F387681

General Info

Members Datasets Scaffolds Average Seq Length
286 153 572 256

Family's Representative Sequence

Representative Sequence 3300049587|Ga0501071_0058693|Ga0501071_0058693_467_1384
Length 295
Sequence MPSRAMPAPDGSSLLQSPAFEITAFLLGLVVGSFANVCIHRLPRAIDESDSGRVAWARRVWRQLRSIGYPPSRCPRCGLRIRPWDNVPVLSFLALRGRCRDCGTPIPWRYPAVEAANGLLWLAIALLRGPTVSALVAMAIDLEHQLLPDSITLPGIALGVGASFLPGSPIGPLAAVAAAAGGWLSFALLAFAWKKLRDVDALGEGDWKMAAMLGAFFGWERMLLTVLLASVAGSLIGIGMMLAARGGWRSQLPLGTFLGIAGIAMVVFGDGILGFYQALSAVLIEPIPPLGRAAG

Samples

Sample ID Description Type Environment
1 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
112 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
117 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
121 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
122 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
123 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
129 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
130 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
131 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
132 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
134 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
135 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
136 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
137 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
138 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
139 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
140 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
141 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
142 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
143 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
144 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
145 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
148 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
149 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
150 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
151 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
152 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
153 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.85
Nodule 0
Rhizoplane 3.15
Rhizosphere 93.01
Stem 0
Stem Tuber 0
Unclassified 17.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501071_0058693 3300049587 Bacteria 2783
2 Ga0065704_10129776 3300005289 Bacteria 1644
3 Ga0065712_10069168 3300005290 Bacteria 7835
4 Ga0065712_10072784 3300005290 Unclassified 4619
5 Ga0070676_10036792 3300005328 Bacteria 2821
6 Ga0070683_100000203 3300005329 Bacteria 40069
7 Ga0070690_100289242 3300005330 Bacteria 1171
8 Ga0070677_10057144 3300005333 Bacteria 1598
9 Ga0070677_10220312 3300005333 Unclassified 926
10 Ga0068869_100032711 3300005334 Bacteria 3667
11 Ga0068869_100133463 3300005334 Unclassified 1911
12 Ga0070689_100025773 3300005340 Bacteria 4420
13 Ga0070689_100073984 3300005340 Bacteria 2666
14 Ga0070689_100308318 3300005340 Bacteria 1319
15 Ga0070687_100042326 3300005343 Bacteria 2307
16 Ga0070687_100075849 3300005343 Bacteria 1819
17 Ga0070668_100014806 3300005347 Bacteria 5828
18 Ga0070668_100144896 3300005347 Bacteria 1916
19 Ga0070669_100047972 3300005353 Bacteria 3117
20 Ga0070669_100079412 3300005353 Bacteria 2440
21 Ga0070669_100418594 3300005353 Bacteria 1099
