F387631

General Info

Members Datasets Scaffolds Average Seq Length
286 164 570 292

Family's Representative Sequence

Representative Sequence 3300047318|Ga0495636_0015981|Ga0495636_0015981_1737_2753
Length 332
Sequence MQHRAVDRTQLRTGVPTTPAGRLYGQQSGHAESLTVIPVSYETEAVAMDRVVTVGLDGSPESLAAAHWAADEAERRTLTLRLLHAWPLLVPEQTRIPAEVDQNYWANRIVRNARAELQARHPGLSIAGDLVADDAQDALLQAASESEMTVLGSRGLGAIDISMPVVARADRPVVLVRAATPEAGPPPGPRTAGGVVVALKLHGPCDDLLEFAFGSAAARGVPLRVVHGRSLPVNAYVPWGVDHDVTEEIKHEAQKDLSQVLRPWREKFPGVEVADLIVLESPAKAVVRAADGAGLLVVGRRKHRRGLAPRVGPVAQAAAHHARCPVAVVPHD

Samples

Sample ID Description Type Environment
1 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
4 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
5 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
6 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
7 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
8 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
9 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
10 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
11 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
12 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
13 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
14 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
15 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
16 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
17 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
18 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
19 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
20 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
21 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
22 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
23 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
24 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
25 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
26 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
27 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
28 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
29 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
30 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
31 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
32 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
33 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
34 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
35 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
36 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
37 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
38 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
39 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
40 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
41 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
42 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
43 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
44 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
45 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
46 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
47 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
48 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
49 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
50 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
51 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
52 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
53 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
54 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
55 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
56 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
57 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
58 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
59 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
60 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
61 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
62 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
63 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
64 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
