F387239

General Info

Members Datasets Scaffolds Average Seq Length
286 192 572 179

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100000101|Ga0070675_1000001019
Length 207
Sequence MPIVASVEQMDRYVAFLRGMNLGGRRVKNEELRRHFEEIGLEEVSTFRASGNVTFATPKREAESKLAARVEAELGERLGYEVPVFLRSDEEVAAVAAHRPFDAKAVAKSKGKLQVSFLKKKPSATARMKVLSMASEEDLLALEGRELYWLPSGGISESDLDLKALDAALGEGTIRTMGTVEQIAARGTQASVAESSGGVARVWKTTQ

Samples

Sample ID Description Type Environment
1 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
93 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
94 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
97 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
98 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
99 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
100 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
101 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
102 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
105 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
106 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
109 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
112 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
113 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
114 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
115 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
116 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
117 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
118 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
119 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
122 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
123 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
124 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
127 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
128 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
129 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
130 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
131 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
132 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
135 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
136 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
137 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
142 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
143 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
144 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
147 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
148 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
149 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
150 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
175 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
176 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
177 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
178 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
179 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
183 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
186 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
187 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
188 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
190 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.05
Nodule 0
Rhizoplane 12.24
Rhizosphere 85.66
Stem 0
Stem Tuber 0
Unclassified 5.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070675_100000101 3300005354 Bacteria 50140
2 Ga0070683_100016439 3300005329 Bacteria 6527
3 Ga0070683_100129029 3300005329 Bacteria 2392
4 Ga0070670_100060586 3300005331 Bacteria 3250
5 Ga0070677_10000304 3300005333 Bacteria 17193
6 Ga0070682_100000013 3300005337 Bacteria 254641
7 Ga0070682_100000045 3300005337 Bacteria 131960
8 Ga0068868_100000932 3300005338 Bacteria 19897
9 Ga0070660_100288705 3300005339 Unclassified 1343
10 Ga0070689_100054339 3300005340 Bacteria 3100
11 Ga0070689_100224239 3300005340 Bacteria 1543
12 Ga0070674_100000420 3300005356 Bacteria 21367
13 Ga0070688_100000252 3300005365 Bacteria 28245
14 Ga0070659_100001961 3300005366 Bacteria 14692
15 Ga0070667_100407563 3300005367 Bacteria 1238
16 Ga0070714_100017531 3300005435 Bacteria 5802
17 Ga0070714_100161935 3300005435 Bacteria 2025
18 Ga0070701_10069638 3300005438 Bacteria 1877
19 Ga0070663_100243703 3300005455 Archaea 1420
20 Ga0070678_100120750 3300005456 Unclassified 2066
21 Ga0070662_100000016 3300005457 Bacteria 105820
22 Ga0070681_10008161 3300005458 Bacteria 10250
23 Ga0068867_100000266 3300005459 Bacteria 34381
24 Ga0070685_10000127 3300005466 Bacteria 48844
25 Ga0070679_100000312 3300005530 Bacteria 41159
26 Ga0070684_100059984 3300005535 Bacteria 3326
27 Ga0070684_100342352 3300005535 Bacteria 1375
28 Ga0068853_100007219 3300005539 Bacteria 8900
29 Ga0070686_100261945 3300005544 Unclassified 1268
30 Ga0070693_100001154 3300005547 Bacteria 11857
31 Ga0070665_100000244 3300005548 Bacteria 90284
32 Ga0070665_100124491 3300005548 Unclassified 2580
33 Ga0070665_100159694 3300005548 Bacteria 2256
34 Ga0068855_100791990 3300005563 Bacteria 1008
35 Ga0070664_100027653 3300005564 Bacteria 4714
36 Ga0070664_100038597 3300005564 Bacteria 4021
37 Ga0068854_100000114 3300005578 Bacteria 55089
38 Ga0068856_100014215 3300005614 Bacteria 7694
39 Ga0068856_100016413 3300005614 Bacteria 7163