22 Ga0070675_100040946 3300005354 Bacteria 3784
23 Ga0070675_100124172 3300005354 Bacteria 2195
24 Ga0070675_100375347 3300005354 Bacteria 1265
25 Ga0070674_100025604 3300005356 Unclassified 3842
26 Ga0070673_100031325 3300005364 Bacteria 3989
27 Ga0070673_100056229 3300005364 Bacteria 3104
28 Ga0070673_100293087 3300005364 Bacteria 1430
29 Ga0070688_100049357 3300005365 Bacteria 2618
30 Ga0070688_100087930 3300005365 Unclassified 2025
31 Ga0070667_100150227 3300005367 Unclassified 2046
32 Ga0070705_100018238 3300005440 Bacteria 3676
33 Ga0070705_100100361 3300005440 Bacteria 1826
34 Ga0070694_100107320 3300005444 Bacteria 1984
35 Ga0070694_100140924 3300005444 Unclassified 1751
36 Ga0070708_100008834 3300005445 Bacteria 8109
37 Ga0070678_100233908 3300005456 Bacteria 1533
38 Ga0068867_100009653 3300005459 Bacteria 6802
39 Ga0070706_100025861 3300005467 Bacteria 5401
40 Ga0070707_100004429 3300005468 Bacteria 13157
41 Ga0070707_100012835 3300005468 Bacteria 7822
42 Ga0070707_100323192 3300005468 Bacteria 1499
43 Ga0070698_100020565 3300005471 Bacteria 6920
44 Ga0070698_100035736 3300005471 Bacteria 5135
45 Ga0070698_100043910 3300005471 Bacteria 4580
46 Ga0070698_100055773 3300005471 Bacteria 4004
47 Ga0070698_100167456 3300005471 Bacteria 2139
48 Ga0070698_100493116 3300005471 Unclassified 1162
49 Ga0070699_100003480 3300005518 Bacteria 13925
50 Ga0070699_100292897 3300005518 Bacteria 1459
51 Ga0070684_100001332 3300005535 Bacteria 17667
52 Ga0070697_100029264 3300005536 Bacteria 4415
53 Ga0070672_100010271 3300005543 Bacteria 6490
54 Ga0070686_100058676 3300005544 Bacteria 2477
55 Ga0070665_100222629 3300005548 Bacteria 1887
56 Ga0070704_100019942 3300005549 Bacteria 4314
57 Ga0070704_100138560 3300005549 Bacteria 1896
58 Ga0070704_100277047 3300005549 Bacteria 1388
59 Ga0070664_100001490 3300005564 Bacteria 18643
60 Ga0070664_100183524 3300005564 Unclassified 1861
61 Ga0068857_100306247 3300005577 Bacteria 1465
62 Ga0070702_100007326 3300005615 Bacteria 5278
63 Ga0068859_100104859 3300005617 Unclassified 2887
64 Ga0068864_100225609 3300005618 Bacteria 1730
65 Ga0068866_10314126 3300005718 Unclassified 983
66 Ga0068861_100054729 3300005719 Bacteria 3040
67 Ga0068861_100277051 3300005719 Unclassified 1443
68 Ga0068851_10146151 3300005834 Bacteria 1289
69 Ga0068870_10035004 3300005840 Bacteria 2574
70 Ga0068863_100027920 3300005841 Bacteria 5386
71 Ga0068858_100013435 3300005842 Bacteria 7727
72 Ga0068858_100089054 3300005842 Bacteria 2872
73 Ga0068860_100138321 3300005843 Unclassified 2339
74 Ga0068862_100065876 3300005844 Bacteria 3120
75 Ga0068862_100153723 3300005844 Bacteria 2049
76 Ga0068862_100245845 3300005844 Bacteria 1628
77 Ga0075368_10002258 3300006042 Bacteria 6264
78 Ga0075363_100025090 3300006048 Bacteria 3036
79 Ga0075367_10002873 3300006178 Bacteria 8017
80 Ga0075367_10016866 3300006178 Bacteria 3997
81 Ga0075428_100012831 3300006844 Bacteria 9322
82 Ga0075428_100020706 3300006844 Bacteria 7284
83 Ga0075428_100027117 3300006844 Bacteria 6342
84 Ga0075428_100058364 3300006844 Bacteria 4225
85 Ga0075428_100192382 3300006844 Bacteria 2206
86 Ga0075428_100276720 3300006844 Unclassified 1806
87 Ga0075428_100354224 3300006844 Unclassified 1575
88 Ga0075428_100484578 3300006844 Bacteria 1324
89 Ga0075430_100047057 3300006846 Bacteria 3642
