003882
GO:0005783
GO:0006646
GO:0006659
GO:0016020

Map