F387900

General Info

Members Datasets Scaffolds Average Seq Length
287 194 574 365

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100219150|Ga0068853_1002191502
Length 382
Sequence MPSGSLFHRLRQAPPSTSGRSRHDPLIAVADTVINGLFALSGSLRKPGAPREVDRSFPLVVVDRRVVARDQDVIALTLAAPAGGNLPRWHPGAHIDVHLPSGRVRQYSLCGDPGVPDSYRIAVRRIPGGGGGSIEVHDGLGIGASITTNGPRNAFPLTVPGYGSPTQRLRFIAGGIGITPILPMLALAEQLGAEWSMVYAGRSRDTLPFLDELACFGDRIEIRADDEAGLPTATDLLGDCPDGTTVYACGPAPVLTALRRELAGRSDVELHFERFAAAPVVDGDEFTVTLASTGRSLRVGADETLLAALDREGVHAAYSCRQGFCGTCRTRVLAGDVDHRDTLLTHPERAAGMMLICVSRARHRPSSSAASAARDASLTLDL

Samples

Sample ID Description Type Environment
1 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
118 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
121 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
122 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
123 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
124 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
125 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
126 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
127 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
128 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
131 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
132 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
133 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
134 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
135 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
136 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
137 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
138 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
156 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
157 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
158 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
159 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
162 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
163 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
164 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
176 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
177 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
178 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
182 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
183 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
184 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
185 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
186 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
187 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
188 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
189 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
190 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
191 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
192 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
193 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
194 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.86
Metatranscriptomes 0
Isolates 3.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.68
Nodule 0
Rhizoplane 14.29
