F388063

General Info

Members Datasets Scaffolds Average Seq Length
287 157 572 60

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10711606|Ga0265338_107116062
Length 69
Sequence MQKLFGEFGALLSAFLREDEGQDLIEYTLLLAFVALASATMFIRAGGSIKSIWTTTNSQLAXXXXSATS

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300009829 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample D Metatranscriptome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300019181 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
98 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
101 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
102 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
103 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
105 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
106 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
112 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
122 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
125 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
126 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
127 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
132 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
133 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
134 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
135 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
136 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
139 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
140 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
141 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
142 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
143 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
144 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.47
Metatranscriptomes 4.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.05
Rhizosphere 97.91
Stem 0
Stem Tuber 0
Unclassified 53.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10711606 3300028800 Unclassified 692
2 Ga0058863_11667784 3300004799 Bacteria 868
3 Ga0058863_11789869 3300004799 Bacteria 935
4 Ga0058861_11954858 3300004800 Bacteria 1242
5 Ga0058862_12217394 3300004803 Unclassified 586
6 Ga0058862_12254555 3300004803 Bacteria 694
7 Ga0058862_12879301 3300004803 Unclassified 793
8 Ga0058862_12890157 3300004803 Bacteria 1523
9 Ga0070658_10034329 3300005327 Unclassified 4081
10 Ga0070683_100318123 3300005329 Unclassified 1481
11 Ga0070683_100760737 3300005329 Unclassified 928
12 Ga0070683_101860931 3300005329 Unclassified 578
13 Ga0070683_102421080 3300005329 Unclassified 503
14 Ga0070666_10018674 3300005335 Bacteria 4464
15 Ga0070660_100379076 3300005339 Bacteria 1167
16 Ga0070660_100749720 3300005339 Bacteria 820
17 Ga0070691_10461037 3300005341 Unclassified 727
18 Ga0070671_100931119 3300005355 Unclassified 760
19 Ga0070667_100197934 3300005367 Bacteria 1782
20 Ga0070709_10116498 3300005434 Unclassified 1804
21 Ga0070709_10466982 3300005434 Bacteria 953
22 Ga0070714_100511303 3300005435 Bacteria 1146
23 Ga0070713_100437641 3300005436 Unclassified 1226
24 Ga0070713_101111440 3300005436 Bacteria 764
25 Ga0070713_101320347 3300005436 Unclassified 699
26 Ga0070710_10206579 3300005437 Bacteria 1243
