F387507

General Info

Members Datasets Scaffolds Average Seq Length
286 169 572 196

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100131916|Ga0307409_1001319162
Length 220
Sequence VAYSIVVVGASWGGLHALGLLVGGLPAGFALPMAIVQHRSKDSDHGLLARLLQDQTQLPVSEVEDKEPIEPGRVYVAPPDYHLLVDGAHFSLTVDPPVRFSRPSIDVTFVSAAASCGAGTVGVVLTGANEDGAFGLRHIADQGGYAVVQDPETAEIRTMPAAARRAVPTAVVLPIESIAGHLAALASGVAGPQPVGRRLRGDRAVPGGLGAAHGEREGRP

Samples

Sample ID Description Type Environment
1 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
120 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
121 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
136 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
137 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
138 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
141 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
142 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
143 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
144 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
148 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
149 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
152 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
167 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.9
Metatranscriptomes 2.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.4
Rhizosphere 96.85
Stem 0
Stem Tuber 0
Unclassified 4.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307409_100131916 3300031995 Bacteria 2137
2 MBSR1b_contig_4141901 2162886012 Bacteria 1231
3 Ga0058863_10158047 3300004799 Bacteria 3218
4 Ga0070676_10248383 3300005328 Unclassified 1186
5 Ga0070683_100001117 3300005329 Bacteria 20278
6 Ga0070683_100002035 3300005329 Bacteria 15917
7 Ga0070683_100005254 3300005329 Bacteria 10782
8 Ga0070683_100089201 3300005329 Bacteria 2894
9 Ga0070670_100001420 3300005331 Bacteria 19251
10 Ga0068869_100000949 3300005334 Bacteria 16803
11 Ga0070680_100000032 3300005336 Bacteria 72004
12 Ga0070680_100000557 3300005336 Bacteria 25516
13 Ga0070680_100004226 3300005336 Bacteria 10775
14 Ga0070682_100001287 3300005337 Bacteria 14220
15 Ga0070682_100001494 3300005337 Bacteria 13112
16 Ga0068868_100077473 3300005338 Bacteria 2659
17 Ga0070689_100057300 3300005340 Bacteria 3024
18 Ga0070691_10035214 3300005341 Bacteria 2357
19 Ga0070687_100016481 3300005343 Bacteria 3372
20 Ga0070661_100002594 3300005344 Bacteria 12390
21 Ga0070692_10011360 3300005345 Bacteria 4085
22 Ga0070669_100080735 3300005353 Bacteria 2421
23 Ga0070675_100004381 3300005354 Bacteria 10772
24 Ga0070675_100201151 3300005354 Bacteria 1729
25 Ga0070671_100589164 3300005355 Bacteria 961
26 Ga0070673_100051563 3300005364 Bacteria 3224
27 Ga0070659_100000921 3300005366 Bacteria 21552
28 Ga0070667_101089176 3300005367 Unclassified 747
29 Ga0070713_100169685 3300005436 Bacteria 1954
30 Ga0070711_100342362 3300005439 Bacteria 1200
31 Ga0070694_100087914 3300005444 Bacteria 2175
32 Ga0070662_100004446 3300005457 Bacteria 8865
