F387882

General Info

Members Datasets Scaffolds Average Seq Length
287 164 574 228

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100117415|Ga0070708_1001174153
Length 253
Sequence VEQLLVALDVDSIGEARSLVDRLRGAVGGFKIGSRLFTREGPALVEELASRGDRVFLDLKFHDIPNTVAGAVAAATRLGVWMLNVHASGGSTMMRAAHDAAADEAAKRSRPRPLVIAVTMLTSLSQETLGEIGVCDPMPSQVGRLAALTQTAGLDGVVASPQEIDLIRRRCGRQFAIVTPGIRAAADVKGDQSRTMAAAEALAAGATYLVVGRPIITANDPRAAADRIAAECRTVMGSDPSRAGRHVRGVRWG

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
111 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
112 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
113 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
114 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
115 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
116 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
119 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
120 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
121 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
122 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
131 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
145 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
146 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
159 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
160 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
161 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
162 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
163 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.97
Rhizosphere 92.68
Stem 0
Stem Tuber 0
Unclassified 1.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100117415 3300005445 Bacteria 2450
2 MBSR1b_contig_1163342 2162886012 Bacteria 1127
3 MBSR1b_contig_3648798 2162886012 Bacteria 2087
4 Ga0065712_10000399 3300005290 Bacteria 11739
5 Ga0065715_10132268 3300005293 Bacteria 1993
6 Ga0070676_10063106 3300005328 Bacteria 2206
7 Ga0070690_100001774 3300005330 Bacteria 11404
8 Ga0070670_100036541 3300005331 Bacteria 4227
9 Ga0070670_100180081 3300005331 Bacteria 1835
10 Ga0070680_100175402 3300005336 Bacteria 1805
11 Ga0068868_100035256 3300005338 Bacteria 3867
12 Ga0068868_100051191 3300005338 Bacteria 3247
13 Ga0070689_100147453 3300005340 Bacteria 1896
14 Ga0070689_100499388 3300005340 Bacteria 1042
15 Ga0070689_100510786 3300005340 Bacteria 1031
16 Ga0070687_100132204 3300005343 Bacteria 1442
17 Ga0070668_100048164 3300005347 Bacteria 3278
18 Ga0070668_100552175 3300005347 Bacteria 1003
19 Ga0070669_100132574 3300005353 Bacteria 1913
20 Ga0070675_100115425 3300005354 Bacteria 2276
21 Ga0070675_100154902 3300005354 Bacteria 1967
22 Ga0070671_100013365 3300005355 Bacteria 6618
23 Ga0070674_100002917 3300005356 Bacteria 9475
24 Ga0070674_100106145 3300005356 Bacteria 2055
25 Ga0070673_100061598 3300005364 Bacteria 2977
26 Ga0070673_100170245 3300005364 Bacteria 1859
27 Ga0070673_100455137 3300005364 Bacteria 1152
28 Ga0070688_100002708 3300005365 Bacteria 8990
29 Ga0070688_100097828 3300005365 Bacteria 1930