27 Ga0070705_100147841 3300005440 Bacteria 1555
28 Ga0070694_100154994 3300005444 Unclassified 1676
29 Ga0070708_100779618 3300005445 Unclassified 899
30 Ga0070708_101537722 3300005445 Bacteria 620
31 Ga0070681_10142005 3300005458 Bacteria 2330
32 Ga0070681_11547187 3300005458 Unclassified 588
33 Ga0068867_100126687 3300005459 Bacteria 1980
34 Ga0068867_100991595 3300005459 Unclassified 761
35 Ga0068867_101210890 3300005459 Unclassified 694
36 Ga0070685_11155572 3300005466 Unclassified 587
37 Ga0070706_100322226 3300005467 Unclassified 1441
38 Ga0070707_100898625 3300005468 Unclassified 850
39 Ga0070698_100606539 3300005471 Bacteria 1035
40 Ga0070698_100857886 3300005471 Unclassified 853
41 Ga0070699_100212077 3300005518 Unclassified 1724
42 Ga0070699_100541732 3300005518 Bacteria 1059
43 Ga0070699_100733213 3300005518 Bacteria 903
44 Ga0070697_100073737 3300005536 Bacteria 2803
45 Ga0070697_100131954 3300005536 Unclassified 2096
46 Ga0070697_100162204 3300005536 Unclassified 1889
47 Ga0070665_100229201 3300005548 Bacteria 1858
48 Ga0070665_101135079 3300005548 Unclassified 793
49 Ga0068855_100045619 3300005563 Bacteria 5183
50 Ga0068855_100735597 3300005563 Unclassified 1053
51 Ga0068855_100743363 3300005563 Bacteria 1046
52 Ga0068855_100881625 3300005563 Unclassified 946
53 Ga0068856_100093024 3300005614 Unclassified 3000
54 Ga0068856_101553674 3300005614 Bacteria 675
55 Ga0068856_101943957 3300005614 Unclassified 599
56 Ga0068852_100504451 3300005616 Unclassified 1205
57 Ga0068870_10472102 3300005840 Unclassified 831
58 Ga0068860_100706444 3300005843 Bacteria 1018
59 Ga0070717_10300084 3300006028 Unclassified 1428
60 Ga0070715_10080946 3300006163 Unclassified 1474
61 Ga0070716_101543008 3300006173 Bacteria 544
62 Ga0070712_101494402 3300006175 Unclassified 590
63 Ga0070712_101694776 3300006175 Unclassified 553
64 Ga0097621_101677423 3300006237 Bacteria 605
65 Ga0097621_102179877 3300006237 Unclassified 530
66 Ga0068871_100366196 3300006358 Unclassified 1278
67 Ga0068871_100762538 3300006358 Unclassified 890
68 Ga0068871_101350065 3300006358 Unclassified 671
69 Ga0068871_101468473 3300006358 Bacteria 644
70 Ga0075428_101750117 3300006844 Unclassified 648
71 Ga0075434_101688085 3300006871 Unclassified 641
72 Ga0075434_101955472 3300006871 Unclassified 592
73 Ga0075436_100001482 3300006914 Bacteria 15994
74 Ga0075436_100003775 3300006914 Bacteria 10388
75 Ga0075435_101734275 3300007076 Unclassified 548
76 Ga0105240_10003031 3300009093 Bacteria 26427
77 Ga0105240_10459794 3300009093 Bacteria 1422
78 Ga0105240_10483617 3300009093 Bacteria 1380
79 Ga0111539_11335829 3300009094 Unclassified 832
80 Ga0105245_12632121 3300009098 Bacteria 556
81 Ga0105247_10827754 3300009101 Unclassified 709
82 Ga0114129_11172161 3300009147 Unclassified 958
83 Ga0105241_10300794 3300009174 Unclassified 1377
84 Ga0105241_10331445 3300009174 Unclassified 1315
85 Ga0105241_10549792 3300009174 Bacteria 1036
86 Ga0105242_10408192 3300009176 Bacteria 1269
87 Ga0105248_11196887 3300009177 Unclassified 859
88 Ga0105248_11458553 3300009177 Unclassified 774
89 Ga0105248_11561940 3300009177 Unclassified 747
90 Ga0105237_10019121 3300009545 Bacteria 7079
91 Ga0105237_11747635 3300009545 Bacteria 629