Rhizosphere 59.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068853_100219150 3300005539 Bacteria 1737
2 JGI24742J22300_10003584 3300002244 Bacteria 2523
3 Ga0055540_1000024 3300003792 Bacteria 199164
4 Ga0055540_1002042 3300003792 Bacteria 11173
5 Ga0055540_1003526 3300003792 Bacteria 7513
6 Ga0055540_1008139 3300003792 Bacteria 3821
7 Ga0055540_1008453 3300003792 Bacteria 3707
8 Ga0070676_10002844 3300005328 Bacteria 8940
9 Ga0068869_100004458 3300005334 Bacteria 8705
10 Ga0070666_10017430 3300005335 Bacteria 4604
11 Ga0070682_100029613 3300005337 Bacteria 3297
12 Ga0068868_100000955 3300005338 Bacteria 19663
13 Ga0070660_100208271 3300005339 Bacteria 1587
14 Ga0070689_100011000 3300005340 Bacteria 6467
15 Ga0070691_10000393 3300005341 Bacteria 15867
16 Ga0070668_100008649 3300005347 Bacteria 7560
17 Ga0070669_100002395 3300005353 Bacteria 13568
18 Ga0070671_100045650 3300005355 Bacteria 3643
19 Ga0070674_100024168 3300005356 Bacteria 3941
20 Ga0070659_100017684 3300005366 Bacteria 5368
21 Ga0070667_100000139 3300005367 Bacteria 92556
22 Ga0070667_100000768 3300005367 Bacteria 30544
23 Ga0070667_100019646 3300005367 Bacteria 5604
24 Ga0070667_100044552 3300005367 Bacteria 3727
25 Ga0070710_10018731 3300005437 Bacteria 3567
26 Ga0070701_10000508 3300005438 Bacteria 13366
27 Ga0070711_100009767 3300005439 Bacteria 5916
28 Ga0070705_100017615 3300005440 Bacteria 3731
29 Ga0070700_100012539 3300005441 Bacteria 4735
30 Ga0070663_100033026 3300005455 Bacteria 3572
31 Ga0070678_100022625 3300005456 Bacteria 4170
32 Ga0070678_100063602 3300005456 Bacteria 2731
33 Ga0070662_100012274 3300005457 Bacteria 5674
34 Ga0068867_100003925 3300005459 Bacteria 10467
35 Ga0068853_100000658 3300005539 Bacteria 23753
36 Ga0068853_100167545 3300005539 Bacteria 1986
37 Ga0070695_100002476 3300005545 Bacteria 10629
38 Ga0070696_100027445 3300005546 Bacteria 3879
39 Ga0070693_100036507 3300005547 Bacteria 2733
40 Ga0070665_100004431 3300005548 Bacteria 14751
41 Ga0070704_100000300 3300005549 Bacteria 21883
42 Ga0068854_100012044 3300005578 Bacteria 5653
43 Ga0068854_100050399 3300005578 Bacteria 2979
44 Ga0070702_100006302 3300005615 Bacteria 5604
45 Ga0068852_100035687 3300005616 Bacteria 4150
46 Ga0068859_100001829 3300005617 Bacteria 21671
47 Ga0068859_100002436 3300005617 Bacteria 18938
48 Ga0068866_10000247 3300005718 Bacteria 25524
49 Ga0068861_100154526 3300005719 Bacteria 1886
50 Ga0068863_100001629 3300005841 Bacteria 22184
51 Ga0068863_100002906 3300005841 Bacteria 16981
52 Ga0068863_100050060 3300005841 Bacteria 3962
53 Ga0068858_100043070 3300005842 Bacteria 4186
54 Ga0068860_100000025 3300005843 Bacteria 271553
55 Ga0068860_100002200 3300005843 Bacteria 20511
56 Ga0068862_100000045 3300005844 Bacteria 155641
57 Ga0075365_10001410 3300006038 Bacteria 10856
58 Ga0075365_10002424 3300006038 Bacteria 9142
59 Ga0075365_10135423 3300006038 Bacteria 1707
60 Ga0075368_10071005 3300006042 Bacteria 1406
61 Ga0075363_100001097 3300006048 Bacteria 9820
62 Ga0075363_100004514 3300006048 Bacteria 6101
63 Ga0075363_100032285 3300006048 Bacteria 2719
64 Ga0075363_100130631 3300006048 Bacteria 1408
65 Ga0075364_10000837 3300006051 Bacteria 16210