30 Ga0070688_100102157 3300005365 Bacteria 1892
31 Ga0070688_100325651 3300005365 Bacteria 1118
32 Ga0070659_100389694 3300005366 Bacteria 1175
33 Ga0070667_100668190 3300005367 Bacteria 960
34 Ga0070701_10239172 3300005438 Bacteria 1091
35 Ga0070705_100067001 3300005440 Bacteria 2155
36 Ga0070694_100053702 3300005444 Bacteria 2727
37 Ga0070694_100458524 3300005444 Bacteria 1008
38 Ga0070678_100068383 3300005456 Bacteria 2648
39 Ga0070681_10431868 3300005458 Bacteria 1229
40 Ga0068867_100130941 3300005459 Bacteria 1949
41 Ga0068867_100294207 3300005459 Bacteria 1336
42 Ga0068867_100459100 3300005459 Bacteria 1087
43 Ga0070685_10185516 3300005466 Bacteria 1342
44 Ga0070685_10512980 3300005466 Bacteria 850
45 Ga0070699_100002875 3300005518 Bacteria 15347
46 Ga0070684_100736993 3300005535 Bacteria 920
47 Ga0070697_100033663 3300005536 Bacteria 4128
48 Ga0070686_100002412 3300005544 Bacteria 10296
49 Ga0070696_100007930 3300005546 Bacteria 7088
50 Ga0070665_100023606 3300005548 Bacteria 6193
51 Ga0070704_100118550 3300005549 Bacteria 2028
52 Ga0070704_100523763 3300005549 Bacteria 1032
53 Ga0068854_100113832 3300005578 Bacteria 2044
54 Ga0068854_100192640 3300005578 Bacteria 1598
55 Ga0070702_100161640 3300005615 Bacteria 1448
56 Ga0068864_100002718 3300005618 Bacteria 14568
57 Ga0068864_100358308 3300005618 Bacteria 1378
58 Ga0068866_10030229 3300005718 Bacteria 2598
59 Ga0068866_10171771 3300005718 Bacteria 1273
60 Ga0068861_100025712 3300005719 Bacteria 4273
61 Ga0068861_100196027 3300005719 Bacteria 1692
62 Ga0068861_100244033 3300005719 Bacteria 1529
63 Ga0068863_100023402 3300005841 Bacteria 5901
64 Ga0068863_100324482 3300005841 Bacteria 1496
65 Ga0068863_100422711 3300005841 Bacteria 1306
66 Ga0068858_100066132 3300005842 Bacteria 3346
67 Ga0068858_100720576 3300005842 Bacteria 971
68 Ga0068860_100175455 3300005843 Bacteria 2071
69 Ga0068860_100213515 3300005843 Bacteria 1872
70 Ga0068860_100392192 3300005843 Bacteria 1372
71 Ga0068860_101179325 3300005843 Bacteria 786
72 Ga0068862_100051696 3300005844 Bacteria 3515
73 Ga0068862_100313386 3300005844 Bacteria 1446
74 Ga0068862_100461252 3300005844 Bacteria 1199
75 Ga0070716_100200077 3300006173 Bacteria 1327
76 Ga0097621_100000491 3300006237 Bacteria 27694
77 Ga0068871_100077855 3300006358 Bacteria 2741
78 Ga0068871_100217558 3300006358 Bacteria 1654
79 Ga0075430_100276642 3300006846 Bacteria 1389
80 Ga0075431_100052017 3300006847 Bacteria 4224
81 Ga0075431_100107986 3300006847 Bacteria 2872
82 Ga0075431_100147379 3300006847 Bacteria 2425
83 Ga0075431_100186947 3300006847 Bacteria 2124
84 Ga0075431_100221375 3300006847 Bacteria 1931
85 Ga0075431_100485886 3300006847 Bacteria 1227
86 Ga0075433_10052737 3300006852 Bacteria 3544
87 Ga0075429_100181465 3300006880 Bacteria 1844
88 Ga0075429_100188403 3300006880 Bacteria 1808
89 Ga0075429_100448041 3300006880 Bacteria 1131
90 Ga0075429_100511053 3300006880 Bacteria 1053
91 Ga0068865_100063164 3300006881 Bacteria 2602
92 Ga0068865_100286506 3300006881 Bacteria 1313