92 Ga0105237_11751663 3300009545 Unclassified 629
93 Ga0105249_13292524 3300009553 Unclassified 520
94 Ga0130086_1081529 3300009829 Unclassified 635
95 Ga0105239_10222913 3300010375 Unclassified 2115
96 Ga0157370_10017524 3300013104 Bacteria 7225
97 Ga0157370_10316072 3300013104 Bacteria 1441
98 Ga0157369_10717775 3300013105 Unclassified 1029
99 Ga0157369_12574703 3300013105 Unclassified 515
100 Ga0157374_10174206 3300013296 Bacteria 2100
101 Ga0157374_11198547 3300013296 Unclassified 781
102 Ga0157374_11553979 3300013296 Unclassified 685
103 Ga0157374_11577208 3300013296 Unclassified 680
104 Ga0157378_10237808 3300013297 Unclassified 1739
105 Ga0157378_11405508 3300013297 Unclassified 741
106 Ga0157378_12665403 3300013297 Bacteria 552
107 Ga0163162_12134436 3300013306 Unclassified 643
108 Ga0163162_12317814 3300013306 Unclassified 617
109 Ga0163162_13066093 3300013306 Bacteria 537
110 Ga0157372_10011380 3300013307 Bacteria 9466
111 Ga0157372_11344139 3300013307 Bacteria 824
112 Ga0157375_10087439 3300013308 Bacteria 3169
113 Ga0157375_10882655 3300013308 Bacteria 1039
114 Ga0163163_10266001 3300014325 Unclassified 1766
115 Ga0163163_12923699 3300014325 Unclassified 533
116 Ga0157380_10932614 3300014326 Unclassified 897
117 Ga0157376_10576607 3300014969 Bacteria 1117
118 Ga0157376_11083360 3300014969 Unclassified 826
119 Ga0157376_12868259 3300014969 Bacteria 522
120 Ga0163161_10967385 3300017792 Unclassified 725
121 Ga0163161_11977980 3300017792 Unclassified 519
122 Ga0184594_119056 3300019181 Unclassified 638
123 Ga0184594_126562 3300019181 Bacteria 665
124 Ga0213875_10262354 3300021388 Bacteria 815
125 Ga0207692_10734796 3300025898 Bacteria 642
126 Ga0207680_10087294 3300025903 Bacteria 1975
127 Ga0207699_10125694 3300025906 Unclassified 1665
128 Ga0207699_10828003 3300025906 Unclassified 681
129 Ga0207705_10008918 3300025909 Bacteria 7301
130 Ga0207654_10721105 3300025911 Unclassified 717
131 Ga0207707_10024782 3300025912 Bacteria 5248
132 Ga0207695_10194306 3300025913 Bacteria 1946
133 Ga0207695_10345029 3300025913 Bacteria 1376
134 Ga0207695_11039025 3300025913 Bacteria 699
135 Ga0207671_10588365 3300025914 Unclassified 887
136 Ga0207693_11127160 3300025915 Unclassified 595
137 Ga0207663_11408707 3300025916 Unclassified 561
138 Ga0207657_10238169 3300025919 Unclassified 1453
139 Ga0207652_11190636 3300025921 Bacteria 663
140 Ga0207646_10756599 3300025922 Unclassified 867
141 Ga0207650_10541262 3300025925 Unclassified 976
142 Ga0207650_10571054 3300025925 Unclassified 949
143 Ga0207700_10075571 3300025928 Bacteria 2611
144 Ga0207700_11013336 3300025928 Bacteria 743
145 Ga0207700_12032631 3300025928 Unclassified 502
146 Ga0207711_10812577 3300025941 Unclassified 871
147 Ga0207711_11666428 3300025941 Unclassified 581
148 Ga0207711_11943999 3300025941 Unclassified 531
149 Ga0207667_10019044 3300025949 Bacteria 7673
150 Ga0207667_10168862 3300025949 Bacteria 2249
151 Ga0207667_11134831 3300025949 Unclassified 764
152 Ga0207658_10153060 3300025986 Bacteria 1881
153 Ga0207703_11058771 3300026035 Unclassified 779
154 Ga0207702_10500324 3300026078 Bacteria 1185
155 Ga0207702_11420440 3300026078 Bacteria 688
156 Ga0207648_10221131 3300026089 Bacteria 1683