33 Ga0070662_100298118 3300005457 Bacteria 1309
34 Ga0070662_100396238 3300005457 Bacteria 1139
35 Ga0070681_10012480 3300005458 Bacteria 8430
36 Ga0070681_10035774 3300005458 Bacteria 4988
37 Ga0070681_10114691 3300005458 Bacteria 2633
38 Ga0070681_10353428 3300005458 Bacteria 1380
39 Ga0070681_10407107 3300005458 Bacteria 1272
40 Ga0070707_100598327 3300005468 Bacteria 1065
41 Ga0070698_100053367 3300005471 Bacteria 4108
42 Ga0070698_100185294 3300005471 Bacteria 2019
43 Ga0070698_100372621 3300005471 Bacteria 1360
44 Ga0070679_100001121 3300005530 Bacteria 23370
45 Ga0070679_100014384 3300005530 Bacteria 7600
46 Ga0070679_100018742 3300005530 Bacteria 6718
47 Ga0070679_100021717 3300005530 Bacteria 6269
48 Ga0070679_100275133 3300005530 Bacteria 1637
49 Ga0070684_100016231 3300005535 Bacteria 6082
50 Ga0070684_100026402 3300005535 Bacteria 4892
51 Ga0070684_100148410 3300005535 Bacteria 2123
52 Ga0070684_100382493 3300005535 Bacteria 1296
53 Ga0068853_100005783 3300005539 Bacteria 9742
54 Ga0068853_100054671 3300005539 Bacteria 3441
55 Ga0070672_100069557 3300005543 Bacteria 2795
56 Ga0070695_100173100 3300005545 Bacteria 1524
57 Ga0070696_100217163 3300005546 Bacteria 1433
58 Ga0070693_100005180 3300005547 Bacteria 6236
59 Ga0068855_100013502 3300005563 Bacteria 9847
60 Ga0068855_100022634 3300005563 Bacteria 7530
61 Ga0068855_100265904 3300005563 Bacteria 1909
62 Ga0068855_100359725 3300005563 Bacteria 1602
63 Ga0070664_100019295 3300005564 Bacteria 5609
64 Ga0070664_100030171 3300005564 Bacteria 4523
65 Ga0070664_100241641 3300005564 Bacteria 1621
66 Ga0070664_100336096 3300005564 Bacteria 1371
67 Ga0070664_100449346 3300005564 Bacteria 1183
68 Ga0068857_100009910 3300005577 Bacteria 8269
69 Ga0068856_100010408 3300005614 Bacteria 9033
70 Ga0068856_100036422 3300005614 Bacteria 4824
71 Ga0068856_100182082 3300005614 Bacteria 2114
72 Ga0068856_100775653 3300005614 Bacteria 979
73 Ga0070702_100006459 3300005615 Bacteria 5550
74 Ga0068852_100009123 3300005616 Bacteria 7344
75 Ga0068852_100299240 3300005616 Bacteria 1557
76 Ga0068859_100031961 3300005617 Bacteria 5288
77 Ga0068859_100393954 3300005617 Bacteria 1481
78 Ga0068864_100015485 3300005618 Bacteria 6340
79 Ga0068863_100005513 3300005841 Bacteria 12448
80 Ga0068858_100073813 3300005842 Bacteria 3167
81 Ga0068858_100813806 3300005842 Bacteria 912
82 Ga0068860_100058684 3300005843 Bacteria 3658
83 Ga0068862_100248221 3300005844 Bacteria 1621
84 Ga0097621_100012746 3300006237 Bacteria 6246
85 Ga0068871_100064383 3300006358 Bacteria 3002
86 Ga0097620_100031958 3300006931 Bacteria 5288
87 Ga0097620_100393930 3300006931 Bacteria 1481
88 Ga0105240_10004797 3300009093 Bacteria 20382
89 Ga0105240_10038221 3300009093 Bacteria 6158
90 Ga0105245_10003093 3300009098 Bacteria 14891
91 Ga0105245_10009602 3300009098 Bacteria 8438
92 Ga0105241_10004633 3300009174 Bacteria 10169
93 Ga0105241_10016523 3300009174 Bacteria 5412
94 Ga0105242_10009792 3300009176 Bacteria 7346