93 Ga0075436_100016643 3300006914 Bacteria 5033
94 Ga0075436_100230689 3300006914 Bacteria 1315
95 Ga0075435_100015709 3300007076 Bacteria 5696
96 Ga0105240_10010582 3300009093 Bacteria 12960
97 Ga0105240_10132503 3300009093 Bacteria 2988
98 Ga0111539_10605322 3300009094 Bacteria 1276
99 Ga0114129_10000690 3300009147 Bacteria 42700
100 Ga0114129_10022608 3300009147 Bacteria 8919
101 Ga0114129_10102460 3300009147 Bacteria 3959
102 Ga0114129_10186213 3300009147 Bacteria 2821
103 Ga0114129_10490543 3300009147 Unclassified 1606
104 Ga0105243_10019410 3300009148 Bacteria 5154
105 Ga0105242_10021925 3300009176 Bacteria 5019
106 Ga0105248_10024459 3300009177 Bacteria 6715
107 Ga0105248_10038687 3300009177 Bacteria 5339
108 Ga0105248_10091836 3300009177 Bacteria 3419
109 Ga0105248_10278956 3300009177 Bacteria 1881
110 Ga0105249_10096215 3300009553 Bacteria 2777
111 Ga0105249_10187165 3300009553 Bacteria 2018
112 Ga0105246_10167242 3300011119 Bacteria 1681
113 Ga0157374_10098524 3300013296 Bacteria 2799
114 Ga0163162_10068502 3300013306 Bacteria 3600
115 Ga0163162_10093515 3300013306 Bacteria 3091
116 Ga0157375_10260187 3300013308 Bacteria 1897
117 Ga0157375_10372262 3300013308 Bacteria 1595
118 Ga0163163_10013754 3300014325 Bacteria 7417
119 Ga0163163_10096571 3300014325 Bacteria 2976
120 Ga0163163_10370470 3300014325 Bacteria 1489
121 Ga0157380_10024633 3300014326 Bacteria 4557
122 Ga0157380_10235045 3300014326 Bacteria 1649
123 Ga0157380_10935160 3300014326 Bacteria 896
124 Ga0157377_10124025 3300014745 Bacteria 1569
125 Ga0157377_10249125 3300014745 Bacteria 1150
126 Ga0157376_10088840 3300014969 Bacteria 2671
127 Ga0157376_10256611 3300014969 Bacteria 1636
128 Ga0163161_10394898 3300017792 Bacteria 1108
129 Ga0213876_10225762 3300021384 Bacteria 996
130 Ga0207697_10012725 3300025315 Bacteria 3523
131 Ga0207642_10280168 3300025899 Bacteria 959
132 Ga0207645_10228643 3300025907 Bacteria 1227
133 Ga0207645_10415391 3300025907 Bacteria 906
134 Ga0207684_10324023 3300025910 Bacteria 1328
135 Ga0207662_10090842 3300025918 Bacteria 1878
136 Ga0207650_10011773 3300025925 Bacteria 6032
137 Ga0207650_10489008 3300025925 Bacteria 1027
138 Ga0207659_10097760 3300025926 Bacteria 2206
139 Ga0207659_10156984 3300025926 Bacteria 1782
140 Ga0207687_10545266 3300025927 Bacteria 972
141 Ga0207706_10015058 3300025933 Bacteria 7001
142 Ga0207686_10157846 3300025934 Bacteria 1587
143 Ga0207686_10260854 3300025934 Bacteria 1270
144 Ga0207709_10098186 3300025935 Bacteria 1931
145 Ga0207670_10204780 3300025936 Bacteria 1501
146 Ga0207669_10010194 3300025937 Bacteria 4515
147 Ga0207669_10027315 3300025937 Bacteria 3122
148 Ga0207669_10029466 3300025937 Bacteria 3036
149 Ga0207704_10093843 3300025938 Bacteria 1980
150 Ga0207704_10171177 3300025938 Bacteria 1558
151 Ga0207704_10431011 3300025938 Bacteria 1048
152 Ga0207691_10018577 3300025940 Bacteria 6589
153 Ga0207711_10036499 3300025941 Bacteria 4171
154 Ga0207711_10040920 3300025941 Bacteria 3944
155 Ga0207689_10061159 3300025942 Bacteria 3096
156 Ga0207667_10349070 3300025949 Bacteria 1509