157 Ga0207648_10635518 3300026089 Unclassified 986
158 Ga0207648_11150029 3300026089 Unclassified 728
159 Ga0207676_10629021 3300026095 Unclassified 1034
160 Ga0207683_11438195 3300026121 Bacteria 637
161 Ga0207698_11322235 3300026142 Unclassified 735
162 Ga0207428_11030563 3300027907 Unclassified 577
163 Ga0268266_11516271 3300028379 Bacteria 646
164 Ga0268266_11717925 3300028379 Unclassified 603
165 Ga0265338_10201110 3300028800 Bacteria 1502
166 Ga0265338_10267472 3300028800 Bacteria 1254
167 Ga0265766_1012688 3300030863 Bacteria 625
168 Ga0265777_110275 3300030877 Unclassified 684
169 Ga0265764_107953 3300030882 Unclassified 635
170 Ga0265330_10502133 3300031235 Unclassified 516
171 Ga0265331_10395259 3300031250 Unclassified 620
172 Ga0265316_10002625 3300031344 Bacteria 18526
173 Ga0265316_10297350 3300031344 Bacteria 1176
174 Ga0265316_10392518 3300031344 Bacteria 1000
175 Ga0265316_10617840 3300031344 Unclassified 768
176 Ga0265342_10408011 3300031712 Unclassified 701
177 Ga0373954_0151282 3300035118 Bacteria 1134
178 Ga0373954_0152404 3300035118 Unclassified 1129
179 Ga0373924_0086046 3300035410 Bacteria 1341
180 Ga0373935_0291547 3300035692 Bacteria 1151
181 Ga0373935_1155830 3300035692 Unclassified 577
182 Ga0373927_0154857 3300035695 Bacteria 1501
183 Ga0373927_0237005 3300035695 Unclassified 1199
184 Ga0373927_0420758 3300035695 Bacteria 882
185 Ga0373927_0653739 3300035695 Unclassified 695
186 Ga0373927_0924991 3300035695 Unclassified 575
187 Ga0373933_0770306 3300035724 Unclassified 633
188 Ga0373933_0972753 3300035724 Unclassified 559
189 Ga0373947_0084066 3300035725 Bacteria 1975
190 Ga0373947_0292956 3300035725 Unclassified 1084
191 Ga0373947_0563521 3300035725 Unclassified 776
192 Ga0373947_0804444 3300035725 Unclassified 642
193 Ga0373937_0401168 3300036401 Unclassified 1301
194 Ga0373937_0603466 3300036401 Bacteria 1042
195 Ga0373925_0075039 3300037068 Bacteria 2562
196 Ga0373925_0249568 3300037068 Unclassified 1423
197 Ga0373925_0262867 3300037068 Bacteria 1387
198 Ga0373925_0396584 3300037068 Unclassified 1125
199 Ga0436364_1538256 3300037853 Bacteria 7382
200 Ga0436365_0881855 3300039437 Bacteria 3081
201 Ga0436360_0825313 3300039438 Bacteria 722
202 Ga0451577_1964440 3300042876 Unclassified 512
203 Ga0453684_2314133 3300044712 Unclassified 534
204 Ga0466957_0553704 3300044842 Unclassified 802
205 Ga0451576_0201808 3300045051 Bacteria 2077
206 Ga0451576_0268554 3300045051 Bacteria 1783
207 Ga0495592_0002038 3300046454 Bacteria 14221
208 Ga0495592_0648187 3300046454 Bacteria 640
209 Ga0495629_0341591 3300046459 Unclassified 1022
210 Ga0495651_0009452 3300046462 Bacteria 7487
211 Ga0495653_0302362 3300046463 Unclassified 1043
212 Ga0495580_0046066 3300046472 Bacteria 3096
213 Ga0495580_0062182 3300046472 Bacteria 2620
214 Ga0495580_0063007 3300046472 Bacteria 2601
215 Ga0495580_0101065 3300046472 Bacteria 2006
216 Ga0495580_0171150 3300046472 Unclassified 1502
217 Ga0495580_0291825 3300046472 Unclassified 1112
218 Ga0495580_0579185 3300046472 Unclassified 743
219 Ga0495580_0733040 3300046472 Bacteria 645
220 Ga0495580_0798373 3300046472 Unclassified 612
221 Ga0495582_0493102 3300046473 Bacteria 708
222 Ga0495662_0013646 3300046476 Bacteria 3956