66 Ga0075364_10002423 3300006051 Bacteria 10448
67 Ga0075364_10012842 3300006051 Bacteria 5137
68 Ga0075364_10017264 3300006051 Bacteria 4506
69 Ga0070715_10076821 3300006163 Bacteria 1506
70 Ga0070712_100000143 3300006175 Bacteria 37372
71 Ga0075362_10009988 3300006177 Bacteria 3691
72 Ga0075367_10001670 3300006178 Bacteria 9683
73 Ga0075369_10001804 3300006186 Bacteria 7455
74 Ga0075369_10073882 3300006186 Bacteria 1504
75 Ga0075370_10001389 3300006353 Bacteria 10435
76 Ga0068871_100114836 3300006358 Bacteria 2269
77 Ga0075428_100003580 3300006844 Bacteria 17020
78 Ga0068865_100013317 3300006881 Bacteria 5196
79 Ga0097620_100001829 3300006931 Bacteria 21671
80 Ga0097620_100002436 3300006931 Bacteria 18938
81 Ga0105250_10059368 3300009092 Bacteria 1536
82 Ga0105245_10000924 3300009098 Bacteria 26664
83 Ga0105247_10000010 3300009101 Bacteria 302475
84 Ga0105247_10000675 3300009101 Bacteria 26909
85 Ga0105243_10000904 3300009148 Bacteria 27915
86 Ga0105243_10121385 3300009148 Bacteria 2203
87 Ga0105241_10050418 3300009174 Bacteria 3172
88 Ga0105242_10001843 3300009176 Bacteria 16640
89 Ga0105248_10000100 3300009177 Bacteria 95523
90 Ga0105248_10012814 3300009177 Bacteria 9249
91 Ga0105237_10045844 3300009545 Bacteria 4399
92 Ga0105249_10000010 3300009553 Bacteria 306939
93 Ga0105249_10002197 3300009553 Bacteria 16905
94 Ga0105249_10022826 3300009553 Bacteria 5610
95 Ga0105239_10042277 3300010375 Bacteria 4995
96 Ga0157378_10000796 3300013297 Bacteria 29352
97 Ga0163162_10016641 3300013306 Bacteria 7188
98 Ga0157372_10151855 3300013307 Bacteria 2674
99 Ga0157375_10001355 3300013308 Bacteria 21157
100 Ga0163163_10015508 3300014325 Bacteria 7045
101 Ga0157380_10001464 3300014326 Bacteria 15457
102 Ga0163161_10000661 3300017792 Bacteria 27527
103 Ga0213874_10009698 3300021377 Bacteria 2389
104 Ga0213875_10021840 3300021388 Bacteria 3063
105 Ga0209051_1000021 3300025303 Bacteria 507633
106 Ga0209051_1000872 3300025303 Bacteria 30483
107 Ga0209051_1001901 3300025303 Bacteria 16282
108 Ga0207642_10000942 3300025899 Bacteria 9104
109 Ga0207710_10000028 3300025900 Bacteria 304525
110 Ga0207688_10003033 3300025901 Bacteria 9152
111 Ga0207699_10042225 3300025906 Bacteria 2640
112 Ga0207645_10060809 3300025907 Bacteria 2412
113 Ga0207671_10029701 3300025914 Bacteria 4080
114 Ga0207693_10000790 3300025915 Bacteria 28276
115 Ga0207663_10011620 3300025916 Bacteria 4734
116 Ga0207662_10050596 3300025918 Bacteria 2469
117 Ga0207681_10030776 3300025923 Bacteria 3501
118 Ga0207687_10024913 3300025927 Bacteria 4001
119 Ga0207644_10029629 3300025931 Bacteria 3799
120 Ga0207690_10022783 3300025932 Bacteria 3900
121 Ga0207706_10248519 3300025933 Bacteria 1554
122 Ga0207686_10036477 3300025934 Bacteria 2960
123 Ga0207709_10022192 3300025935 Bacteria 3599
124 Ga0207670_10026139 3300025936 Bacteria 3675
125 Ga0207669_10000203 3300025937 Bacteria 27213
126 Ga0207704_10000241 3300025938 Bacteria 27067
127 Ga0207665_10014613 3300025939 Bacteria 5168
128 Ga0207711_10000081 3300025941 Bacteria 102547
129 Ga0207689_10034427 3300025942 Bacteria 4208
130 Ga0207661_10067809 3300025944 Bacteria 2903
131 Ga0207712_10000016 3300025961 Bacteria 343014