95 Ga0105242_10042300 3300009176 Bacteria 3678
96 Ga0105248_10015009 3300009177 Bacteria 8528
97 Ga0105248_10489950 3300009177 Unclassified 1386
98 Ga0105238_10362669 3300009551 Bacteria 1439
99 Ga0105238_10611223 3300009551 Bacteria 1098
100 Ga0105249_10049252 3300009553 Bacteria 3842
101 Ga0105249_10427687 3300009553 Bacteria 1359
102 Ga0105239_10010616 3300010375 Bacteria 10302
103 Ga0105239_10758776 3300010375 Bacteria 1110
104 Ga0105246_10000547 3300011119 Bacteria 20697
105 Ga0157373_10387361 3300013100 Bacteria 1000
106 Ga0157371_10007618 3300013102 Bacteria 8733
107 Ga0157370_10002126 3300013104 Bacteria 24195
108 Ga0157370_10018717 3300013104 Bacteria 6964
109 Ga0157370_10472652 3300013104 Bacteria 1152
110 Ga0157369_10046697 3300013105 Bacteria 4706
111 Ga0157369_10134739 3300013105 Bacteria 2615
112 Ga0157369_10279671 3300013105 Bacteria 1738
113 Ga0157369_10455034 3300013105 Bacteria 1325
114 Ga0157369_10772791 3300013105 Bacteria 988
115 Ga0157374_10002862 3300013296 Bacteria 14486
116 Ga0157374_10503510 3300013296 Unclassified 1216
117 Ga0157374_10982538 3300013296 Unclassified 863
118 Ga0157372_10002707 3300013307 Bacteria 19163
119 Ga0157372_10008099 3300013307 Bacteria 11179
120 Ga0157372_10049284 3300013307 Bacteria 4683
121 Ga0157372_10074948 3300013307 Bacteria 3817
122 Ga0157372_10619160 3300013307 Unclassified 1262
123 Ga0157375_10069037 3300013308 Bacteria 3539
124 Ga0157375_10706335 3300013308 Bacteria 1162
125 Ga0163163_10007796 3300014325 Bacteria 9463
126 Ga0157377_10018686 3300014745 Bacteria 3607
127 Ga0157376_10016851 3300014969 Bacteria 5559
128 Ga0157376_10575569 3300014969 Bacteria 1118
129 Ga0206352_10341639 3300020078 Bacteria 974
130 Ga0206352_10897303 3300020078 Bacteria 1220
131 Ga0206353_10244573 3300020082 Bacteria 2076
132 Ga0213876_10011654 3300021384 Bacteria 4694
133 Ga0207643_10023400 3300025908 Bacteria 3405
134 Ga0207705_10026068 3300025909 Bacteria 4171
135 Ga0207654_10069789 3300025911 Unclassified 2084
136 Ga0207707_10000611 3300025912 Bacteria 35815
137 Ga0207707_10018649 3300025912 Bacteria 6050
138 Ga0207707_10024076 3300025912 Bacteria 5324
139 Ga0207707_10089904 3300025912 Bacteria 2683
140 Ga0207707_10451199 3300025912 Bacteria 1100
141 Ga0207695_10011954 3300025913 Bacteria 10452
142 Ga0207695_10133403 3300025913 Bacteria 2439
143 Ga0207660_10000094 3300025917 Bacteria 48704
144 Ga0207660_10045868 3300025917 Unclassified 3081
145 Ga0207660_10070012 3300025917 Bacteria 2549
146 Ga0207662_10260892 3300025918 Bacteria 1141
147 Ga0207652_10001504 3300025921 Bacteria 20575
148 Ga0207652_10003334 3300025921 Bacteria 13284
149 Ga0207652_10009983 3300025921 Bacteria 7643
150 Ga0207652_10010040 3300025921 Bacteria 7625
151 Ga0207652_10064172 3300025921 Bacteria 3178
152 Ga0207652_10087594 3300025921 Bacteria 2731
153 Ga0207652_10536192 3300025921 Bacteria 1052
154 Ga0207646_10135294 3300025922 Bacteria 2219
155 Ga0207694_10314801 3300025924 Bacteria 1291
156 Ga0207650_10002943 3300025925 Bacteria 11751