90 Ga0075431_100001989 3300006847 Bacteria 19507
91 Ga0075431_100019065 3300006847 Bacteria 6989
92 Ga0075431_100157093 3300006847 Bacteria 2340
93 Ga0075431_100174131 3300006847 Bacteria 2211
94 Ga0075431_100181610 3300006847 Unclassified 2159
95 Ga0075431_100195640 3300006847 Bacteria 2070
96 Ga0075433_10035208 3300006852 Bacteria 4304
97 Ga0075433_10047473 3300006852 Bacteria 3735
98 Ga0075433_10052471 3300006852 Unclassified 3553
99 Ga0075433_10053989 3300006852 Bacteria 3505
100 Ga0075433_10062824 3300006852 Bacteria 3253
101 Ga0075433_10441870 3300006852 Bacteria 1147
102 Ga0075433_10487978 3300006852 Bacteria 1085
103 Ga0075434_100013037 3300006871 Bacteria 7893
104 Ga0075434_100088504 3300006871 Bacteria 3098
105 Ga0075429_100002562 3300006880 Bacteria 15324
106 Ga0075429_100007032 3300006880 Bacteria 9777
107 Ga0075429_100053091 3300006880 Bacteria 3527
108 Ga0068865_100060682 3300006881 Unclassified 2648
109 Ga0097620_100104860 3300006931 Unclassified 2887
110 Ga0075435_100004094 3300007076 Bacteria 9986
111 Ga0075435_100005605 3300007076 Bacteria 8791
112 Ga0075435_100007280 3300007076 Bacteria 7877
113 Ga0075435_100052500 3300007076 Bacteria 3286
114 Ga0075435_100062953 3300007076 Bacteria 3012
115 Ga0075435_100243372 3300007076 Bacteria 1530
116 Ga0111539_10000085 3300009094 Bacteria 95551
117 Ga0111539_10000566 3300009094 Bacteria 47366
118 Ga0111539_10015133 3300009094 Bacteria 9613
119 Ga0111539_10085380 3300009094 Bacteria 3710
120 Ga0111539_10085447 3300009094 Bacteria 3708
121 Ga0105245_10392041 3300009098 Bacteria 1386
122 Ga0114129_10006685 3300009147 Bacteria 16372
123 Ga0114129_10036872 3300009147 Bacteria 6903
124 Ga0114129_10055282 3300009147 Bacteria 5564
125 Ga0114129_10086636 3300009147 Bacteria 4344
126 Ga0114129_10143243 3300009147 Bacteria 3275
127 Ga0114129_10526178 3300009147 Bacteria 1541
128 Ga0114129_10547485 3300009147 Bacteria 1505
129 Ga0114129_10868191 3300009147 Unclassified 1146
130 Ga0105243_10027522 3300009148 Unclassified 4357
131 Ga0105248_10042166 3300009177 Bacteria 5118
132 Ga0105248_10152024 3300009177 Bacteria 2612
133 Ga0105249_10040837 3300009553 Bacteria 4215
134 Ga0105249_10405537 3300009553 Bacteria 1394
135 Ga0105246_10107061 3300011119 Bacteria 2047
136 Ga0157378_10029727 3300013297 Bacteria 4824
137 Ga0163162_10197546 3300013306 Unclassified 2140
138 Ga0157375_10674730 3300013308 Unclassified 1188
139 Ga0163163_10022335 3300014325 Bacteria 5988
140 Ga0163163_10292879 3300014325 Bacteria 1680
141 Ga0163163_10610848 3300014325 Unclassified 1154
142 Ga0157380_10001004 3300014326 Bacteria 17945
143 Ga0157380_10172604 3300014326 Unclassified 1891
144 Ga0157380_10278828 3300014326 Bacteria 1528
145 Ga0207697_10056275 3300025315 Bacteria 1632
146 Ga0207642_10127945 3300025899 Bacteria 1321
147 Ga0207688_10079591 3300025901 Unclassified 1869
148 Ga0207645_10016728 3300025907 Bacteria 4849
149 Ga0207645_10301808 3300025907 Bacteria 1066
150 Ga0207643_10004424 3300025908 Bacteria 7557
151 Ga0207684_10017098 3300025910 Bacteria 6226
152 Ga0207684_10140938 3300025910 Bacteria 2072
153 Ga0207684_10363570 3300025910 Bacteria 1245
154 Ga0207660_10050978 3300025917 Bacteria 2941
155 Ga0207662_10013352 3300025918 Bacteria 4592
156 Ga0207646_10005507 3300025922 Bacteria 13306
157 Ga0207646_10005881 3300025922 Bacteria 12811