157 Ga0207651_10060700 3300025960 Bacteria 2626
158 Ga0207712_10189985 3300025961 Bacteria 1620
159 Ga0207712_10336173 3300025961 Bacteria 1251
160 Ga0207712_10381618 3300025961 Bacteria 1180
161 Ga0207668_10308713 3300025972 Bacteria 1308
162 Ga0207668_10617125 3300025972 Bacteria 946
163 Ga0207640_10242855 3300025981 Bacteria 1393
164 Ga0207658_10631562 3300025986 Bacteria 964
165 Ga0207677_10471121 3300026023 Bacteria 1080
166 Ga0207703_10407368 3300026035 Bacteria 1263
167 Ga0207678_10035993 3300026067 Bacteria 4309
168 Ga0207702_10030335 3300026078 Bacteria 4506
169 Ga0207641_10065171 3300026088 Bacteria 3116
170 Ga0207641_10316725 3300026088 Bacteria 1478
171 Ga0207641_10612971 3300026088 Bacteria 1066
172 Ga0207648_10031050 3300026089 Bacteria 4726
173 Ga0207648_10121387 3300026089 Bacteria 2298
174 Ga0207648_10245667 3300026089 Bacteria 1595
175 Ga0207676_10022043 3300026095 Bacteria 4681
176 Ga0207676_11018000 3300026095 Bacteria 817
177 Ga0207674_10836112 3300026116 Bacteria 888
178 Ga0207675_100048123 3300026118 Bacteria 3980
179 Ga0207675_100125484 3300026118 Bacteria 2431
180 Ga0207675_100680282 3300026118 Bacteria 1037
181 Ga0268265_10406419 3300028380 Bacteria 1260
182 Ga0268265_10526109 3300028380 Bacteria 1118
183 Ga0268264_10853910 3300028381 Bacteria 912
184 Ga0307412_10304679 3300031911 Bacteria 1261
185 Ga0307416_100005578 3300032002 Bacteria 7752
186 Ga0307416_100098532 3300032002 Bacteria 2536
187 Ga0307415_100118008 3300032126 Bacteria 1983
188 Ga0395900_0522978 3300037418 Bacteria 1134
189 Ga0395898_0721170 3300037466 Bacteria 939
190 Ga0439464_0054692 3300042439 Bacteria 1160
191 Ga0451576_0097311 3300045051 Bacteria 3061
192 Ga0466967_0813269 3300045976 Bacteria 928
193 Ga0495618_0202626 3300046514 Bacteria 1256
194 Ga0495640_0046999 3300046533 Bacteria 2988
195 Ga0495586_0161768 3300046535 Bacteria 1263
196 Ga0495645_0125013 3300046543 Bacteria 1807
197 Ga0495667_0210445 3300046559 Bacteria 1243
198 Ga0495611_0156398 3300046648 Bacteria 1064
199 Ga0495599_0029955 3300046678 Bacteria 3414
200 Ga0495680_0321573 3300047322 Bacteria 1083
201 Ga0495684_0096983 3300047471 Bacteria 2231
202 Ga0496101_0001528 3300048904 Bacteria 13862
203 Ga0496101_0462335 3300048904 Bacteria 1001
204 Ga0496102_0026333 3300048905 Bacteria 5186
205 Ga0496102_0284767 3300048905 Bacteria 1558
206 Ga0496102_0426294 3300048905 Bacteria 1246
207 Ga0496104_0101987 3300048907 Bacteria 2748
208 Ga0496104_0730911 3300048907 Bacteria 897
209 Ga0496105_0032187 3300048908 Bacteria 4303
210 Ga0496106_0072661 3300048909 Bacteria 2631
211 Ga0496108_0014715 3300048911 Bacteria 6385
212 Ga0496109_0003744 3300048912 Bacteria 12710
213 Ga0496110_0001714 3300048913 Bacteria 16145
214 Ga0496112_0003060 3300048915 Bacteria 13696
215 Ga0496112_0046821 3300048915 Bacteria 4243
216 Ga0496112_0471948 3300048915 Bacteria 1192
217 Ga0496112_0477275 3300048915 Bacteria 1184
218 Ga0496113_0032480 3300048916 Bacteria 3794
219 Ga0496113_0096068 3300048916 Bacteria 2291
220 Ga0496114_0000958 3300048917 Bacteria 21594