157 Ga0207659_10015364 3300025926 Bacteria 4958
158 Ga0207659_10484410 3300025926 Bacteria 1045
159 Ga0207687_10034410 3300025927 Bacteria 3440
160 Ga0207700_10139517 3300025928 Bacteria 1990
161 Ga0207644_10512654 3300025931 Bacteria 990
162 Ga0207690_10482620 3300025932 Bacteria 1000
163 Ga0207706_10002855 3300025933 Bacteria 16771
164 Ga0207686_10023219 3300025934 Bacteria 3580
165 Ga0207686_10050741 3300025934 Bacteria 2581
166 Ga0207670_10026465 3300025936 Bacteria 3655
167 Ga0207691_10066347 3300025940 Bacteria 3265
168 Ga0207711_10254986 3300025941 Bacteria 1612
169 Ga0207689_10000867 3300025942 Bacteria 29208
170 Ga0207661_10002337 3300025944 Bacteria 13061
171 Ga0207661_10002785 3300025944 Bacteria 12050
172 Ga0207661_10018827 3300025944 Bacteria 5138
173 Ga0207661_10038957 3300025944 Bacteria 3728
174 Ga0207661_10039992 3300025944 Bacteria 3684
175 Ga0207679_10086426 3300025945 Bacteria 2412
176 Ga0207679_10466718 3300025945 Bacteria 1122
177 Ga0207667_10032607 3300025949 Bacteria 5611
178 Ga0207667_10254976 3300025949 Bacteria 1794
179 Ga0207667_10298419 3300025949 Bacteria 1646
180 Ga0207651_10034936 3300025960 Bacteria 3262
181 Ga0207712_10069068 3300025961 Bacteria 2534
182 Ga0207712_10928608 3300025961 Unclassified 770
183 Ga0207677_10487262 3300026023 Bacteria 1063
184 Ga0207703_10038865 3300026035 Bacteria 3801
185 Ga0207639_10471890 3300026041 Bacteria 1142
186 Ga0207702_10003913 3300026078 Bacteria 13407
187 Ga0207702_10026657 3300026078 Bacteria 4798
188 Ga0207702_10270653 3300026078 Bacteria 1602
189 Ga0207641_10005310 3300026088 Bacteria 11002
190 Ga0207648_10161593 3300026089 Bacteria 1978
191 Ga0207674_10000949 3300026116 Bacteria 37834
192 Ga0207698_10005614 3300026142 Bacteria 7766
193 Ga0207698_10042383 3300026142 Bacteria 3400
194 Ga0307408_100084406 3300031548 Bacteria 2382
195 Ga0307405_10004532 3300031731 Bacteria 6579
196 Ga0307413_10009680 3300031824 Bacteria 4626
197 Ga0307410_10007930 3300031852 Bacteria 5852
198 Ga0307406_10026045 3300031901 Bacteria 3507
199 Ga0307407_10002709 3300031903 Bacteria 7029
200 Ga0307407_10273256 3300031903 Bacteria 1167
201 Ga0307412_10041015 3300031911 Bacteria 2997
202 Ga0307412_10345810 3300031911 Bacteria 1192
203 Ga0307409_100246599 3300031995 Bacteria 1630
204 Ga0307416_100003955 3300032002 Bacteria 8830
205 Ga0307416_100094379 3300032002 Bacteria 2580
206 Ga0307416_100207998 3300032002 Bacteria 1864
207 Ga0307416_100795364 3300032002 Bacteria 1041
208 Ga0307414_10056482 3300032004 Bacteria 2754
209 Ga0307411_10209960 3300032005 Bacteria 1502
210 Ga0307415_100011304 3300032126 Bacteria 5103
211 Ga0307415_100023996 3300032126 Bacteria 3799
212 Ga0307415_100798929 3300032126 Bacteria 861
213 Ga0373953_0011603 3300035117 Bacteria 3098
214 Ga0373956_0069789 3300035119 Bacteria 1602
215 Ga0373960_0021986 3300035121 Bacteria 1703
216 Ga0373955_0002613 3300035172 Bacteria 7880
217 Ga0373955_0565225 3300035172 Bacteria 696
218 Ga0373931_0043164 3300035691 Bacteria 2373