158 Ga0207646_10008857 3300025922 Bacteria 10025
159 Ga0207681_10021629 3300025923 Unclassified 4092
160 Ga0207681_10247597 3300025923 Unclassified 1390
161 Ga0207650_10005892 3300025925 Bacteria 8365
162 Ga0207650_10186360 3300025925 Unclassified 1656
163 Ga0207659_10080391 3300025926 Unclassified 2407
164 Ga0207659_10172350 3300025926 Bacteria 1708
165 Ga0207644_10203627 3300025931 Bacteria 1562
166 Ga0207644_10314662 3300025931 Bacteria 1265
167 Ga0207706_10028346 3300025933 Bacteria 5002
168 Ga0207706_10199870 3300025933 Bacteria 1753
169 Ga0207709_10082147 3300025935 Unclassified 2080
170 Ga0207670_10019388 3300025936 Bacteria 4154
171 Ga0207670_10307679 3300025936 Bacteria 1243
172 Ga0207670_10441962 3300025936 Unclassified 1047
173 Ga0207669_10029034 3300025937 Bacteria 3052
174 Ga0207704_10027017 3300025938 Unclassified 3158
175 Ga0207691_10003941 3300025940 Bacteria 14417
176 Ga0207691_10046713 3300025940 Bacteria 3977
177 Ga0207711_10133866 3300025941 Bacteria 2224
178 Ga0207689_10065799 3300025942 Unclassified 2981
179 Ga0207689_10112787 3300025942 Bacteria 2235
180 Ga0207661_10010362 3300025944 Bacteria 6708
181 Ga0207679_10008902 3300025945 Bacteria 6407
182 Ga0207651_10075005 3300025960 Bacteria 2411
183 Ga0207712_10055292 3300025961 Bacteria 2791
184 Ga0207712_10106324 3300025961 Bacteria 2096
185 Ga0207668_10133822 3300025972 Unclassified 1897
186 Ga0207658_10117765 3300025986 Unclassified 2112
187 Ga0207658_10285690 3300025986 Bacteria 1416
188 Ga0207677_10030635 3300026023 Unclassified 3437
189 Ga0207703_10107081 3300026035 Bacteria 2379
190 Ga0207703_10600863 3300026035 Unclassified 1041
191 Ga0207678_10012372 3300026067 Bacteria 7490
192 Ga0207678_10024138 3300026067 Bacteria 5312
193 Ga0207708_10012410 3300026075 Bacteria 6351
194 Ga0207641_10049178 3300026088 Bacteria 3562
195 Ga0207648_10003775 3300026089 Bacteria 15832
196 Ga0207676_10191786 3300026095 Unclassified 1799
197 Ga0207676_10208844 3300026095 Bacteria 1731
198 Ga0207674_10180704 3300026116 Bacteria 2061
199 Ga0207674_10297243 3300026116 Bacteria 1564
200 Ga0207675_100024602 3300026118 Bacteria 5599
201 Ga0207675_100131871 3300026118 Bacteria 2370
202 Ga0207675_100345805 3300026118 Bacteria 1456
203 Ga0207683_10057056 3300026121 Bacteria 3427
204 Ga0209813_10006548 3300027866 Bacteria 2883
205 Ga0207428_10000125 3300027907 Bacteria 105543
206 Ga0207428_10055624 3300027907 Bacteria 3145
207 Ga0207428_10159663 3300027907 Bacteria 1712
208 Ga0268265_10047978 3300028380 Bacteria 3203
209 Ga0268265_10063285 3300028380 Bacteria 2846
210 Ga0268265_10252561 3300028380 Unclassified 1563
211 Ga0268265_10379539 3300028380 Bacteria 1300
212 Ga0268264_10051162 3300028381 Bacteria 3441
213 Ga0316576_10014768 3300031727 Bacteria 5222
214 Ga0316577_10037041 3300031733 Unclassified 2728
215 Ga0307416_100277601 3300032002 Bacteria 1650
216 Ga0373941_0075879 3300035115 Unclassified 1126
217 Ga0373933_0164769 3300035724 Bacteria 1409
218 Ga0316584_0000353 3300036712 Bacteria 23683
219 Ga0316584_0057091 3300036712 Bacteria 2922
220 Ga0450920_034302 3300042122 Bacteria 1004
221 Ga0451577_0176839 3300042876 Bacteria 1924
222 Ga0451576_0409962 3300045051 Bacteria 1421
223 Ga0495638_0003715 3300046460 Bacteria 11882
224 Ga0495669_0033786 3300046684 Bacteria 2253