221 Ga0496114_0199123 3300048917 Bacteria 1754
222 Ga0501031_0204597 3300049568 Bacteria 1287
223 Ga0501032_0001132 3300049569 Bacteria 21336
224 Ga0501034_0004803 3300049571 Bacteria 14940
225 Ga0501034_0005502 3300049571 Bacteria 13822
226 Ga0501034_0418929 3300049571 Bacteria 1260
227 Ga0501034_0483447 3300049571 Bacteria 1153
228 Ga0501036_0001495 3300049572 Bacteria 18017
229 Ga0501037_0032482 3300049573 Bacteria 3854
230 Ga0501038_0023244 3300049574 Bacteria 5545
231 Ga0501038_0060471 3300049574 Bacteria 3242
232 Ga0501039_0014717 3300049575 Bacteria 5984
233 Ga0501039_0206466 3300049575 Bacteria 1544
234 Ga0501043_0001097 3300049579 Bacteria 23794
235 Ga0501043_0005731 3300049579 Bacteria 10006
236 Ga0501043_0043588 3300049579 Bacteria 3526
237 Ga0501046_0018474 3300049580 Bacteria 5800
238 Ga0501047_0000303 3300049581 Bacteria 56793
239 Ga0501047_0005641 3300049581 Bacteria 11792
240 Ga0501047_0113372 3300049581 Bacteria 2593
241 Ga0501047_0379237 3300049581 Bacteria 1248
242 Ga0501048_0179777 3300049582 Bacteria 1499
243 Ga0501067_0009850 3300049583 Bacteria 5292
244 Ga0501067_0134424 3300049583 Bacteria 1377
245 Ga0501067_0139017 3300049583 Bacteria 1352
246 Ga0501070_0101056 3300049586 Bacteria 2385
247 Ga0501073_0033178 3300049589 Bacteria 3677
248 Ga0501073_0118930 3300049589 Bacteria 1831
249 Ga0501073_0128796 3300049589 Bacteria 1754
250 Ga0501076_0429199 3300049592 Bacteria 1088
251 Ga0501077_0220384 3300049593 Bacteria 1206
252 Ga0501080_0027937 3300049742 Bacteria 5246
253 Ga0501080_0112087 3300049742 Unclassified 2528
254 Ga0501080_0681308 3300049742 Bacteria 908
255 Ga0501083_0004890 3300049744 Bacteria 9475
256 Ga0501083_0068453 3300049744 Bacteria 2362
257 Ga0501083_0199819 3300049744 Bacteria 1304
258 Ga0501083_0244373 3300049744 Bacteria 1168
259 Ga0501044_0037772 3300049823 Bacteria 5046
260 Ga0501044_0057381 3300049823 Bacteria 3995
261 Ga0501044_0428881 3300049823 Unclassified 1231
262 nmdc:mga05p37_184585_c1 3300050507 Bacteria 2536
263 nmdc:mga05p37_190092_c1 3300050507 Bacteria 2493
264 nmdc:mga05p37_29_c1 3300050507 Bacteria 114400
265 nmdc:mga05p37_727036_c1 3300050507 Bacteria 1098
266 nmdc:mga05p37_79350_c1 3300050507 Bacteria 4042
267 nmdc:mga05p37_89933_c1 3300050507 Bacteria 3783
268 nmdc:mga09592_607389_c1 3300050508 Unclassified 937
269 nmdc:mga0qj67_355359_c1 3300050509 Bacteria 1184
270 nmdc:mga06r32_117945_c1 3300050510 Bacteria 2616
271 nmdc:mga06r32_218581_c1 3300050510 Bacteria 1893
272 nmdc:mga06r32_463589_c1 3300050510 Bacteria 1246
273 nmdc:mga06r32_535324_c1 3300050510 Bacteria 1146
274 nmdc:mga08y16_104276_c1 3300050511 Unclassified 2952
275 nmdc:mga08y16_113434_c1 3300050511 Bacteria 2821
276 nmdc:mga08y16_181139_c1 3300050511 Bacteria 2188
277 nmdc:mga08y16_7554_c1 3300050511 Bacteria 11389
278 nmdc:mga0n895_64245_c1 3300050512 Bacteria 3631
279 nmdc:mga0rr50_122062_c1 3300050513 Bacteria 2076
280 nmdc:mga08x19_33744_c1 3300050514 Bacteria 3231
281 Ga0495601_0041490 3300053077 Bacteria 2885