219 Ga0373927_0015206 3300035695 Bacteria 5087
220 Ga0373927_0070294 3300035695 Bacteria 2266
221 Ga0373933_0011335 3300035724 Bacteria 4910
222 Ga0373947_0106618 3300035725 Bacteria 1766
223 Ga0373937_0000687 3300036401 Bacteria 29453
224 Ga0373925_0294430 3300037068 Bacteria 1309
225 Ga0436364_0733412 3300037853 Bacteria 1300
226 Ga0436365_0861446 3300039437 Bacteria 3921
227 Ga0436365_0989637 3300039437 Bacteria 752
228 Ga0436365_1292688 3300039437 Bacteria 1023
229 Ga0451576_0032443 3300045051 Bacteria 5561
230 Ga0466967_0014238 3300045976 Bacteria 6187
231 Ga0495629_0003893 3300046459 Bacteria 11237
232 Ga0495629_0096598 3300046459 Bacteria 2061
233 Ga0495580_0236415 3300046472 Bacteria 1253
234 Ga0495582_0017360 3300046473 Bacteria 3938
235 Ga0495639_0010308 3300046475 Bacteria 4021
236 Ga0495639_0167453 3300046475 Bacteria 1066
237 Ga0495639_0186870 3300046475 Bacteria 1010
238 Ga0495594_0177247 3300046499 Bacteria 1213
239 Ga0495628_0059983 3300046516 Bacteria 2986
240 Ga0495628_0511254 3300046516 Bacteria 866
241 Ga0495630_0016849 3300046517 Bacteria 5346
242 Ga0495630_0054537 3300046517 Bacteria 2995
243 Ga0495666_0286165 3300046526 Bacteria 747
244 Ga0495665_0069920 3300046531 Bacteria 1850
245 Ga0495640_0357399 3300046533 Bacteria 901
246 Ga0495586_0011057 3300046535 Bacteria 4795
247 Ga0495586_0024407 3300046535 Bacteria 3232
248 Ga0495586_0405434 3300046535 Unclassified 785
249 Ga0495587_0003213 3300046536 Bacteria 10923
250 Ga0495587_0229996 3300046536 Bacteria 1045
251 Ga0495587_0400614 3300046536 Unclassified 763
252 Ga0495645_0000061 3300046543 Bacteria 79047
253 Ga0495645_0014143 3300046543 Bacteria 5657
254 Ga0495645_0227584 3300046543 Bacteria 1251
255 Ga0495645_0268408 3300046543 Bacteria 1127
256 Ga0495667_0011805 3300046559 Bacteria 5917
257 Ga0495659_0084812 3300046664 Bacteria 1208
258 Ga0495588_0177103 3300046674 Bacteria 1127
259 Ga0495657_0080008 3300046675 Bacteria 2116
260 Ga0495599_0004862 3300046678 Bacteria 7994
261 Ga0495658_0044829 3300046683 Bacteria 2479
262 Ga0495658_0110243 3300046683 Bacteria 1654
263 Ga0495581_0008141 3300047315 Bacteria 6071
264 Ga0495581_0009780 3300047315 Bacteria 5548
265 Ga0495581_0131897 3300047315 Bacteria 1456
266 Ga0495674_0179454 3300047319 Bacteria 1764
267 Ga0495674_0862725 3300047319 Unclassified 701
268 Ga0495672_0006726 3300047320 Bacteria 8824
269 Ga0495675_0001894 3300047444 Bacteria 12465
270 Ga0495675_0174254 3300047444 Bacteria 1320
271 Ga0495684_0053439 3300047471 Bacteria 3082
272 Ga0495593_0071993 3300047673 Bacteria 1795
273 Ga0495593_0431055 3300047673 Bacteria 660
274 Ga0495602_0184276 3300048088 Bacteria 1607
275 Ga0496104_0156613 3300048907 Bacteria 2186
276 Ga0496109_0245607 3300048912 Bacteria 1685
277 Ga0496112_0099442 3300048915 Bacteria 2878
278 Ga0496113_0024245 3300048916 Bacteria 4309
279 Ga0501067_0417925 3300049583 Bacteria 748
280 Ga0501044_1236790 3300049823 Bacteria 614
281 nmdc:mga0rr50_671104_c1 3300050513 Bacteria 884