225 Ga0495672_0001740 3300047320 Bacteria 21031
226 Ga0496100_0243403 3300048903 Bacteria 1328
227 Ga0496104_0005476 3300048907 Bacteria 11118
228 Ga0496105_0082278 3300048908 Unclassified 2659
229 Ga0496108_0004110 3300048911 Bacteria 11690
230 Ga0496109_0002990 3300048912 Bacteria 14124
231 Ga0496110_0002419 3300048913 Bacteria 13970
232 Ga0496111_0095578 3300048914 Unclassified 2180
233 Ga0496112_0007435 3300048915 Bacteria 9724
234 Ga0496113_0154404 3300048916 Bacteria 1812
235 Ga0501042_0352064 3300049578 Bacteria 1065
236 Ga0501042_0363303 3300049578 Bacteria 1048
237 Ga0501072_0301116 3300049588 Bacteria 1275
238 Ga0501075_0031593 3300049591 Bacteria 3931
239 Ga0501076_0070163 3300049592 Bacteria 2801
240 Ga0501076_0168372 3300049592 Bacteria 1786
241 Ga0501076_0517292 3300049592 Bacteria 984
242 Ga0501081_0442789 3300049743 Bacteria 965
243 Ga0501045_0051496 3300049824 Unclassified 3005
244 nmdc:mga03n38_104493_c1 3300050490 Bacteria 1370
245 nmdc:mga03n38_202858_c1 3300050490 Bacteria 1027
246 nmdc:mga00v17_16196_c1 3300050491 Bacteria 4201
247 nmdc:mga0k408_2647_c1 3300050493 Bacteria 9507
248 nmdc:mga06z11_2811_c1 3300050494 Bacteria 6673
249 nmdc:mga04h51_7490_c1 3300050495 Bacteria 2883
250 nmdc:mga05p37_114985_c1 3300050507 Bacteria 3307
251 nmdc:mga05p37_12199_c1 3300050507 Bacteria 10261
252 nmdc:mga05p37_39926_c1 3300050507 Bacteria 5763
253 nmdc:mga05p37_46670_c1 3300050507 Bacteria 5325
254 nmdc:mga05p37_5785_c1 3300050507 Bacteria 9872
255 nmdc:mga05p37_69655_c2 3300050507 Unclassified 1453
256 nmdc:mga09592_12525_c1 3300050508 Bacteria 6911
257 nmdc:mga09592_1756_c1 3300050508 Bacteria 17422
258 nmdc:mga09592_491634_c1 3300050508 Bacteria 1057
259 nmdc:mga09592_73115_c1 3300050508 Bacteria 2912
260 nmdc:mga0qj67_45607_c1 3300050509 Bacteria 3459
261 nmdc:mga06r32_1132_c1 3300050510 Bacteria 23910
262 nmdc:mga06r32_141361_c1 3300050510 Unclassified 2383
263 nmdc:mga06r32_5555_c1 3300050510 Bacteria 11364
264 nmdc:mga06r32_65624_c1 3300050510 Bacteria 3501
265 nmdc:mga08y16_130249_c1 3300050511 Bacteria 2617
266 nmdc:mga08y16_4396_c1 3300050511 Bacteria 14733
267 nmdc:mga08y16_72662_c1 3300050511 Bacteria 3584
268 nmdc:mga08y16_74481_c1 3300050511 Bacteria 3538
269 nmdc:mga08y16_894591_c1 3300050511 Bacteria 874
270 nmdc:mga0n895_182565_c1 3300050512 Bacteria 2130
271 nmdc:mga0n895_205472_c1 3300050512 Bacteria 2000
272 nmdc:mga0n895_22084_c1 3300050512 Bacteria 5964
273 nmdc:mga0rr50_33751_c1 3300050513 Unclassified 3659
274 nmdc:mga0rr50_41070_c1 3300050513 Bacteria 3368
275 nmdc:mga0rr50_66065_c2 3300050513 Bacteria 1746
276 nmdc:mga08x19_103101_c1 3300050514 Bacteria 1895
277 nmdc:mga08x19_15291_c1 3300050514 Bacteria 4668
278 nmdc:mga0a205_110695_c1 3300050515 Bacteria 2645
279 nmdc:mga0a205_15300_c1 3300050515 Bacteria 7168
280 nmdc:mga0a205_3290_c1 3300050515 Bacteria 2684
281 nmdc:mga0a205_80104_c1 3300050515 Bacteria 3156
282 Ga0501084_0118596 3300054114 Bacteria 2225
283 Ga0501084_0295184 3300054114 Unclassified 1369
284 Ga0501084_0489742 3300054114 Bacteria 1039
285 Ga0501082_0144863 3300060353 Unclassified 2062
286 Ga0501082_0171838 3300060353 Bacteria 1884
287 Ga0501071_0058693
288 Ga0065704_10129776
289 Ga0065712_10069168
290 Ga0065712_10072784
291 Ga0070676_10036792
292 Ga0070683_100000203
293 Ga0070690_100289242
294 Ga0070677_10057144