132 Ga0207712_10014301 3300025961 Bacteria 5102
133 Ga0207668_10005335 3300025972 Bacteria 7561
134 Ga0207668_10015684 3300025972 Bacteria 4712
135 Ga0207640_10009222 3300025981 Bacteria 5517
136 Ga0207658_10000675 3300025986 Bacteria 29755
137 Ga0207658_10004478 3300025986 Bacteria 9713
138 Ga0207658_10062185 3300025986 Bacteria 2793
139 Ga0207658_10066746 3300025986 Bacteria 2707
140 Ga0207703_10007979 3300026035 Bacteria 8367
141 Ga0207639_10043806 3300026041 Bacteria 3361
142 Ga0207678_10018153 3300026067 Bacteria 6179
143 Ga0207678_10085323 3300026067 Bacteria 2700
144 Ga0207678_10101704 3300026067 Bacteria 2454
145 Ga0207708_10012809 3300026075 Bacteria 6254
146 Ga0207641_10002247 3300026088 Bacteria 18017
147 Ga0207641_10030267 3300026088 Bacteria 4484
148 Ga0207648_10004625 3300026089 Bacteria 14093
149 Ga0207675_100219706 3300026118 Bacteria 1831
150 Ga0207683_10000819 3300026121 Bacteria 28484
151 Ga0207683_10138654 3300026121 Bacteria 2190
152 Ga0268266_10007333 3300028379 Bacteria 9965
153 Ga0268266_10010148 3300028379 Bacteria 8254
154 Ga0268265_10000056 3300028380 Bacteria 155720
155 Ga0268264_10000053 3300028381 Bacteria 320368
156 Ga0268264_10001190 3300028381 Bacteria 25165
157 Ga0265327_10001903 3300031251 Bacteria 24112
158 Ga0307409_100115163 3300031995 Bacteria 2263
159 Ga0307415_100044189 3300032126 Bacteria 2977
160 Ga0373945_0072164 3300035116 Bacteria 1309
161 Ga0316584_0134993 3300036712 Bacteria 1842
162 Ga0436364_0906046 3300037853 Bacteria 5522
163 Ga0436363_1133793 3300039450 Bacteria 5879
164 Ga0436363_1456026 3300039450 Bacteria 2380
165 Ga0439461_0007699 3300041410 Bacteria 1916
166 Ga0439466_0051532 3300041411 Bacteria 1347
167 Ga0439465_0002583 3300041413 Bacteria 5899
168 Ga0439434_0002573 3300042435 Bacteria 5279
169 Ga0466972_0039219 3300044658 Bacteria 2312
170 Ga0466972_0043973 3300044658 Bacteria 2168
171 Ga0466965_0005470 3300044683 Bacteria 5728
172 Ga0466966_0098319 3300044684 Bacteria 1812
173 Ga0466960_0000012 3300044901 Bacteria 60091
174 Ga0466967_0112372 3300045976 Bacteria 2505
175 Ga0466967_0195948 3300045976 Bacteria 1911
176 Ga0495603_0024052 3300046455 Bacteria 3685
177 Ga0495638_0002836 3300046460 Bacteria 13890
178 Ga0495638_0004222 3300046460 Bacteria 10936
179 Ga0495641_0050726 3300046461 Bacteria 1896
180 Ga0495606_0048456 3300046507 Bacteria 2795
181 Ga0495635_0202445 3300046663 Bacteria 1346
182 Ga0495658_0009159 3300046683 Bacteria 4922
183 Ga0495676_0114585 3300047321 Bacteria 1972
184 Ga0495686_0006416 3300047472 Bacteria 9008
185 Ga0495686_0049117 3300047472 Bacteria 2656
186 Ga0495593_0015596 3300047673 Bacteria 4300
187 Ga0496100_0000080 3300048903 Bacteria 54146
188 Ga0496100_0001628 3300048903 Bacteria 11112
189 Ga0496100_0005174 3300048903 Bacteria 6996
190 Ga0496100_0126156 3300048903 Bacteria 1796
191 Ga0496101_0000688 3300048904 Bacteria 20371
192 Ga0496101_0001310 3300048904 Bacteria 14877
193 Ga0496101_0028255 3300048904 Bacteria 3914
194 Ga0496101_0029539 3300048904 Bacteria 3834
195 Ga0496102_0000480 3300048905 Bacteria 44338
196 Ga0496102_0001549 3300048905 Bacteria 20302
197 Ga0496102_0042599 3300048905 Bacteria 4114