282 Ga0495601_0103090 3300053077 Bacteria 1844
283 Ga0495595_0037961 3300053084 Bacteria 2193
284 Ga0495619_0034255 3300053085 Bacteria 3301
285 Ga0501084_0017468 3300054114 Bacteria 5964
286 Ga0501084_0164431 3300054114 Bacteria 1873
287 Ga0501082_0035760 3300060353 Bacteria 4280
288 Ga0070708_100117415
289 MBSR1b_contig_1163342
290 MBSR1b_contig_3648798
291 Ga0065712_10000399
292 Ga0065715_10132268
293 Ga0070676_10063106
294 Ga0070690_100001774
295 Ga0070670_100036541
296 Ga0070670_100180081
297 Ga0070680_100175402
298 Ga0068868_100035256
299 Ga0068868_100051191
300 Ga0070689_100147453
301 Ga0070689_100499388
302 Ga0070689_100510786
303 Ga0070687_100132204
304 Ga0070668_100048164
305 Ga0070668_100552175
306 Ga0070669_100132574
307 Ga0070675_100115425
308 Ga0070675_100154902
309 Ga0070671_100013365
310 Ga0070674_100002917
311 Ga0070674_100106145
312 Ga0070673_100061598
313 Ga0070673_100170245
314 Ga0070673_100455137
315 Ga0070688_100002708
316 Ga0070688_100097828
317 Ga0070688_100102157
318 Ga0070688_100325651
319 Ga0070659_100389694
320 Ga0070667_100668190
321 Ga0070701_10239172
322 Ga0070705_100067001
323 Ga0070694_100053702
324 Ga0070694_100458524
325 Ga0070678_100068383
326 Ga0070681_10431868
327 Ga0068867_100130941
328 Ga0068867_100294207
329 Ga0068867_100459100
330 Ga0070685_10185516
331 Ga0070685_10512980
332 Ga0070699_100002875
333 Ga0070684_100736993
334 Ga0070697_100033663
335 Ga0070686_100002412
336 Ga0070696_100007930
337 Ga0070665_100023606
338 Ga0070704_100118550
339 Ga0070704_100523763
340 Ga0068854_100113832
341 Ga0068854_100192640
342 Ga0070702_100161640
343 Ga0068864_100002718
344 Ga0068864_100358308
345 Ga0068866_10030229
346 Ga0068866_10171771
347 Ga0068861_100025712
348 Ga0068861_100196027
349 Ga0068861_100244033
350 Ga0068863_100023402
351 Ga0068863_100324482
352 Ga0068863_100422711
353 Ga0068858_100066132
354 Ga0068858_100720576
355 Ga0068860_100175455
356 Ga0068860_100213515
357 Ga0068860_100392192
358 Ga0068860_101179325
359 Ga0068862_100051696
360 Ga0068862_100313386
361 Ga0068862_100461252
362 Ga0070716_100200077
363 Ga0097621_100000491
364 Ga0068871_100077855
365 Ga0068871_100217558
366 Ga0075430_100276642
367 Ga0075431_100052017
368 Ga0075431_100107986
369 Ga0075431_100147379
370 Ga0075431_100186947
371 Ga0075431_100221375
372 Ga0075431_100485886
373 Ga0075433_10052737
374 Ga0075429_100181465
375 Ga0075429_100188403
376 Ga0075429_100448041
377 Ga0075429_100511053
378 Ga0068865_100063164
379 Ga0068865_100286506
380 Ga0075436_100016643
381 Ga0075436_100230689
382 Ga0075435_100015709
383 Ga0105240_10010582
384 Ga0105240_10132503
385 Ga0111539_10605322
386 Ga0114129_10000690
387 Ga0114129_10022608
388 Ga0114129_10102460
389 Ga0114129_10186213
390 Ga0114129_10490543
391 Ga0105243_10019410
392 Ga0105242_10021925
393 Ga0105248_10024459
394 Ga0105248_10038687
395 Ga0105248_10091836
396 Ga0105248_10278956
397 Ga0105249_10096215
398 Ga0105249_10187165
399 Ga0105246_10167242
400 Ga0157374_10098524
401 Ga0163162_10068502
402 Ga0163162_10093515
403 Ga0157375_10260187