295 Ga0070677_10220312
296 Ga0068869_100032711
297 Ga0068869_100133463
298 Ga0070689_100025773
299 Ga0070689_100073984
300 Ga0070689_100308318
301 Ga0070687_100042326
302 Ga0070687_100075849
303 Ga0070668_100014806
304 Ga0070668_100144896
305 Ga0070669_100047972
306 Ga0070669_100079412
307 Ga0070669_100418594
308 Ga0070675_100040946
309 Ga0070675_100124172
310 Ga0070675_100375347
311 Ga0070674_100025604
312 Ga0070673_100031325
313 Ga0070673_100056229
314 Ga0070673_100293087
315 Ga0070688_100049357
316 Ga0070688_100087930
317 Ga0070667_100150227
318 Ga0070705_100018238
319 Ga0070705_100100361
320 Ga0070694_100107320
321 Ga0070694_100140924
322 Ga0070708_100008834
323 Ga0070678_100233908
324 Ga0068867_100009653
325 Ga0070706_100025861
326 Ga0070707_100004429
327 Ga0070707_100012835
328 Ga0070707_100323192
329 Ga0070698_100020565
330 Ga0070698_100035736
331 Ga0070698_100043910
332 Ga0070698_100055773
333 Ga0070698_100167456
334 Ga0070698_100493116
335 Ga0070699_100003480
336 Ga0070699_100292897
337 Ga0070684_100001332
338 Ga0070697_100029264
339 Ga0070672_100010271
340 Ga0070686_100058676
341 Ga0070665_100222629
342 Ga0070704_100019942
343 Ga0070704_100138560
344 Ga0070704_100277047
345 Ga0070664_100001490
346 Ga0070664_100183524
347 Ga0068857_100306247
348 Ga0070702_100007326
349 Ga0068859_100104859
350 Ga0068864_100225609
351 Ga0068866_10314126
352 Ga0068861_100054729
353 Ga0068861_100277051
354 Ga0068851_10146151
355 Ga0068870_10035004
356 Ga0068863_100027920
357 Ga0068858_100013435
358 Ga0068858_100089054
359 Ga0068860_100138321
360 Ga0068862_100065876
361 Ga0068862_100153723
362 Ga0068862_100245845
363 Ga0075368_10002258
364 Ga0075363_100025090
365 Ga0075367_10002873
366 Ga0075367_10016866
367 Ga0075428_100012831
368 Ga0075428_100020706
369 Ga0075428_100027117
370 Ga0075428_100058364
371 Ga0075428_100192382
372 Ga0075428_100276720
373 Ga0075428_100354224
374 Ga0075428_100484578
375 Ga0075430_100047057
376 Ga0075431_100001989
377 Ga0075431_100019065
378 Ga0075431_100157093
379 Ga0075431_100174131
380 Ga0075431_100181610
381 Ga0075431_100195640
382 Ga0075433_10035208
383 Ga0075433_10047473
384 Ga0075433_10052471
385 Ga0075433_10053989
386 Ga0075433_10062824
387 Ga0075433_10441870
388 Ga0075433_10487978
389 Ga0075434_100013037
390 Ga0075434_100088504
391 Ga0075429_100002562
392 Ga0075429_100007032
393 Ga0075429_100053091
394 Ga0068865_100060682
395 Ga0097620_100104860
396 Ga0075435_100004094
397 Ga0075435_100005605
398 Ga0075435_100007280
399 Ga0075435_100052500
400 Ga0075435_100062953
401 Ga0075435_100243372
402 Ga0111539_10000085
403 Ga0111539_10000566
404 Ga0111539_10015133
405 Ga0111539_10085380
406 Ga0111539_10085447
407 Ga0105245_10392041
408 Ga0114129_10006685
409 Ga0114129_10036872
410 Ga0114129_10055282
411 Ga0114129_10086636
412 Ga0114129_10143243
413 Ga0114129_10526178
414 Ga0114129_10547485
415 Ga0114129_10868191
416 Ga0105243_10027522
417 Ga0105248_10042166
418 Ga0105248_10152024
419 Ga0105249_10040837
420 Ga0105249_10405537
421 Ga0105246_10107061
422 Ga0157378_10029727
423 Ga0163162_10197546
424 Ga0157375_10674730
425 Ga0163163_10022335
426 Ga0163163_10292879
427 Ga0163163_10610848
428 Ga0157380_10001004
429 Ga0157380_10172604
430 Ga0157380_10278828
431 Ga0207697_10056275
432 Ga0207642_10127945
433 Ga0207688_10079591