198 Ga0496102_0177386 3300048905 Bacteria 2007
199 Ga0496103_0000969 3300048906 Bacteria 20338
200 Ga0496103_0001390 3300048906 Bacteria 16298
201 Ga0496103_0004412 3300048906 Bacteria 8535
202 Ga0496103_0074347 3300048906 Bacteria 2130
203 Ga0496104_0031934 3300048907 Bacteria 4899
204 Ga0496105_0008030 3300048908 Bacteria 8199
205 Ga0496105_0153543 3300048908 Bacteria 1892
206 Ga0496106_0002796 3300048909 Bacteria 12936
207 Ga0496106_0003331 3300048909 Bacteria 11974
208 Ga0496106_0121881 3300048909 Bacteria 2039
209 Ga0496107_0001431 3300048910 Bacteria 14748
210 Ga0496107_0001648 3300048910 Bacteria 13944
211 Ga0496107_0007976 3300048910 Bacteria 7310
212 Ga0496108_0007287 3300048911 Bacteria 8968
213 Ga0496108_0021871 3300048911 Bacteria 5258
214 Ga0496109_0000745 3300048912 Bacteria 27076
215 Ga0496109_0007047 3300048912 Bacteria 9485
216 Ga0496109_0199173 3300048912 Bacteria 1882
217 Ga0496109_0446735 3300048912 Bacteria 1221
218 Ga0496110_0003017 3300048913 Bacteria 12774
219 Ga0496110_0017855 3300048913 Bacteria 5939
220 Ga0496111_0014384 3300048914 Bacteria 5404
221 Ga0496112_0467790 3300048915 Bacteria 1198
222 Ga0496113_0020940 3300048916 Bacteria 4607
223 Ga0496114_0001553 3300048917 Bacteria 17416
224 Ga0496114_0003555 3300048917 Bacteria 11967
225 Ga0496114_0011798 3300048917 Bacteria 6991
226 Ga0496115_0002979 3300048918 Bacteria 12168
227 Ga0496115_0010273 3300048918 Bacteria 6988
228 Ga0496116_0023013 3300048919 Bacteria 4650
229 Ga0496116_0024457 3300048919 Bacteria 4467
230 Ga0496117_0001513 3300048920 Bacteria 33283
231 Ga0496118_0001679 3300048921 Bacteria 32406
232 Ga0496118_0028071 3300048921 Bacteria 4748
233 Ga0496119_0004251 3300048922 Bacteria 14357
234 Ga0496119_0005683 3300048922 Bacteria 11830
235 Ga0496120_0004525 3300048923 Bacteria 11620
236 Ga0496120_0039191 3300048923 Bacteria 2798
237 Ga0496121_0000014 3300048924 Bacteria 609379
238 Ga0496121_0035397 3300048924 Bacteria 4477
239 Ga0496122_0000097 3300048925 Bacteria 199223
240 Ga0496123_0009184 3300048926 Bacteria 8936
241 Ga0496124_0000019 3300048927 Bacteria 436995
242 Ga0496124_0048565 3300048927 Bacteria 3625
243 Ga0496125_0000014 3300048928 Bacteria 610124
244 Ga0496126_0000017 3300048929 Bacteria 610676
245 Ga0496126_0018263 3300048929 Bacteria 6956
246 Ga0501032_0053948 3300049569 Bacteria 2706
247 Ga0501034_0002566 3300049571 Bacteria 21627
248 Ga0501034_0122155 3300049571 Bacteria 2590
249 Ga0501036_0021167 3300049572 Bacteria 5463
250 Ga0501037_0002048 3300049573 Bacteria 14614
251 Ga0501038_0015658 3300049574 Bacteria 6893
252 Ga0501039_0002873 3300049575 Bacteria 12887
253 Ga0501043_0086419 3300049579 Bacteria 2464
254 Ga0501070_0000247 3300049586 Bacteria 50837
255 Ga0501070_0031922 3300049586 Bacteria 4411
256 Ga0501044_0018459 3300049823 Bacteria 7473
257 nmdc:mga03n38_1776_c1 3300050490 Bacteria 6395
258 nmdc:mga03n38_34617_c1 3300050490 Bacteria 2158
259 nmdc:mga00v17_73200_c1 3300050491 Bacteria 2127
260 nmdc:mga00v17_7961_c1 3300050491 Bacteria 5681
261 nmdc:mga00v17_99323_c1 3300050491 Bacteria 1836
262 nmdc:mga0yw44_132423_c1 3300050492 Bacteria 1615
263 nmdc:mga0yw44_252514_c1 3300050492 Bacteria 1174