65 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
66 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
67 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
68 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
69 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
70 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
71 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
72 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
73 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
74 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
75 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
76 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
77 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
78 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
79 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
80 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
81 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
82 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
83 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
84 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
85 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
86 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
87 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
88 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
89 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
90 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
91 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
92 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
93 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
94 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
95 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
96 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
97 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
98 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
101 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
102 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
103 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
104 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
105 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
106 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
107 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
108 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
109 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
110 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
111 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
112 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
114 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
115 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
116 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
117 2643221647 Streptomyces sp. Root369 Isolate Unclassified
118 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
119 2643221714 Streptomyces sp. Root264 Isolate Unclassified
120 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
121 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
122 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
123 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
124 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
125 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
126 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
127 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
128 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
129 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
130 2862574272 Streptomyces sp. AcE210 Isolate Nodule
131 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
132 2867428634 Streptomyces sp. RP5T Isolate Unclassified
133 2867475112 Streptomyces sp. TM32 Isolate Unclassified
134 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
135 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
136 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
137 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
138 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
139 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
140 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
141 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
142 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
143 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
144 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
145 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
146 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
147 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
148 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
149 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
150 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
151 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
152 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
153 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
154 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
155 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
156 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
157 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
158 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
159 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
160 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
161 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
162 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
163 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
164 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.92
Metatranscriptomes 0.7
Isolates 22.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.59
Nodule 1.4
Rhizoplane 0.7
Rhizosphere 77.97
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495636_0015981 3300047318 Bacteria 2994
2 Ga0006562J51391_1070988 3300003578 Bacteria 3100
3 Ga0075363_100053228 3300006048 Bacteria 2162
4 Ga0075367_10002899 3300006178 Bacteria 7988
5 Ga0099826_10093678 3300006948 Bacteria 1830
6 Ga0182008_10005073 3300014497 Bacteria 7565
7 Ga0182007_10001930 3300015262 Bacteria 10727
8 Ga0207426_1002124 3300025302 Bacteria 13572
9 Ga0207426_1005077 3300025302 Bacteria 6153
10 Ga0209813_10015335 3300027866 Bacteria 2074
11 Ga0307517_10004413 3300028786 Bacteria 21605
12 Ga0307515_10142849 3300028794 Bacteria 2556
13 Ga0307512_10003367 3300030522 Bacteria 18716
14 Ga0307512_10038672 3300030522 Bacteria 4010
15 Ga0307509_10284630 3300031507 Bacteria 1412
16 Ga0307508_10007809 3300031616 Bacteria 9934
17 Ga0307508_10025402 3300031616 Bacteria 5371
18 Ga0307508_10044100 3300031616 Bacteria 3991
19 Ga0307508_10046854 3300031616 Bacteria 3858
20 Ga0307508_10078241 3300031616 Bacteria 2887
21 Ga0307508_10132757 3300031616 Bacteria 2093
22 Ga0307516_10054977 3300031730 Bacteria 3888
23 Ga0307516_10068437 3300031730 Bacteria 3419
24 Ga0307507_10181415 3300033179 Bacteria 1504
25 Ga0307510_10025887 3300033180 Bacteria 6758
26 Ga0395900_0301964 3300037418 Bacteria 1587
27 Ga0395898_0009344 3300037466 Bacteria 10304
28 Ga0439436_0001191 3300041404 Bacteria 7387
29 Ga0439436_0029633 3300041404 Bacteria 1593
30 Ga0439439_0002769 3300041406 Bacteria 3778
31 Ga0439439_0005420 3300041406 Bacteria 2912
32 Ga0451853_0187254 3300041512 Bacteria 5001
33 Ga0451853_1814077 3300041512 Bacteria 20470
34 Ga0439433_0001184 3300041999 Bacteria 5356
35 Ga0439448_0003710 3300042005 Bacteria 4256
36 Ga0439449_0054462 3300042007 Bacteria 1478
37 Ga0439454_018462 3300042011 Bacteria 1006
38 Ga0439455_0008853 3300042012 Bacteria 2168
39 Ga0439457_000048 3300042014 Bacteria 25562
40 Ga0439457_003011 3300042014 Bacteria 4683
41 Ga0450894_000083 3300042131 Bacteria 15369
42 Ga0450898_002191 3300042134 Bacteria 2710
43 Ga0450899_002889 3300042135 Bacteria 1857
44 Ga0450903_001064 3300042138 Bacteria 5239
45 Ga0450903_004254 3300042138 Bacteria 2450
46 Ga0450906_001105 3300042145 Bacteria 5976
47 Ga0439458_0001588 3300042157 Bacteria 5673
48 Ga0439458_0002313 3300042157 Bacteria 4677
49 Ga0439458_0004246 3300042157 Bacteria 3306
50 Ga0466972_0002566 3300044658 Bacteria 8996
51 Ga0466966_0006920 3300044684 Bacteria 7513
52 Ga0466963_0000047 3300044694 Bacteria 40057
53 Ga0466971_0000079 3300044719 Bacteria 35332