434 Ga0207645_10016728
435 Ga0207645_10301808
436 Ga0207643_10004424
437 Ga0207684_10017098
438 Ga0207684_10140938
439 Ga0207684_10363570
440 Ga0207660_10050978
441 Ga0207662_10013352
442 Ga0207646_10005507
443 Ga0207646_10005881
444 Ga0207646_10008857
445 Ga0207681_10021629
446 Ga0207681_10247597
447 Ga0207650_10005892
448 Ga0207650_10186360
449 Ga0207659_10080391
450 Ga0207659_10172350
451 Ga0207644_10203627
452 Ga0207644_10314662
453 Ga0207706_10028346
454 Ga0207706_10199870
455 Ga0207709_10082147
456 Ga0207670_10019388
457 Ga0207670_10307679
458 Ga0207670_10441962
459 Ga0207669_10029034
460 Ga0207704_10027017
461 Ga0207691_10003941
462 Ga0207691_10046713
463 Ga0207711_10133866
464 Ga0207689_10065799
465 Ga0207689_10112787
466 Ga0207661_10010362
467 Ga0207679_10008902
468 Ga0207651_10075005
469 Ga0207712_10055292
470 Ga0207712_10106324
471 Ga0207668_10133822
472 Ga0207658_10117765
473 Ga0207658_10285690
474 Ga0207677_10030635
475 Ga0207703_10107081
476 Ga0207703_10600863
477 Ga0207678_10012372
478 Ga0207678_10024138
479 Ga0207708_10012410
480 Ga0207641_10049178
481 Ga0207648_10003775
482 Ga0207676_10191786
483 Ga0207676_10208844
484 Ga0207674_10180704
485 Ga0207674_10297243
486 Ga0207675_100024602
487 Ga0207675_100131871
488 Ga0207675_100345805
489 Ga0207683_10057056
490 Ga0209813_10006548
491 Ga0207428_10000125
492 Ga0207428_10055624
493 Ga0207428_10159663
494 Ga0268265_10047978
495 Ga0268265_10063285
496 Ga0268265_10252561
497 Ga0268265_10379539
498 Ga0268264_10051162
499 Ga0316576_10014768
500 Ga0316577_10037041
501 Ga0307416_100277601
502 Ga0373941_0075879
503 Ga0373933_0164769
504 Ga0316584_0000353
505 Ga0316584_0057091
506 Ga0450920_034302
507 Ga0451577_0176839
508 Ga0451576_0409962
509 Ga0495638_0003715
510 Ga0495669_0033786
511 Ga0495672_0001740
512 Ga0496100_0243403
513 Ga0496104_0005476
514 Ga0496105_0082278
515 Ga0496108_0004110
516 Ga0496109_0002990
517 Ga0496110_0002419
518 Ga0496111_0095578
519 Ga0496112_0007435
520 Ga0496113_0154404
521 Ga0501042_0352064
522 Ga0501042_0363303
523 Ga0501072_0301116
524 Ga0501075_0031593
525 Ga0501076_0070163
526 Ga0501076_0168372
527 Ga0501076_0517292
528 Ga0501081_0442789
529 Ga0501045_0051496
530 nmdc:mga03n38_104493_c1
531 nmdc:mga03n38_202858_c1
532 nmdc:mga00v17_16196_c1
533 nmdc:mga0k408_2647_c1
534 nmdc:mga06z11_2811_c1
535 nmdc:mga04h51_7490_c1
536 nmdc:mga05p37_114985_c1
537 nmdc:mga05p37_12199_c1
538 nmdc:mga05p37_39926_c1
539 nmdc:mga05p37_46670_c1
540 nmdc:mga05p37_5785_c1
541 nmdc:mga05p37_69655_c2
542 nmdc:mga09592_12525_c1
543 nmdc:mga09592_1756_c1
544 nmdc:mga09592_491634_c1
545 nmdc:mga09592_73115_c1
546 nmdc:mga0qj67_45607_c1
547 nmdc:mga06r32_1132_c1
548 nmdc:mga06r32_141361_c1
549 nmdc:mga06r32_5555_c1
550 nmdc:mga06r32_65624_c1
551 nmdc:mga08y16_130249_c1
552 nmdc:mga08y16_4396_c1
553 nmdc:mga08y16_72662_c1
554 nmdc:mga08y16_74481_c1
555 nmdc:mga08y16_894591_c1
556 nmdc:mga0n895_182565_c1
557 nmdc:mga0n895_205472_c1
558 nmdc:mga0n895_22084_c1
559 nmdc:mga0rr50_33751_c1
560 nmdc:mga0rr50_41070_c1
561 nmdc:mga0rr50_66065_c2
562 nmdc:mga08x19_103101_c1
563 nmdc:mga08x19_15291_c1
564 nmdc:mga0a205_110695_c1
565 nmdc:mga0a205_15300_c1
566 nmdc:mga0a205_3290_c1
567 nmdc:mga0a205_80104_c1
568 Ga0501084_0118596
569 Ga0501084_0295184
570 Ga0501084_0489742
571 Ga0501082_0144863
572 Ga0501082_0171838