282 Ga0495601_0027698 3300053077 Bacteria 3505
283 Ga0495601_0306844 3300053077 Bacteria 1034
284 Ga0587088_010437 3300059508 Bacteria 1361
285 Ga0587128_040668 3300059630 Bacteria 812
286 Ga0530510_0165490 3300061734 Bacteria 1637
287 Ga0307409_100131916
288 MBSR1b_contig_4141901
289 Ga0058863_10158047
290 Ga0070676_10248383
291 Ga0070683_100001117
292 Ga0070683_100002035
293 Ga0070683_100005254
294 Ga0070683_100089201
295 Ga0070670_100001420
296 Ga0068869_100000949
297 Ga0070680_100000032
298 Ga0070680_100000557
299 Ga0070680_100004226
300 Ga0070682_100001287
301 Ga0070682_100001494
302 Ga0068868_100077473
303 Ga0070689_100057300
304 Ga0070691_10035214
305 Ga0070687_100016481
306 Ga0070661_100002594
307 Ga0070692_10011360
308 Ga0070669_100080735
309 Ga0070675_100004381
310 Ga0070675_100201151
311 Ga0070671_100589164
312 Ga0070673_100051563
313 Ga0070659_100000921
314 Ga0070667_101089176
315 Ga0070713_100169685
316 Ga0070711_100342362
317 Ga0070694_100087914
318 Ga0070662_100004446
319 Ga0070662_100298118
320 Ga0070662_100396238
321 Ga0070681_10012480
322 Ga0070681_10035774
323 Ga0070681_10114691
324 Ga0070681_10353428
325 Ga0070681_10407107
326 Ga0070707_100598327
327 Ga0070698_100053367
328 Ga0070698_100185294
329 Ga0070698_100372621
330 Ga0070679_100001121
331 Ga0070679_100014384
332 Ga0070679_100018742
333 Ga0070679_100021717
334 Ga0070679_100275133
335 Ga0070684_100016231
336 Ga0070684_100026402
337 Ga0070684_100148410
338 Ga0070684_100382493
339 Ga0068853_100005783
340 Ga0068853_100054671
341 Ga0070672_100069557
342 Ga0070695_100173100
343 Ga0070696_100217163
344 Ga0070693_100005180
345 Ga0068855_100013502
346 Ga0068855_100022634
347 Ga0068855_100265904
348 Ga0068855_100359725
349 Ga0070664_100019295
350 Ga0070664_100030171
351 Ga0070664_100241641
352 Ga0070664_100336096
353 Ga0070664_100449346
354 Ga0068857_100009910
355 Ga0068856_100010408
356 Ga0068856_100036422
357 Ga0068856_100182082
358 Ga0068856_100775653
359 Ga0070702_100006459
360 Ga0068852_100009123
361 Ga0068852_100299240
362 Ga0068859_100031961
363 Ga0068859_100393954
364 Ga0068864_100015485
365 Ga0068863_100005513
366 Ga0068858_100073813
367 Ga0068858_100813806
368 Ga0068860_100058684
369 Ga0068862_100248221
370 Ga0097621_100012746
371 Ga0068871_100064383
372 Ga0097620_100031958
373 Ga0097620_100393930
374 Ga0105240_10004797
375 Ga0105240_10038221
376 Ga0105245_10003093
377 Ga0105245_10009602
378 Ga0105241_10004633
379 Ga0105241_10016523
380 Ga0105242_10009792
381 Ga0105242_10042300
382 Ga0105248_10015009
383 Ga0105248_10489950
384 Ga0105238_10362669
385 Ga0105238_10611223
386 Ga0105249_10049252
387 Ga0105249_10427687
388 Ga0105239_10010616
389 Ga0105239_10758776
390 Ga0105246_10000547
391 Ga0157373_10387361
392 Ga0157371_10007618
393 Ga0157370_10002126
394 Ga0157370_10018717
395 Ga0157370_10472652
396 Ga0157369_10046697
397 Ga0157369_10134739
398 Ga0157369_10279671
399 Ga0157369_10455034
400 Ga0157369_10772791
401 Ga0157374_10002862
402 Ga0157374_10503510
403 Ga0157374_10982538