264 nmdc:mga0yw44_7557_c1 3300050492 Bacteria 5354
265 nmdc:mga07m45_188062_c1 3300050496 Bacteria 1200
266 nmdc:mga07m45_94558_c1 3300050496 Bacteria 1714
267 nmdc:mga05p37_66706_c1 3300050507 Bacteria 4426
268 nmdc:mga06r32_233045_c1 3300050510 Bacteria 1829
269 nmdc:mga0sz30_11276_c1 3300050516 Bacteria 2285
270 nmdc:mga0sz30_18483_c1 3300050516 Bacteria 2790
271 nmdc:mga0sz30_50198_c1 3300050516 Bacteria 1768
272 nmdc:mga0sz30_75627_c1 3300050516 Bacteria 1453
273 nmdc:mga0sz30_8152_c1 3300050516 Bacteria 3948
274 nmdc:mga0sz30_9768_c1 3300050516 Bacteria 3658
275 Ga0500635_0003381 3300053080 Bacteria 4008
276 Ga0500578_0195525 3300053086 Bacteria 1240
277 Ga0500652_000344 3300053131 Bacteria 16730
278 Ga0500645_000006 3300053730 Bacteria 276677
279 2644485386 2643221687 Bacteria 6500351
280 2738667640 2738541264 Bacteria 5935393
281 2738704228 2738541274 Bacteria 6909446
282 2739146710 2738541356 Bacteria 5935017
283 2739331288 2738543028 Bacteria 6917070
284 2739365760 2738543034 Bacteria 6084756
285 2902804547 2902799365 Bacteria 5419524
286 2902838098 2902837492 Bacteria 6697721
287 2939585394 2939582691 Bacteria 7088898
288 Ga0068853_100219150
289 JGI24742J22300_10003584
290 Ga0055540_1000024
291 Ga0055540_1002042
292 Ga0055540_1003526
293 Ga0055540_1008139
294 Ga0055540_1008453
295 Ga0070676_10002844
296 Ga0068869_100004458
297 Ga0070666_10017430
298 Ga0070682_100029613
299 Ga0068868_100000955
300 Ga0070660_100208271
301 Ga0070689_100011000
302 Ga0070691_10000393
303 Ga0070668_100008649
304 Ga0070669_100002395
305 Ga0070671_100045650
306 Ga0070674_100024168
307 Ga0070659_100017684
308 Ga0070667_100000139
309 Ga0070667_100000768
310 Ga0070667_100019646
311 Ga0070667_100044552
312 Ga0070710_10018731
313 Ga0070701_10000508
314 Ga0070711_100009767
315 Ga0070705_100017615
316 Ga0070700_100012539
317 Ga0070663_100033026
318 Ga0070678_100022625
319 Ga0070678_100063602
320 Ga0070662_100012274
321 Ga0068867_100003925
322 Ga0068853_100000658
323 Ga0068853_100167545
324 Ga0070695_100002476
325 Ga0070696_100027445
326 Ga0070693_100036507
327 Ga0070665_100004431
328 Ga0070704_100000300
329 Ga0068854_100012044
330 Ga0068854_100050399
331 Ga0070702_100006302
332 Ga0068852_100035687
333 Ga0068859_100001829
334 Ga0068859_100002436
335 Ga0068866_10000247
336 Ga0068861_100154526
337 Ga0068863_100001629
338 Ga0068863_100002906
339 Ga0068863_100050060
340 Ga0068858_100043070
341 Ga0068860_100000025
342 Ga0068860_100002200
343 Ga0068862_100000045
344 Ga0075365_10001410
345 Ga0075365_10002424
346 Ga0075365_10135423
347 Ga0075368_10071005
348 Ga0075363_100001097
349 Ga0075363_100004514
350 Ga0075363_100032285
351 Ga0075363_100130631
352 Ga0075364_10000837
353 Ga0075364_10002423
354 Ga0075364_10012842
355 Ga0075364_10017264
356 Ga0070715_10076821
357 Ga0070712_100000143
358 Ga0075362_10009988
359 Ga0075367_10001670
360 Ga0075369_10001804
361 Ga0075369_10073882
362 Ga0075370_10001389
363 Ga0068871_100114836
364 Ga0075428_100003580
365 Ga0068865_100013317
366 Ga0097620_100001829
367 Ga0097620_100002436
368 Ga0105250_10059368
369 Ga0105245_10000924
370 Ga0105247_10000010
371 Ga0105247_10000675