54 Ga0466970_0000378 3300044765 Bacteria 21629
55 Ga0466957_0000062 3300044842 Bacteria 40831
56 Ga0466959_0000800 3300045049 Bacteria 18533
57 Ga0466958_0000122 3300045836 Bacteria 25398
58 Ga0466967_0000547 3300045976 Bacteria 18283
59 Ga0495617_043049 3300046452 Bacteria 1508
60 Ga0495592_0044412 3300046454 Bacteria 3321
61 Ga0495603_0000018 3300046455 Bacteria 65755
62 Ga0495603_0000021 3300046455 Bacteria 64285
63 Ga0495603_0000735 3300046455 Bacteria 18662
64 Ga0495603_0005228 3300046455 Bacteria 7747
65 Ga0495603_0007606 3300046455 Bacteria 6519
66 Ga0495603_0009793 3300046455 Bacteria 5798
67 Ga0495629_0002473 3300046459 Bacteria 14175
68 Ga0495629_0084795 3300046459 Bacteria 2210
69 Ga0495629_0164786 3300046459 Bacteria 1539
70 Ga0495629_0169768 3300046459 Bacteria 1514
71 Ga0495638_0072251 3300046460 Bacteria 2109
72 Ga0495638_0179106 3300046460 Bacteria 1211
73 Ga0495651_0091066 3300046462 Bacteria 2287
74 Ga0495651_0184781 3300046462 Bacteria 1472
75 Ga0495582_0087263 3300046473 Bacteria 1737
76 Ga0495582_0099323 3300046473 Bacteria 1629
77 Ga0495605_0001540 3300046474 Bacteria 14977
78 Ga0495605_0001650 3300046474 Bacteria 14342
79 Ga0495605_0086278 3300046474 Bacteria 1461
80 Ga0495662_0000293 3300046476 Bacteria 21638
81 Ga0495585_0013210 3300046492 Bacteria 4837
82 Ga0495585_0050802 3300046492 Bacteria 2299
83 Ga0495585_0119367 3300046492 Bacteria 1396
84 Ga0495585_0146196 3300046492 Bacteria 1235
85 Ga0495585_0165036 3300046492 Bacteria 1147
86 Ga0495594_0004773 3300046499 Bacteria 6980
87 Ga0495594_0007254 3300046499 Bacteria 5703
88 Ga0495594_0009337 3300046499 Bacteria 5066
89 Ga0495594_0010412 3300046499 Bacteria 4822
90 Ga0495594_0033549 3300046499 Bacteria 2791
91 Ga0495583_0008588 3300046506 Bacteria 6221
92 Ga0495583_0047901 3300046506 Bacteria 1963
93 Ga0495606_0009767 3300046507 Bacteria 8067
94 Ga0495606_0021317 3300046507 Bacteria 4747
95 Ga0495608_0206440 3300046511 Bacteria 1236
96 Ga0495616_0015496 3300046513 Bacteria 4239
97 Ga0495616_0017942 3300046513 Bacteria 3898
98 Ga0495618_0100575 3300046514 Bacteria 1850
99 Ga0495618_0128736 3300046514 Bacteria 1620
100 Ga0495620_0007501 3300046515 Bacteria 5914
101 Ga0495620_0022403 3300046515 Bacteria 3042
102 Ga0495620_0027161 3300046515 Bacteria 2682
103 Ga0495620_0038930 3300046515 Bacteria 2106
104 Ga0495628_0045883 3300046516 Bacteria 3473
105 Ga0495628_0058195 3300046516 Bacteria 3038
106 Ga0495628_0076100 3300046516 Bacteria 2612
107 Ga0495632_0063684 3300046519 Bacteria 1785
108 Ga0495643_0004855 3300046522 Bacteria 9261
109 Ga0495643_0017645 3300046522 Bacteria 4167
110 Ga0495648_0099409 3300046524 Bacteria 1610
111 Ga0495666_0007311 3300046526 Bacteria 5538
112 Ga0495666_0009020 3300046526 Bacteria 4989
113 Ga0495666_0043995 3300046526 Bacteria 2156
114 Ga0495652_0057542 3300046529 Bacteria 3296
115 Ga0495652_0285242 3300046529 Bacteria 1207
116 Ga0495640_0009030 3300046533 Bacteria 7780
117 Ga0495640_0016737 3300046533 Bacteria 5481
118 Ga0495597_0146209 3300046542 Bacteria 972
119 Ga0495622_0010096 3300046557 Bacteria 4369
120 Ga0495622_0013174 3300046557 Bacteria 3837
121 Ga0495622_0111665 3300046557 Bacteria 1251
122 Ga0495668_0013356 3300046616 Bacteria 4848
123 Ga0495668_0127588 3300046616 Bacteria 1392
124 Ga0495634_0028271 3300046642 Bacteria 3893
125 Ga0495634_0080911 3300046642 Bacteria 2125
126 Ga0495634_0099925 3300046642 Bacteria 1875
127 Ga0495611_0001285 3300046648 Bacteria 12841
128 Ga0495611_0019116 3300046648 Bacteria 2942
129 Ga0495611_0043354 3300046648 Bacteria 2011
130 Ga0495625_0012851 3300046660 Bacteria 6767
131 Ga0495625_0015711 3300046660 Bacteria 5982
132 Ga0495625_0254317 3300046660 Bacteria 1139
133 Ga0495635_0007877 3300046663 Bacteria 7441
134 Ga0495661_0084893 3300046665 Bacteria 1816
135 Ga0495657_0004869 3300046675 Bacteria 10690
136 Ga0495657_0020607 3300046675 Bacteria 4738
137 Ga0495657_0028951 3300046675 Bacteria 3888
138 Ga0495657_0064341 3300046675 Bacteria 2416
139 Ga0495599_0225669 3300046678 Bacteria 1145
140 Ga0495658_0014358 3300046683 Bacteria 4047
141 Ga0495613_0009012 3300046689 Bacteria 7403