223 Ga0495662_0431381 3300046476 Unclassified 647
224 Ga0495664_0000568 3300046477 Bacteria 18530
225 Ga0495594_0283776 3300046499 Unclassified 943
226 Ga0495608_0240716 3300046511 Bacteria 1131
227 Ga0495608_0534835 3300046511 Unclassified 707
228 Ga0495618_0076272 3300046514 Bacteria 2136
229 Ga0495628_0034249 3300046516 Bacteria 4086
230 Ga0495628_0244962 3300046516 Bacteria 1340
231 Ga0495630_0136816 3300046517 Bacteria 1861
232 Ga0495630_0793066 3300046517 Bacteria 723
233 Ga0495630_1252441 3300046517 Unclassified 560
234 Ga0495666_0494132 3300046526 Bacteria 547
235 Ga0495652_0042301 3300046529 Bacteria 3929
236 Ga0495652_0176056 3300046529 Bacteria 1647
237 Ga0495652_0193571 3300046529 Unclassified 1550
238 Ga0495665_0066009 3300046531 Bacteria 1910
239 Ga0495665_0471067 3300046531 Unclassified 634
240 Ga0495586_0826545 3300046535 Bacteria 534
241 Ga0495587_0035234 3300046536 Unclassified 3016
242 Ga0495587_0177121 3300046536 Unclassified 1210
243 Ga0495587_0298031 3300046536 Bacteria 902
244 Ga0495645_0002230 3300046543 Bacteria 13177
245 Ga0495645_0142274 3300046543 Unclassified 1673
246 Ga0495645_0194029 3300046543 Unclassified 1382
247 Ga0495667_0044344 3300046559 Bacteria 2945
248 Ga0495667_0231467 3300046559 Unclassified 1178
249 Ga0495634_0032257 3300046642 Bacteria 3603
250 Ga0495634_0410719 3300046642 Unclassified 803
251 Ga0495635_0017012 3300046663 Bacteria 5078
252 Ga0495635_0095022 3300046663 Bacteria 2038
253 Ga0495657_0110482 3300046675 Unclassified 1742
254 Ga0495599_0379201 3300046678 Unclassified 844
255 Ga0495623_0046664 3300046679 Bacteria 2749
256 Ga0495623_0071924 3300046679 Bacteria 2151
257 Ga0495623_0520901 3300046679 Unclassified 625
258 Ga0495623_0737956 3300046679 Unclassified 502
259 Ga0495613_0044281 3300046689 Bacteria 3293
260 Ga0495613_0254740 3300046689 Bacteria 1224
261 Ga0495613_1080218 3300046689 Unclassified 513
262 Ga0495600_0043727 3300046809 Bacteria 2921
263 Ga0495600_0327064 3300046809 Bacteria 963
264 Ga0495581_0625833 3300047315 Unclassified 623
265 Ga0495604_0056849 3300047317 Bacteria 3009
266 Ga0495604_0458104 3300047317 Unclassified 832
267 Ga0495674_0014880 3300047319 Bacteria 7279
268 Ga0495674_0082884 3300047319 Bacteria 2749
269 Ga0495674_0794240 3300047319 Unclassified 737
270 Ga0495680_0015641 3300047322 Bacteria 6539
271 Ga0495675_0039212 3300047444 Bacteria 3017
272 Ga0495675_0801918 3300047444 Bacteria 521
273 Ga0495684_0003827 3300047471 Bacteria 11720
274 Ga0495684_0081434 3300047471 Bacteria 2456
275 Ga0495684_0601067 3300047471 Unclassified 742
276 Ga0495602_0297593 3300048088 Bacteria 1182
277 Ga0495602_0313771 3300048088 Unclassified 1143
278 Ga0495602_1098725 3300048088 Unclassified 521
279 Ga0495614_0257310 3300048089 Unclassified 800
280 Ga0496100_0718610 3300048903 Unclassified 780
281 Ga0496104_1682922 3300048907 Unclassified 537
282 Ga0496115_0144694 3300048918 Unclassified 1962
283 Ga0501068_1093135 3300049584 Unclassified 527
284 nmdc:mga05p37_1205795_c1 3300050507 Unclassified 781
285 nmdc:mga0n895_1336419_c1 3300050512 Unclassified 687
286 Ga0495601_0141389 3300053077 Unclassified 1570
287 Ga0265338_10711606
288 Ga0058863_11667784
289 Ga0058863_11789869
290 Ga0058861_11954858
291 Ga0058862_12217394
292 Ga0058862_12254555