404 Ga0157375_10372262
405 Ga0163163_10013754
406 Ga0163163_10096571
407 Ga0163163_10370470
408 Ga0157380_10024633
409 Ga0157380_10235045
410 Ga0157380_10935160
411 Ga0157377_10124025
412 Ga0157377_10249125
413 Ga0157376_10088840
414 Ga0157376_10256611
415 Ga0163161_10394898
416 Ga0213876_10225762
417 Ga0207697_10012725
418 Ga0207642_10280168
419 Ga0207645_10228643
420 Ga0207645_10415391
421 Ga0207684_10324023
422 Ga0207662_10090842
423 Ga0207650_10011773
424 Ga0207650_10489008
425 Ga0207659_10097760
426 Ga0207659_10156984
427 Ga0207687_10545266
428 Ga0207706_10015058
429 Ga0207686_10157846
430 Ga0207686_10260854
431 Ga0207709_10098186
432 Ga0207670_10204780
433 Ga0207669_10010194
434 Ga0207669_10027315
435 Ga0207669_10029466
436 Ga0207704_10093843
437 Ga0207704_10171177
438 Ga0207704_10431011
439 Ga0207691_10018577
440 Ga0207711_10036499
441 Ga0207711_10040920
442 Ga0207689_10061159
443 Ga0207667_10349070
444 Ga0207651_10060700
445 Ga0207712_10189985
446 Ga0207712_10336173
447 Ga0207712_10381618
448 Ga0207668_10308713
449 Ga0207668_10617125
450 Ga0207640_10242855
451 Ga0207658_10631562
452 Ga0207677_10471121
453 Ga0207703_10407368
454 Ga0207678_10035993
455 Ga0207702_10030335
456 Ga0207641_10065171
457 Ga0207641_10316725
458 Ga0207641_10612971
459 Ga0207648_10031050
460 Ga0207648_10121387
461 Ga0207648_10245667
462 Ga0207676_10022043
463 Ga0207676_11018000
464 Ga0207674_10836112
465 Ga0207675_100048123
466 Ga0207675_100125484
467 Ga0207675_100680282
468 Ga0268265_10406419
469 Ga0268265_10526109
470 Ga0268264_10853910
471 Ga0307412_10304679
472 Ga0307416_100005578
473 Ga0307416_100098532
474 Ga0307415_100118008
475 Ga0395900_0522978
476 Ga0395898_0721170
477 Ga0439464_0054692
478 Ga0451576_0097311
479 Ga0466967_0813269
480 Ga0495618_0202626
481 Ga0495640_0046999
482 Ga0495586_0161768
483 Ga0495645_0125013
484 Ga0495667_0210445
485 Ga0495611_0156398
486 Ga0495599_0029955
487 Ga0495680_0321573
488 Ga0495684_0096983
489 Ga0496101_0001528
490 Ga0496101_0462335
491 Ga0496102_0026333
492 Ga0496102_0284767
493 Ga0496102_0426294
494 Ga0496104_0101987
495 Ga0496104_0730911
496 Ga0496105_0032187
497 Ga0496106_0072661
498 Ga0496108_0014715
499 Ga0496109_0003744
500 Ga0496110_0001714
501 Ga0496112_0003060
502 Ga0496112_0046821
503 Ga0496112_0471948
504 Ga0496112_0477275
505 Ga0496113_0032480
506 Ga0496113_0096068
507 Ga0496114_0000958
508 Ga0496114_0199123
509 Ga0501031_0204597
510 Ga0501032_0001132
511 Ga0501034_0004803
512 Ga0501034_0005502
513 Ga0501034_0418929
514 Ga0501034_0483447
515 Ga0501036_0001495
516 Ga0501037_0032482
517 Ga0501038_0023244
518 Ga0501038_0060471
519 Ga0501039_0014717
520 Ga0501039_0206466
521 Ga0501043_0001097
522 Ga0501043_0005731
523 Ga0501043_0043588
524 Ga0501046_0018474
525 Ga0501047_0000303
526 Ga0501047_0005641
527 Ga0501047_0113372
528 Ga0501047_0379237
529 Ga0501048_0179777
530 Ga0501067_0009850
531 Ga0501067_0134424
532 Ga0501067_0139017
533 Ga0501070_0101056
534 Ga0501073_0033178
535 Ga0501073_0118930
536 Ga0501073_0128796
537 Ga0501076_0429199
538 Ga0501077_0220384