142 Ga0495613_0014309 3300046689 Bacteria 5887
143 Ga0495613_0019893 3300046689 Bacteria 5003
144 Ga0495613_0024169 3300046689 Bacteria 4528
145 Ga0495613_0038852 3300046689 Bacteria 3528
146 Ga0495613_0042769 3300046689 Bacteria 3351
147 Ga0495613_0062792 3300046689 Bacteria 2718
148 Ga0495613_0106237 3300046689 Bacteria 2026
149 Ga0495613_0127072 3300046689 Bacteria 1827
150 Ga0495624_0126099 3300046690 Bacteria 1571
151 Ga0495624_0130995 3300046690 Bacteria 1537
152 Ga0495624_0169681 3300046690 Bacteria 1331
153 Ga0495649_0031799 3300046694 Bacteria 2909
154 Ga0495589_0004069 3300046794 Bacteria 7836
155 Ga0495589_0009610 3300046794 Bacteria 5029
156 Ga0495589_0025564 3300046794 Bacteria 2996
157 Ga0495589_0055285 3300046794 Bacteria 1956
158 Ga0495660_0008044 3300046810 Bacteria 6195
159 Ga0495660_0033642 3300046810 Bacteria 2872
160 Ga0495604_0009234 3300047317 Bacteria 7807
161 Ga0495604_0074930 3300047317 Bacteria 2549
162 Ga0495604_0082776 3300047317 Bacteria 2399
163 Ga0495636_0001584 3300047318 Bacteria 8653
164 Ga0495676_0000364 3300047321 Bacteria 37208
165 Ga0495676_0000390 3300047321 Bacteria 35506
166 Ga0495676_0002136 3300047321 Bacteria 17469
167 Ga0495676_0003851 3300047321 Bacteria 13647
168 Ga0495676_0008522 3300047321 Bacteria 9394
169 Ga0495676_0020554 3300047321 Bacteria 5788
170 Ga0495676_0040052 3300047321 Bacteria 3872
171 Ga0495676_0130902 3300047321 Bacteria 1811
172 Ga0495680_0009793 3300047322 Bacteria 8595
173 Ga0495680_0052770 3300047322 Bacteria 3168
174 Ga0495680_0514338 3300047322 Bacteria 811
175 Ga0495683_0001104 3300047323 Bacteria 18634
176 Ga0495683_0007627 3300047323 Bacteria 5826
177 Ga0495683_0058462 3300047323 Bacteria 1915
178 Ga0495683_0076396 3300047323 Bacteria 1639
179 Ga0495683_0088603 3300047323 Bacteria 1502
180 Ga0495687_005045 3300047443 Bacteria 8599
181 Ga0495687_007321 3300047443 Bacteria 6532
182 Ga0495687_011663 3300047443 Bacteria 4706
183 Ga0495687_015535 3300047443 Bacteria 3867
184 Ga0495687_019651 3300047443 Bacteria 3309
185 Ga0495687_041944 3300047443 Bacteria 2003
186 Ga0495687_054466 3300047443 Bacteria 1678
187 Ga0495687_064670 3300047443 Bacteria 1492
188 Ga0495687_116561 3300047443 Bacteria 971
189 Ga0495675_0007203 3300047444 Bacteria 6850
190 Ga0495677_0033119 3300047445 Bacteria 1883
191 Ga0495679_085386 3300047446 Bacteria 891
192 Ga0495685_003382 3300047447 Bacteria 5090
193 Ga0495685_004574 3300047447 Bacteria 4482
194 Ga0495685_005867 3300047447 Bacteria 4012
195 Ga0495685_013395 3300047447 Bacteria 2783
196 Ga0495685_018610 3300047447 Bacteria 2385
197 Ga0495681_0005191 3300047470 Bacteria 8755
198 Ga0495593_0114318 3300047673 Bacteria 1376
199 Ga0495593_0116080 3300047673 Bacteria 1364
200 Ga0495614_0002221 3300048089 Bacteria 8603
201 Ga0495614_0025958 3300048089 Bacteria 2525
202 Ga0495626_0012723 3300048091 Bacteria 4400
203 Ga0496109_0037665 3300048912 Bacteria 4370
204 Ga0501033_0000596 3300049570 Bacteria 33450
205 Ga0501033_0004066 3300049570 Bacteria 11810
206 Ga0501046_0051179 3300049580 Bacteria 3260
207 Ga0501044_0000552 3300049823 Bacteria 45539
208 Ga0501044_0171098 3300049823 Bacteria 2144
209 nmdc:mga04h51_65350_c1 3300050495 Bacteria 1257
210 Ga0500654_066866 3300053099 Bacteria 1786
211 Ga0500553_037385 3300053101 Bacteria 2397
212 Ga0500560_015979 3300053107 Bacteria 2038
213 Ga0500628_003361 3300053129 Bacteria 2641
214 Ga0500652_013731 3300053131 Bacteria 2878
215 Ga0500658_0016863 3300053134 Bacteria 2724
216 Ga0500561_0002616 3300053137 Bacteria 3050
217 Ga0500600_0020014 3300053149 Bacteria 4026
218 Ga0500616_0026306 3300053153 Bacteria 3221
219 Ga0500656_002681 3300053732 Bacteria 1625
220 Ga0587107_011507 3300059652 Bacteria 1085
221 Ga0466962_0001292 3300061719 Bacteria 11562
222 2585299503 2582581312 Bacteria 7308206
223 2616699610 2616644814 Bacteria 11555299
224 2616901033 2616644941 Bacteria 8510691
225 2644268456 2643221647 Bacteria 10741251
226 2644440382 2643221678 Bacteria 9540101
227 2644630753 2643221714 Bacteria 9015452
228 2785345141 2784746763 Bacteria 9783172
229 2786667428 2786546132 Bacteria 10419719