293 Ga0058862_12879301
294 Ga0058862_12890157
295 Ga0070658_10034329
296 Ga0070683_100318123
297 Ga0070683_100760737
298 Ga0070683_101860931
299 Ga0070683_102421080
300 Ga0070666_10018674
301 Ga0070660_100379076
302 Ga0070660_100749720
303 Ga0070691_10461037
304 Ga0070671_100931119
305 Ga0070667_100197934
306 Ga0070709_10116498
307 Ga0070709_10466982
308 Ga0070714_100511303
309 Ga0070713_100437641
310 Ga0070713_101111440
311 Ga0070713_101320347
312 Ga0070710_10206579
313 Ga0070705_100147841
314 Ga0070694_100154994
315 Ga0070708_100779618
316 Ga0070708_101537722
317 Ga0070681_10142005
318 Ga0070681_11547187
319 Ga0068867_100126687
320 Ga0068867_100991595
321 Ga0068867_101210890
322 Ga0070685_11155572
323 Ga0070706_100322226
324 Ga0070707_100898625
325 Ga0070698_100606539
326 Ga0070698_100857886
327 Ga0070699_100212077
328 Ga0070699_100541732
329 Ga0070699_100733213
330 Ga0070697_100073737
331 Ga0070697_100131954
332 Ga0070697_100162204
333 Ga0070665_100229201
334 Ga0070665_101135079
335 Ga0068855_100045619
336 Ga0068855_100735597
337 Ga0068855_100743363
338 Ga0068855_100881625
339 Ga0068856_100093024
340 Ga0068856_101553674
341 Ga0068856_101943957
342 Ga0068852_100504451
343 Ga0068870_10472102
344 Ga0068860_100706444
345 Ga0070717_10300084
346 Ga0070715_10080946
347 Ga0070716_101543008
348 Ga0070712_101494402
349 Ga0070712_101694776
350 Ga0097621_101677423
351 Ga0097621_102179877
352 Ga0068871_100366196
353 Ga0068871_100762538
354 Ga0068871_101350065
355 Ga0068871_101468473
356 Ga0075428_101750117
357 Ga0075434_101688085
358 Ga0075434_101955472
359 Ga0075436_100001482
360 Ga0075436_100003775
361 Ga0075435_101734275
362 Ga0105240_10003031
363 Ga0105240_10459794
364 Ga0105240_10483617
365 Ga0111539_11335829
366 Ga0105245_12632121
367 Ga0105247_10827754
368 Ga0114129_11172161
369 Ga0105241_10300794
370 Ga0105241_10331445
371 Ga0105241_10549792
372 Ga0105242_10408192
373 Ga0105248_11196887
374 Ga0105248_11458553
375 Ga0105248_11561940
376 Ga0105237_10019121
377 Ga0105237_11747635
378 Ga0105237_11751663
379 Ga0105249_13292524
380 Ga0130086_1081529
381 Ga0105239_10222913
382 Ga0157370_10017524
383 Ga0157370_10316072
384 Ga0157369_10717775
385 Ga0157369_12574703
386 Ga0157374_10174206
387 Ga0157374_11198547
388 Ga0157374_11553979
389 Ga0157374_11577208
390 Ga0157378_10237808
391 Ga0157378_11405508
392 Ga0157378_12665403
393 Ga0163162_12134436
394 Ga0163162_12317814
395 Ga0163162_13066093
396 Ga0157372_10011380
397 Ga0157372_11344139
398 Ga0157375_10087439
399 Ga0157375_10882655
400 Ga0163163_10266001
401 Ga0163163_12923699
402 Ga0157380_10932614
403 Ga0157376_10576607
404 Ga0157376_11083360
405 Ga0157376_12868259
406 Ga0163161_10967385
407 Ga0163161_11977980
408 Ga0184594_119056
409 Ga0184594_126562
410 Ga0213875_10262354
411 Ga0207692_10734796
412 Ga0207680_10087294
413 Ga0207699_10125694
414 Ga0207699_10828003
415 Ga0207705_10008918
416 Ga0207654_10721105
417 Ga0207707_10024782
418 Ga0207695_10194306
419 Ga0207695_10345029
420 Ga0207695_11039025
421 Ga0207671_10588365
422 Ga0207693_11127160
423 Ga0207663_11408707
424 Ga0207657_10238169
425 Ga0207652_11190636
426 Ga0207646_10756599
427 Ga0207650_10541262
428 Ga0207650_10571054
429 Ga0207700_10075571
430 Ga0207700_11013336