539 Ga0501080_0027937
540 Ga0501080_0112087
541 Ga0501080_0681308
542 Ga0501083_0004890
543 Ga0501083_0068453
544 Ga0501083_0199819
545 Ga0501083_0244373
546 Ga0501044_0037772
547 Ga0501044_0057381
548 Ga0501044_0428881
549 nmdc:mga05p37_184585_c1
550 nmdc:mga05p37_190092_c1
551 nmdc:mga05p37_29_c1
552 nmdc:mga05p37_727036_c1
553 nmdc:mga05p37_79350_c1
554 nmdc:mga05p37_89933_c1
555 nmdc:mga09592_607389_c1
556 nmdc:mga0qj67_355359_c1
557 nmdc:mga06r32_117945_c1
558 nmdc:mga06r32_218581_c1
559 nmdc:mga06r32_463589_c1
560 nmdc:mga06r32_535324_c1
561 nmdc:mga08y16_104276_c1
562 nmdc:mga08y16_113434_c1
563 nmdc:mga08y16_181139_c1
564 nmdc:mga08y16_7554_c1
565 nmdc:mga0n895_64245_c1
566 nmdc:mga0rr50_122062_c1
567 nmdc:mga08x19_33744_c1
568 Ga0495601_0041490
569 Ga0495601_0103090
570 Ga0495595_0037961
571 Ga0495619_0034255
572 Ga0501084_0017468
573 Ga0501084_0164431
574 Ga0501082_0035760

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00215

OMPdecase

Orotidine 5'-phosphate decarboxylase / HUMPS family

2

228

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cso-assembly5.cif.gz_J crystal structure of orotidine 5'-phosphate decarboxylase from klebsiella pneumoniae in complex with uridine-5'-monophosphate 0.9554 5 179
3tr2-assembly1.cif.gz_B structure of a orotidine 5'-phosphate decarboxylase (pyrf) from coxiella burnetii 0.9525 1 234
8cso-assembly1.cif.gz_B crystal structure of orotidine 5'-phosphate decarboxylase from klebsiella pneumoniae in complex with uridine-5'-monophosphate 0.9515 3 233
8dop-assembly3.cif.gz_E crystal structure of 2,3-diketo-5-methylthiopentyl-1-phosphate enolase-phosphatase from klebsiella aerogenes (p1 form) 0.9508 4 232
1jjk-assembly1.cif.gz_A selenomethionine substitution of orotidine-5'-monophosphate decarboxylase from e. coli causes a change in crystal contacts and space group 0.9503 1 232
ID Description Score Start End Superfamily
1jjkA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9361 1 232 3.20.20.70
3ru6D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9333 3 231 3.20.20.70
3ldvB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.928 2 232 3.20.20.70
2yyuB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9254 1 232 3.20.20.70
3ru6D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9208 3 231 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7Y5Q5G5-F1-model_v4 Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) 0.9867 5 93 GO:0004590
GO:0005829
GO:0006207
GO:0044205
AF-A0A7W1YTC1-F1-model_v4 Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) 0.9851 5 121 GO:0004590
GO:0005829
GO:0006207
GO:0044205
AF-A0A3C0IW84-F1-model_v4 Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) 0.9796 6 105 GO:0004590
GO:0005829
GO:0006207
GO:0044205
AF-W1V747-F1-model_v4 Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) 0.9784 31 162 GO:0004590
GO:0005829
GO:0006207
GO:0044205
AF-A0A7C2W2J4-F1-model_v4 Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) 0.9771 5 124 GO:0004590
GO:0005829
GO:0006207
GO:0044205

Map