372 Ga0105243_10000904
373 Ga0105243_10121385
374 Ga0105241_10050418
375 Ga0105242_10001843
376 Ga0105248_10000100
377 Ga0105248_10012814
378 Ga0105237_10045844
379 Ga0105249_10000010
380 Ga0105249_10002197
381 Ga0105249_10022826
382 Ga0105239_10042277
383 Ga0157378_10000796
384 Ga0163162_10016641
385 Ga0157372_10151855
386 Ga0157375_10001355
387 Ga0163163_10015508
388 Ga0157380_10001464
389 Ga0163161_10000661
390 Ga0213874_10009698
391 Ga0213875_10021840
392 Ga0209051_1000021
393 Ga0209051_1000872
394 Ga0209051_1001901
395 Ga0207642_10000942
396 Ga0207710_10000028
397 Ga0207688_10003033
398 Ga0207699_10042225
399 Ga0207645_10060809
400 Ga0207671_10029701
401 Ga0207693_10000790
402 Ga0207663_10011620
403 Ga0207662_10050596
404 Ga0207681_10030776
405 Ga0207687_10024913
406 Ga0207644_10029629
407 Ga0207690_10022783
408 Ga0207706_10248519
409 Ga0207686_10036477
410 Ga0207709_10022192
411 Ga0207670_10026139
412 Ga0207669_10000203
413 Ga0207704_10000241
414 Ga0207665_10014613
415 Ga0207711_10000081
416 Ga0207689_10034427
417 Ga0207661_10067809
418 Ga0207712_10000016
419 Ga0207712_10014301
420 Ga0207668_10005335
421 Ga0207668_10015684
422 Ga0207640_10009222
423 Ga0207658_10000675
424 Ga0207658_10004478
425 Ga0207658_10062185
426 Ga0207658_10066746
427 Ga0207703_10007979
428 Ga0207639_10043806
429 Ga0207678_10018153
430 Ga0207678_10085323
431 Ga0207678_10101704
432 Ga0207708_10012809
433 Ga0207641_10002247
434 Ga0207641_10030267
435 Ga0207648_10004625
436 Ga0207675_100219706
437 Ga0207683_10000819
438 Ga0207683_10138654
439 Ga0268266_10007333
440 Ga0268266_10010148
441 Ga0268265_10000056
442 Ga0268264_10000053
443 Ga0268264_10001190
444 Ga0265327_10001903
445 Ga0307409_100115163
446 Ga0307415_100044189
447 Ga0373945_0072164
448 Ga0316584_0134993
449 Ga0436364_0906046
450 Ga0436363_1133793
451 Ga0436363_1456026
452 Ga0439461_0007699
453 Ga0439466_0051532
454 Ga0439465_0002583
455 Ga0439434_0002573
456 Ga0466972_0039219
457 Ga0466972_0043973
458 Ga0466965_0005470
459 Ga0466966_0098319
460 Ga0466960_0000012
461 Ga0466967_0112372
462 Ga0466967_0195948
463 Ga0495603_0024052
464 Ga0495638_0002836
465 Ga0495638_0004222
466 Ga0495641_0050726
467 Ga0495606_0048456
468 Ga0495635_0202445
469 Ga0495658_0009159
470 Ga0495676_0114585
471 Ga0495686_0006416
472 Ga0495686_0049117
473 Ga0495593_0015596
474 Ga0496100_0000080
475 Ga0496100_0001628
476 Ga0496100_0005174
477 Ga0496100_0126156
478 Ga0496101_0000688
479 Ga0496101_0001310
480 Ga0496101_0028255
481 Ga0496101_0029539
482 Ga0496102_0000480
483 Ga0496102_0001549
484 Ga0496102_0042599
485 Ga0496102_0177386
486 Ga0496103_0000969
487 Ga0496103_0001390
488 Ga0496103_0004412
489 Ga0496103_0074347
490 Ga0496104_0031934
491 Ga0496105_0008030
492 Ga0496105_0153543
493 Ga0496106_0002796
494 Ga0496106_0003331
495 Ga0496106_0121881
496 Ga0496107_0001431
497 Ga0496107_0001648
498 Ga0496107_0007976
499 Ga0496108_0007287
500 Ga0496108_0021871
501 Ga0496109_0000745
502 Ga0496109_0007047
503 Ga0496109_0199173
504 Ga0496109_0446735
505 Ga0496110_0003017
506 Ga0496110_0017855
507 Ga0496111_0014384
508 Ga0496112_0467790
509 Ga0496113_0020940
510 Ga0496114_0001553
511 Ga0496114_0003555