431 Ga0207700_12032631
432 Ga0207711_10812577
433 Ga0207711_11666428
434 Ga0207711_11943999
435 Ga0207667_10019044
436 Ga0207667_10168862
437 Ga0207667_11134831
438 Ga0207658_10153060
439 Ga0207703_11058771
440 Ga0207702_10500324
441 Ga0207702_11420440
442 Ga0207648_10221131
443 Ga0207648_10635518
444 Ga0207648_11150029
445 Ga0207676_10629021
446 Ga0207683_11438195
447 Ga0207698_11322235
448 Ga0207428_11030563
449 Ga0268266_11516271
450 Ga0268266_11717925
451 Ga0265338_10201110
452 Ga0265338_10267472
453 Ga0265766_1012688
454 Ga0265777_110275
455 Ga0265764_107953
456 Ga0265330_10502133
457 Ga0265331_10395259
458 Ga0265316_10002625
459 Ga0265316_10297350
460 Ga0265316_10392518
461 Ga0265316_10617840
462 Ga0265342_10408011
463 Ga0373954_0151282
464 Ga0373954_0152404
465 Ga0373924_0086046
466 Ga0373935_0291547
467 Ga0373935_1155830
468 Ga0373927_0154857
469 Ga0373927_0237005
470 Ga0373927_0420758
471 Ga0373927_0653739
472 Ga0373927_0924991
473 Ga0373933_0770306
474 Ga0373933_0972753
475 Ga0373947_0084066
476 Ga0373947_0292956
477 Ga0373947_0563521
478 Ga0373947_0804444
479 Ga0373937_0401168
480 Ga0373937_0603466
481 Ga0373925_0075039
482 Ga0373925_0249568
483 Ga0373925_0262867
484 Ga0373925_0396584
485 Ga0436364_1538256
486 Ga0436365_0881855
487 Ga0436360_0825313
488 Ga0451577_1964440
489 Ga0453684_2314133
490 Ga0466957_0553704
491 Ga0451576_0201808
492 Ga0451576_0268554
493 Ga0495592_0002038
494 Ga0495592_0648187
495 Ga0495629_0341591
496 Ga0495651_0009452
497 Ga0495653_0302362
498 Ga0495580_0046066
499 Ga0495580_0062182
500 Ga0495580_0063007
501 Ga0495580_0101065
502 Ga0495580_0171150
503 Ga0495580_0291825
504 Ga0495580_0579185
505 Ga0495580_0733040
506 Ga0495580_0798373
507 Ga0495582_0493102
508 Ga0495662_0013646
509 Ga0495662_0431381
510 Ga0495664_0000568
511 Ga0495594_0283776
512 Ga0495608_0240716
513 Ga0495608_0534835
514 Ga0495618_0076272
515 Ga0495628_0034249
516 Ga0495628_0244962
517 Ga0495630_0136816
518 Ga0495630_0793066
519 Ga0495630_1252441
520 Ga0495666_0494132
521 Ga0495652_0042301
522 Ga0495652_0176056
523 Ga0495652_0193571
524 Ga0495665_0066009
525 Ga0495665_0471067
526 Ga0495586_0826545
527 Ga0495587_0035234
528 Ga0495587_0177121
529 Ga0495587_0298031
530 Ga0495645_0002230
531 Ga0495645_0142274
532 Ga0495645_0194029
533 Ga0495667_0044344
534 Ga0495667_0231467
535 Ga0495634_0032257
536 Ga0495634_0410719
537 Ga0495635_0017012
538 Ga0495635_0095022
539 Ga0495657_0110482
540 Ga0495599_0379201
541 Ga0495623_0046664
542 Ga0495623_0071924
543 Ga0495623_0520901
544 Ga0495623_0737956
545 Ga0495613_0044281
546 Ga0495613_0254740
547 Ga0495613_1080218
548 Ga0495600_0043727
549 Ga0495600_0327064
550 Ga0495581_0625833
551 Ga0495604_0056849
552 Ga0495604_0458104
553 Ga0495674_0014880
554 Ga0495674_0082884
555 Ga0495674_0794240
556 Ga0495680_0015641
557 Ga0495675_0039212
558 Ga0495675_0801918
559 Ga0495684_0003827
560 Ga0495684_0081434
561 Ga0495684_0601067
562 Ga0495602_0297593
563 Ga0495602_0313771
564 Ga0495602_1098725
565 Ga0495614_0257310
566 Ga0496100_0718610
567 Ga0496104_1682922
568 Ga0496115_0144694
569 Ga0501068_1093135
570 nmdc:mga05p37_1205795_c1
571 nmdc:mga0n895_1336419_c1
572 Ga0495601_0141389

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map