230 2786667444 2786546132 Bacteria 10419719
231 2808845940 2808606359 Bacteria 9866990
232 2808848847 2808606359 Bacteria 9866990
233 2808917656 2808606375 Bacteria 9466072
234 2811842386 2808606982 Bacteria 7791042
235 2811842435 2808606982 Bacteria 7791042
236 2812361395 2811994879 Bacteria 9313447
237 2812477284 2811994917 Bacteria 7761064
238 2819696749 2818991463 Bacteria 7948711
239 2862282174 2862281513 Bacteria 9621493
240 2862385958 2862382967 Bacteria 10317375
241 2862575521 2862574272 Bacteria 10567477
242 2863411023 2863404153 Bacteria 9672205
243 2863411039 2863404153 Bacteria 9672205
244 2867430189 2867428634 Bacteria 9590268
245 2867432749 2867428634 Bacteria 9590268
246 2867481375 2867475112 Bacteria 6909112
247 2877676626 2877676314 Bacteria 9512378
248 2912723621 2912715099 Bacteria 9460473
249 2912726680 2912723979 Bacteria 8557534
250 2912759604 2912757875 Bacteria 7940295
251 2919470789 2919468124 Bacteria 9133025
252 2946073067 2946072368 Bacteria 8999607
253 2947225067 2947224130 Bacteria 9938529
254 2954673581 2954673503 Bacteria 9685905
255 2954673597 2954673503 Bacteria 9685905
256 2954673618 2954673503 Bacteria 9685905
257 2954690372 2954682443 Bacteria 9862841
258 2954690393 2954682443 Bacteria 9862841
259 2954690409 2954682443 Bacteria 9862841
260 2954700942 2954691527 Bacteria 10720516
261 2954706397 2954701450 Bacteria 10834262
262 2954711980 2954711539 Bacteria 10867210
263 2954720137 2954711539 Bacteria 10867210
264 2954721919 2954721474 Bacteria 10456478
265 2954739933 2954731030 Bacteria 10243860
266 2954740813 2954740390 Bacteria 10229294
267 2954758753 2954749733 Bacteria 10366972
268 2954759821 2954759201 Bacteria 9358192
269 2966604644 2966598605 Bacteria 7676064
270 2966605336 2966598605 Bacteria 7676064
271 2997452363 2997451912 Bacteria 8492419
272 2997452769 2997451912 Bacteria 8492419
273 2997604802 2997600082 Bacteria 9896405
274 3006491927 3006486233 Bacteria 8157040
275 3006498493 3006493962 Bacteria 8825450
276 8008558897 8008558824 Bacteria 10610750
277 8025536864 8025530807 Bacteria 8495698
278 8047897716 8047893842 Bacteria 11723082
279 8048129762 8048127548 Bacteria 11053136
280 8048134484 8048127548 Bacteria 11053136
281 8048361155 8048356638 Bacteria 11044339
282 8048374702 8048369669 Bacteria 11666822
283 8048383520 8048379754 Bacteria 11877923
284 8048410967 8048406513 Bacteria 8936924
285 8056831336 8056829672 Bacteria 9045328
286 Ga0495636_0015981
287 Ga0006562J51391_1070988
288 Ga0075363_100053228
289 Ga0075367_10002899
290 Ga0099826_10093678
291 Ga0182008_10005073
292 Ga0182007_10001930
293 Ga0207426_1002124
294 Ga0207426_1005077
295 Ga0209813_10015335
296 Ga0307517_10004413
297 Ga0307515_10142849
298 Ga0307512_10003367
299 Ga0307512_10038672
300 Ga0307509_10284630
301 Ga0307508_10007809
302 Ga0307508_10025402
303 Ga0307508_10044100
304 Ga0307508_10046854
305 Ga0307508_10078241
306 Ga0307508_10132757
307 Ga0307516_10054977
308 Ga0307516_10068437
309 Ga0307507_10181415
310 Ga0307510_10025887
311 Ga0395900_0301964
312 Ga0395898_0009344
313 Ga0439436_0001191
314 Ga0439436_0029633
315 Ga0439439_0002769
316 Ga0439439_0005420
317 Ga0451853_0187254
318 Ga0451853_1814077
319 Ga0439433_0001184
320 Ga0439448_0003710
321 Ga0439449_0054462
322 Ga0439454_018462
323 Ga0439455_0008853
324 Ga0439457_000048
325 Ga0439457_003011
326 Ga0450894_000083
327 Ga0450898_002191
328 Ga0450899_002889
329 Ga0450903_001064
330 Ga0450903_004254
331 Ga0450906_001105
332 Ga0439458_0001588
333 Ga0439458_0002313
334 Ga0439458_0004246
335 Ga0466972_0002566
336 Ga0466966_0006920
337 Ga0466963_0000047
338 Ga0466971_0000079
339 Ga0466970_0000378
340 Ga0466957_0000062
341 Ga0466959_0000800
342 Ga0466958_0000122
343 Ga0466967_0000547
344 Ga0495617_043049
345 Ga0495592_0044412
346 Ga0495603_0000018
347 Ga0495603_0000021
348 Ga0495603_0000735
349 Ga0495603_0005228
350 Ga0495603_0007606
351 Ga0495603_0009793
352 Ga0495629_0002473
353 Ga0495629_0084795
354 Ga0495629_0164786
355 Ga0495629_0169768
356 Ga0495638_0072251
357 Ga0495638_0179106
358 Ga0495651_0091066
359 Ga0495651_0184781
360 Ga0495582_0087263
361 Ga0495582_0099323
362 Ga0495605_0001540