404 Ga0157372_10002707
405 Ga0157372_10008099
406 Ga0157372_10049284
407 Ga0157372_10074948
408 Ga0157372_10619160
409 Ga0157375_10069037
410 Ga0157375_10706335
411 Ga0163163_10007796
412 Ga0157377_10018686
413 Ga0157376_10016851
414 Ga0157376_10575569
415 Ga0206352_10341639
416 Ga0206352_10897303
417 Ga0206353_10244573
418 Ga0213876_10011654
419 Ga0207643_10023400
420 Ga0207705_10026068
421 Ga0207654_10069789
422 Ga0207707_10000611
423 Ga0207707_10018649
424 Ga0207707_10024076
425 Ga0207707_10089904
426 Ga0207707_10451199
427 Ga0207695_10011954
428 Ga0207695_10133403
429 Ga0207660_10000094
430 Ga0207660_10045868
431 Ga0207660_10070012
432 Ga0207662_10260892
433 Ga0207652_10001504
434 Ga0207652_10003334
435 Ga0207652_10009983
436 Ga0207652_10010040
437 Ga0207652_10064172
438 Ga0207652_10087594
439 Ga0207652_10536192
440 Ga0207646_10135294
441 Ga0207694_10314801
442 Ga0207650_10002943
443 Ga0207659_10015364
444 Ga0207659_10484410
445 Ga0207687_10034410
446 Ga0207700_10139517
447 Ga0207644_10512654
448 Ga0207690_10482620
449 Ga0207706_10002855
450 Ga0207686_10023219
451 Ga0207686_10050741
452 Ga0207670_10026465
453 Ga0207691_10066347
454 Ga0207711_10254986
455 Ga0207689_10000867
456 Ga0207661_10002337
457 Ga0207661_10002785
458 Ga0207661_10018827
459 Ga0207661_10038957
460 Ga0207661_10039992
461 Ga0207679_10086426
462 Ga0207679_10466718
463 Ga0207667_10032607
464 Ga0207667_10254976
465 Ga0207667_10298419
466 Ga0207651_10034936
467 Ga0207712_10069068
468 Ga0207712_10928608
469 Ga0207677_10487262
470 Ga0207703_10038865
471 Ga0207639_10471890
472 Ga0207702_10003913
473 Ga0207702_10026657
474 Ga0207702_10270653
475 Ga0207641_10005310
476 Ga0207648_10161593
477 Ga0207674_10000949
478 Ga0207698_10005614
479 Ga0207698_10042383
480 Ga0307408_100084406
481 Ga0307405_10004532
482 Ga0307413_10009680
483 Ga0307410_10007930
484 Ga0307406_10026045
485 Ga0307407_10002709
486 Ga0307407_10273256
487 Ga0307412_10041015
488 Ga0307412_10345810
489 Ga0307409_100246599
490 Ga0307416_100003955
491 Ga0307416_100094379
492 Ga0307416_100207998
493 Ga0307416_100795364
494 Ga0307414_10056482
495 Ga0307411_10209960
496 Ga0307415_100011304
497 Ga0307415_100023996
498 Ga0307415_100798929
499 Ga0373953_0011603
500 Ga0373956_0069789
501 Ga0373960_0021986
502 Ga0373955_0002613
503 Ga0373955_0565225
504 Ga0373931_0043164
505 Ga0373927_0015206
506 Ga0373927_0070294
507 Ga0373933_0011335
508 Ga0373947_0106618
509 Ga0373937_0000687
510 Ga0373925_0294430
511 Ga0436364_0733412
512 Ga0436365_0861446
513 Ga0436365_0989637
514 Ga0436365_1292688
515 Ga0451576_0032443
516 Ga0466967_0014238
517 Ga0495629_0003893
518 Ga0495629_0096598
519 Ga0495580_0236415
520 Ga0495582_0017360
521 Ga0495639_0010308
522 Ga0495639_0167453
523 Ga0495639_0186870
524 Ga0495594_0177247
525 Ga0495628_0059983
526 Ga0495628_0511254
527 Ga0495630_0016849
528 Ga0495630_0054537
529 Ga0495666_0286165
530 Ga0495665_0069920
531 Ga0495640_0357399
532 Ga0495586_0011057
533 Ga0495586_0024407
534 Ga0495586_0405434