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06750

A24_N_bact

Bacterial Peptidase A24 N-terminal domain

26

127

0.97

PF01478

Peptidase_A24

Type IV leader peptidase family

131

238

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s0x-assembly2.cif.gz_B-2 the crystal structure of gxgd membrane protease flak 0.6538 103 252
3s0x-assembly2.cif.gz_B-2 the crystal structure of gxgd membrane protease flak 0.5422 103 252
7y3m-assembly2.cif.gz_C structure of sall4 zfc1 bound with 16 bp at-rich dsdna 0.3064 38 83
4ysx-assembly2.cif.gz_G crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with the specific inhibitor nn23 0.294 127 254
8djk-assembly1.cif.gz_A hmgcr-ubiad1 complex state 2 0.2918 8 256
ID Description Score Start End Superfamily
af_P25960_74_220_1.20.120.1220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9014 99 246 1.20.120.1220
af_P25960_74_220_1.20.120.1220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8901 99 246 1.20.120.1220
af_Q46836_122_264_1.20.120.1220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8333 99 243 1.20.120.1220
af_I6Y9M6_1_137_1.20.120.1220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8189 107 247 1.20.120.1220
af_Q46836_122_264_1.20.120.1220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8175 99 243 1.20.120.1220
ID Description Score Start End GO Terms
AF-A0A2V7YEN4-F1-model_v4 Prepilin peptidase 0.9753 8 145 GO:0004190
GO:0005886
GO:0006465
AF-A0A356Z9A7-F1-model_v4 Prepilin peptidase 0.9727 8 141 GO:0004190
GO:0005886
GO:0006465
AF-A0A545S9D6-F1-model_v4 Prepilin peptidase 0.971 8 132 GO:0004190
GO:0005886
GO:0006465
AF-A0A838GNM2-F1-model_v4 deleted 0.9694 8 140
AF-A0A3C1YH95-F1-model_v4 Prepilin peptidase A24 N-terminal domain-containing protein 0.9693 8 138 GO:0004190
GO:0005886
GO:0006465

Map