363 Ga0495605_0001650
364 Ga0495605_0086278
365 Ga0495662_0000293
366 Ga0495585_0013210
367 Ga0495585_0050802
368 Ga0495585_0119367
369 Ga0495585_0146196
370 Ga0495585_0165036
371 Ga0495594_0004773
372 Ga0495594_0007254
373 Ga0495594_0009337
374 Ga0495594_0010412
375 Ga0495594_0033549
376 Ga0495583_0008588
377 Ga0495583_0047901
378 Ga0495606_0009767
379 Ga0495606_0021317
380 Ga0495608_0206440
381 Ga0495616_0015496
382 Ga0495616_0017942
383 Ga0495618_0100575
384 Ga0495618_0128736
385 Ga0495620_0007501
386 Ga0495620_0022403
387 Ga0495620_0027161
388 Ga0495620_0038930
389 Ga0495628_0045883
390 Ga0495628_0058195
391 Ga0495628_0076100
392 Ga0495632_0063684
393 Ga0495643_0004855
394 Ga0495643_0017645
395 Ga0495648_0099409
396 Ga0495666_0007311
397 Ga0495666_0009020
398 Ga0495666_0043995
399 Ga0495652_0057542
400 Ga0495652_0285242
401 Ga0495640_0009030
402 Ga0495640_0016737
403 Ga0495597_0146209
404 Ga0495622_0010096
405 Ga0495622_0013174
406 Ga0495622_0111665
407 Ga0495668_0013356
408 Ga0495668_0127588
409 Ga0495634_0028271
410 Ga0495634_0080911
411 Ga0495634_0099925
412 Ga0495611_0001285
413 Ga0495611_0019116
414 Ga0495611_0043354
415 Ga0495625_0012851
416 Ga0495625_0015711
417 Ga0495625_0254317
418 Ga0495635_0007877
419 Ga0495661_0084893
420 Ga0495657_0004869
421 Ga0495657_0020607
422 Ga0495657_0028951
423 Ga0495657_0064341
424 Ga0495599_0225669
425 Ga0495658_0014358
426 Ga0495613_0009012
427 Ga0495613_0014309
428 Ga0495613_0019893
429 Ga0495613_0024169
430 Ga0495613_0038852
431 Ga0495613_0042769
432 Ga0495613_0062792
433 Ga0495613_0106237
434 Ga0495613_0127072
435 Ga0495624_0126099
436 Ga0495624_0130995
437 Ga0495624_0169681
438 Ga0495649_0031799
439 Ga0495589_0004069
440 Ga0495589_0009610
441 Ga0495589_0025564
442 Ga0495589_0055285
443 Ga0495660_0008044
444 Ga0495660_0033642
445 Ga0495604_0009234
446 Ga0495604_0074930
447 Ga0495604_0082776
448 Ga0495636_0001584
449 Ga0495676_0000364
450 Ga0495676_0000390
451 Ga0495676_0002136
452 Ga0495676_0003851
453 Ga0495676_0008522
454 Ga0495676_0020554
455 Ga0495676_0040052
456 Ga0495676_0130902
457 Ga0495680_0009793
458 Ga0495680_0052770
459 Ga0495680_0514338
460 Ga0495683_0001104
461 Ga0495683_0007627
462 Ga0495683_0058462
463 Ga0495683_0076396
464 Ga0495683_0088603
465 Ga0495687_005045
466 Ga0495687_007321
467 Ga0495687_011663
468 Ga0495687_015535
469 Ga0495687_019651
470 Ga0495687_041944
471 Ga0495687_054466
472 Ga0495687_064670
473 Ga0495687_116561
474 Ga0495675_0007203
475 Ga0495677_0033119
476 Ga0495679_085386
477 Ga0495685_003382
478 Ga0495685_004574
479 Ga0495685_005867
480 Ga0495685_013395
481 Ga0495685_018610
482 Ga0495681_0005191
483 Ga0495593_0114318
484 Ga0495593_0116080
485 Ga0495614_0002221
486 Ga0495614_0025958
487 Ga0495626_0012723
488 Ga0496109_0037665
489 Ga0501033_0000596
490 Ga0501033_0004066
491 Ga0501046_0051179
492 Ga0501044_0000552
493 Ga0501044_0171098
494 nmdc:mga04h51_65350_c1
495 Ga0500654_066866
496 Ga0500553_037385
497 Ga0500560_015979
498 Ga0500628_003361
499 Ga0500652_013731
500 Ga0500658_0016863
501 Ga0500561_0002616
502 Ga0500600_0020014
503 Ga0500616_0026306
504 Ga0500656_002681
505 Ga0587107_011507
506 Ga0466962_0001292
507 2585299503
508 2616699610
509 2616901033
510 2644268456
511 2644440382
512 2644630753
513 2785345141
514 2786667428
515 2786667444
516 2808845940
517 2808848847
518 2808917656
519 2811842386
520 2811842435
521 2812361395
522 2812477284
523 2819696749
524 2862282174
525 2862385958
526 2862575521
527 2863411023
528 2863411039
529 2867430189
530 2867432749
531 2867481375
532 2877676626
533 2912723621
534 2912726680
535 2912759604
536 2919470789
537 2946073067
538 2947225067
539 2954673581
540 2954673597
541 2954673618
542 2954690372
543 2954690393
544 2954690409
545 2954700942
546 2954706397
547 2954711980
548 2954720137
549 2954721919
550 2954739933
551 2954740813
552 2954758753
553 2954759821
554 2966604644
555 2966605336
556 2997452363
557 2997452769
558 2997604802
559 3006491927
560 3006498493
561 8008558897
562 8025536864
563 8047897716
564 8048129762
565 8048134484
566 8048361155
567 8048374702
568 8048383520
569 8048410967
570 8056831336