535 Ga0495587_0003213
536 Ga0495587_0229996
537 Ga0495587_0400614
538 Ga0495645_0000061
539 Ga0495645_0014143
540 Ga0495645_0227584
541 Ga0495645_0268408
542 Ga0495667_0011805
543 Ga0495659_0084812
544 Ga0495588_0177103
545 Ga0495657_0080008
546 Ga0495599_0004862
547 Ga0495658_0044829
548 Ga0495658_0110243
549 Ga0495581_0008141
550 Ga0495581_0009780
551 Ga0495581_0131897
552 Ga0495674_0179454
553 Ga0495674_0862725
554 Ga0495672_0006726
555 Ga0495675_0001894
556 Ga0495675_0174254
557 Ga0495684_0053439
558 Ga0495593_0071993
559 Ga0495593_0431055
560 Ga0495602_0184276
561 Ga0496104_0156613
562 Ga0496109_0245607
563 Ga0496112_0099442
564 Ga0496113_0024245
565 Ga0501067_0417925
566 Ga0501044_1236790
567 nmdc:mga0rr50_671104_c1
568 Ga0495601_0027698
569 Ga0495601_0306844
570 Ga0587088_010437
571 Ga0587128_040668
572 Ga0530510_0165490

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01339

CheB_methylest

CheB methylesterase

6

182

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ymz-assembly3.cif.gz_C structure of the cheb methylsterase from p. atrosepticum scri1043 0.9391 5 183
1a2o-assembly2.cif.gz_B structural basis for methylesterase cheb regulation by a phosphorylation-activated domain 0.938 5 183
3sft-assembly1.cif.gz_A crystal structure of thermotoga maritima cheb methylesterase catalytic domain 0.9351 3 179
1chd-assembly1.cif.gz_A cheb methylesterase domain 0.932 1 182
6ymz-assembly5.cif.gz_E structure of the cheb methylsterase from p. atrosepticum scri1043 0.93 1 182
ID Description Score Start End Superfamily
3sftA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylesterase CheB, C-terminal domain 0.9351 3 179 3.40.50.180
af_P07330_147_349_3.40.50.180 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylesterase CheB, C-terminal domain 0.9138 1 188 3.40.50.180
af_P07330_147_349_3.40.50.180 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylesterase CheB, C-terminal domain 0.8955 1 188 3.40.50.180
3sftA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylesterase CheB, C-terminal domain 0.8734 3 179 3.40.50.180
2wvlB00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.667 5 54 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A1F9API2-F1-model_v4 Protein-glutamate methylesterase/protein-glutamine glutaminase (EC 3.1.1.61) (EC 3.5.1.44) 0.9604 4 180 GO:0000156
GO:0005737
GO:0006935
GO:0008984
GO:0050568
AF-Q2INL1-F1-model_v4 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 (EC 3.1.1.61) (EC 3.5.1.44) 0.9596 4 180 GO:0000156
GO:0005737
GO:0006935
GO:0008984
GO:0050568
AF-A0A832H6E9-F1-model_v4 protein-glutamate methylesterase (EC 3.1.1.61) 0.9561 4 178 GO:0000156
GO:0005737
GO:0006935
GO:0008984
AF-A0A0F2R2X9-F1-model_v4 protein-glutamate methylesterase (EC 3.1.1.61) 0.9543 4 181 GO:0000156
GO:0005737
GO:0006935
GO:0008984
AF-A0A7G9ZDG4-F1-model_v4 Protein-glutamate methylesterase/protein-glutamine glutaminase (EC 3.1.1.61) (EC 3.5.1.44) 0.9541 2 179 GO:0000156
GO:0005737
GO:0006935
GO:0008984
GO:0050568

Map