512 Ga0496114_0011798
513 Ga0496115_0002979
514 Ga0496115_0010273
515 Ga0496116_0023013
516 Ga0496116_0024457
517 Ga0496117_0001513
518 Ga0496118_0001679
519 Ga0496118_0028071
520 Ga0496119_0004251
521 Ga0496119_0005683
522 Ga0496120_0004525
523 Ga0496120_0039191
524 Ga0496121_0000014
525 Ga0496121_0035397
526 Ga0496122_0000097
527 Ga0496123_0009184
528 Ga0496124_0000019
529 Ga0496124_0048565
530 Ga0496125_0000014
531 Ga0496126_0000017
532 Ga0496126_0018263
533 Ga0501032_0053948
534 Ga0501034_0002566
535 Ga0501034_0122155
536 Ga0501036_0021167
537 Ga0501037_0002048
538 Ga0501038_0015658
539 Ga0501039_0002873
540 Ga0501043_0086419
541 Ga0501070_0000247
542 Ga0501070_0031922
543 Ga0501044_0018459
544 nmdc:mga03n38_1776_c1
545 nmdc:mga03n38_34617_c1
546 nmdc:mga00v17_73200_c1
547 nmdc:mga00v17_7961_c1
548 nmdc:mga00v17_99323_c1
549 nmdc:mga0yw44_132423_c1
550 nmdc:mga0yw44_252514_c1
551 nmdc:mga0yw44_7557_c1
552 nmdc:mga07m45_188062_c1
553 nmdc:mga07m45_94558_c1
554 nmdc:mga05p37_66706_c1
555 nmdc:mga06r32_233045_c1
556 nmdc:mga0sz30_11276_c1
557 nmdc:mga0sz30_18483_c1
558 nmdc:mga0sz30_50198_c1
559 nmdc:mga0sz30_75627_c1
560 nmdc:mga0sz30_8152_c1
561 nmdc:mga0sz30_9768_c1
562 Ga0500635_0003381
563 Ga0500578_0195525
564 Ga0500652_000344
565 Ga0500645_000006
566 2644485386
567 2738667640
568 2738704228
569 2739146710
570 2739331288
571 2739365760
572 2902804547
573 2902838098
574 2939585394

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

288

362

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g1b-assembly1.cif.gz_A x-ray structure of yeast flavohemoglobin in complex with econazole 0.824 53 265
6o0a-assembly1.cif.gz_A crystal structure of flavohemoglobin from malassezia yamatoensis with bound fad and heme determined by iron sad phasing 0.8159 53 265
7qu0-assembly1.cif.gz_A x-ray structure of fad domain of nqrf of klebsiella pneumoniae 0.8072 52 262
7ylr-assembly1.cif.gz_A structure of a bacteria protein 0.806 51 365
2r6h-assembly4.cif.gz_D crystal structure of the domain comprising the nad binding and the fad binding regions of the nadh:ubiquinone oxidoreductase, na translocating, f subunit from porphyromonas gingivalis 0.7998 52 264
ID Description Score Start End Superfamily
af_O86347_101_218_3.40.50.80 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.9396 148 267 3.40.50.80
af_O86347_101_218_3.40.50.80 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.9319 148 267 3.40.50.80
af_O86347_1_100_2.40.30.10 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9209 50 147 2.40.30.10
2piaA01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9138 51 146 2.40.30.10
af_P76254_2_105_2.40.30.10 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.906 52 146 2.40.30.10
ID Description Score Start End GO Terms
AF-A0A022MMI6-F1-model_v4 FAD-binding FR-type domain-containing protein 0.9384 54 152 GO:0016491
GO:0051537
AF-D4TBS1-F1-model_v4 deleted 0.9226 52 202
AF-A0A1Q3XJ33-F1-model_v4 deleted 0.9225 49 269
AF-A0A7U2MNI3-F1-model_v4 Oxidoreductase FAD/NAD(P)-binding domain-containing protein 0.9201 123 267 GO:0016491
GO:0051537
AF-A0A519IR40-F1-model_v4 deleted 0.9193 50 206

Map