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00582

Usp

Universal stress protein family

193

330

0.93

PF00582

Usp

Universal stress protein family

48

177

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ab7-assembly3.cif.gz_B crystal structure of the hypothetical tandem-type universal stress protein ttha0350 from thermus thermophilus hb8 0.8439 4 286
3ab7-assembly2.cif.gz_A crystal structure of the hypothetical tandem-type universal stress protein ttha0350 from thermus thermophilus hb8 0.8347 4 286
3ab7-assembly3.cif.gz_B crystal structure of the hypothetical tandem-type universal stress protein ttha0350 from thermus thermophilus hb8 0.8338 4 286
3ab7-assembly2.cif.gz_A crystal structure of the hypothetical tandem-type universal stress protein ttha0350 from thermus thermophilus hb8 0.8251 4 286
2jax-assembly1.cif.gz_A-2 universal stress protein rv2623 from mycobaterium tuberculosis 0.8224 4 288
ID Description Score Start End Superfamily
af_P9WFD3_147_254_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8769 150 245 3.40.50.620
af_P9WFD5_3_145_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8212 1 141 3.40.50.620
5ahwB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8211 2 138 3.40.50.620
2jaxA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8128 150 288 3.40.50.620
af_Q2FXM1_1_137_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8059 151 286 3.40.50.620
ID Description Score Start End GO Terms
AF-C9Z3E1-F1-model_v4 UspA domain-containing protein 0.9622 1 289
AF-C9Z3E1-F1-model_v4 UspA domain-containing protein 0.9589 1 289
AF-A0A6B2S4A4-F1-model_v4 Universal stress protein 0.9293 64 289
AF-A0A3N6D4Z9-F1-model_v4 deleted 0.929 103 289
AF-A0A3N6GXL5-F1-model_v4 Universal stress protein 0.9287 101 289

Map