40 Ga0068852_100380766 3300005616 Bacteria 1384
41 Ga0068866_10000001 3300005718 Bacteria 519680
42 Ga0068861_100325099 3300005719 Bacteria 1341
43 Ga0068851_10004594 3300005834 Bacteria 6226
44 Ga0068863_100000021 3300005841 Bacteria 198088
45 Ga0068858_100000267 3300005842 Bacteria 55818
46 Ga0068858_100000590 3300005842 Bacteria 37996
47 Ga0068860_100047750 3300005843 Bacteria 4080
48 Ga0081540_1083384 3300005983 Bacteria 1430
49 Ga0081539_10001929 3300005985 Bacteria 31957
50 Ga0075363_100125602 3300006048 Bacteria 1436
51 Ga0070715_10000001 3300006163 Bacteria 693690
52 Ga0097621_100388028 3300006237 Bacteria 1248
53 Ga0075430_100127711 3300006846 Unclassified 2119
54 Ga0068865_100126446 3300006881 Bacteria 1909
55 Ga0075435_100189913 3300007076 Bacteria 1739
56 Ga0105245_10000016 3300009098 Bacteria 204372
57 Ga0105245_10001174 3300009098 Bacteria 23711
58 Ga0105245_10001295 3300009098 Bacteria 22566
59 Ga0105242_10465454 3300009176 Bacteria 1195
60 Ga0105238_10000011 3300009551 Bacteria 261080
61 Ga0105249_10000068 3300009553 Bacteria 148594
62 Ga0105249_11221989 3300009553 Bacteria 823
63 Ga0105239_10390905 3300010375 Bacteria 1573
64 Ga0157371_10015152 3300013102 Bacteria 5791
65 Ga0157370_10046026 3300013104 Bacteria 4184
66 Ga0157370_10802759 3300013104 Unclassified 856
67 Ga0157369_10000110 3300013105 Bacteria 115514
68 Ga0157374_10042277 3300013296 Bacteria 4203
69 Ga0157372_10000409 3300013307 Bacteria 47021
70 Ga0157375_10000112 3300013308 Bacteria 79146
71 Ga0157375_10083533 3300013308 Bacteria 3239
72 Ga0157375_10322779 3300013308 Bacteria 1708
73 Ga0163163_10271507 3300014325 Bacteria 1747
74 Ga0163163_10767681 3300014325 Bacteria 1027
75 Ga0157380_10000093 3300014326 Bacteria 48915
76 Ga0157380_10000815 3300014326 Bacteria 19534
77 Ga0157379_10011336 3300014968 Bacteria 7772
78 Ga0157376_10066353 3300014969 Bacteria 3050
79 Ga0163161_10000032 3300017792 Bacteria 165511
80 Ga0206356_11667875 3300020070 Bacteria 2775
81 Ga0207656_10000116 3300025321 Bacteria 30697
82 Ga0207682_10000557 3300025893 Bacteria 17207
83 Ga0207642_10000031 3300025899 Bacteria 45198
84 Ga0207680_10001098 3300025903 Bacteria 12763
85 Ga0207685_10000036 3300025905 Bacteria 65666
86 Ga0207657_10298239 3300025919 Bacteria 1277
87 Ga0207652_10000483 3300025921 Bacteria 40881
88 Ga0207694_10000004 3300025924 Bacteria 967075
89 Ga0207650_10069751 3300025925 Bacteria 2641
90 Ga0207659_10000010 3300025926 Bacteria 286639
91 Ga0207687_10000018 3300025927 Bacteria 236159
92 Ga0207687_10000247 3300025927 Bacteria 36785
93 Ga0207687_10006221 3300025927 Bacteria 7900
94 Ga0207664_10080689 3300025929 Bacteria 2645
95 Ga0207690_10001068 3300025932 Bacteria 17537
96 Ga0207706_10000068 3300025933 Bacteria 105795
97 Ga0207686_10063289 3300025934 Bacteria 2352
98 Ga0207670_10040032 3300025936 Bacteria 3074
99 Ga0207670_10252024 3300025936 Bacteria 1365
100 Ga0207669_10000012 3300025937 Bacteria 138242
101 Ga0207661_10010833 3300025944 Bacteria 6578
102 Ga0207661_10036599 3300025944 Bacteria 3833
103 Ga0207679_10015693 3300025945 Bacteria 5013
104 Ga0207712_10000007 3300025961 Bacteria 539589
105 Ga0207712_10566015 3300025961 Bacteria 979
106 Ga0207640_10000015 3300025981 Bacteria 215411
107 Ga0207677_10000654 3300026023 Bacteria 20750
108 Ga0207703_10000020 3300026035 Bacteria 251603
109 Ga0207703_10000040 3300026035 Bacteria 168191
110 Ga0207639_10000915 3300026041 Bacteria 19983
111 Ga0207702_10000060 3300026078 Bacteria 125473
112 Ga0207702_10062631 3300026078 Bacteria 3177
113 Ga0207702_10105565 3300026078 Bacteria 2495
114 Ga0207702_11027402 3300026078 Unclassified 818
115 Ga0207641_10000151 3300026088 Bacteria 99225
116 Ga0207648_10000848 3300026089 Bacteria 34516
117 Ga0207698_10041501 3300026142 Bacteria 3429
118 Ga0268266_10000020 3300028379 Bacteria 527065
119 Ga0268266_10091822 3300028379 Unclassified 2663
120 Ga0268266_10114474 3300028379 Bacteria 2393
121 Ga0265319_1000025 3300028563 Bacteria 142639
122 Ga0265322_10103144 3300028654 Bacteria 811
123 Ga0265336_10038275 3300028666 Bacteria 1473
124 Ga0265338_10000473 3300028800 Bacteria 71777
125 Ga0265324_10031080 3300029957 Bacteria 1872
126 Ga0307511_10063286 3300030521 Bacteria 2796
127 Ga0265325_10009973 3300031241 Bacteria 5523
128 Ga0373956_0117671 3300035119 Bacteria 1240
129 Ga0373957_0148285 3300035120 Unclassified 962
130 Ga0373955_0140333 3300035172 Bacteria 1417
131 Ga0316574_0749227 3300035398 Bacteria 597
132 Ga0373937_1381302 3300036401 Unclassified 652
133 Ga0451853_0656289 3300041512 Bacteria 726
134 Ga0451853_3487497 3300041512 Bacteria 3569
135 Ga0466963_0000282 3300044694 Bacteria 22761
136 Ga0466958_0267130 3300045836 Unclassified 1095
137 Ga0466967_0000027 3300045976 Bacteria 64265
138 Ga0466967_0644313 3300045976 Bacteria 1047
139 Ga0495592_0000036 3300046454 Bacteria 125461
140 Ga0495603_0010294 3300046455 Bacteria 5660
141 Ga0495629_0214655 3300046459 Bacteria 1328
142 Ga0495629_0637528 3300046459 Unclassified 711
143 Ga0495638_0064197 3300046460 Bacteria 2262
144 Ga0495641_0004274 3300046461 Bacteria 10192
145 Ga0495641_0008569 3300046461 Bacteria 6203
146 Ga0495653_0240383 3300046463 Bacteria 1207
147 Ga0495653_0296805 3300046463 Bacteria 1055
148 Ga0495582_0000112 3300046473 Bacteria 42740
149 Ga0495662_0000083 3300046476 Bacteria 34253
150 Ga0495662_0008350 3300046476 Bacteria 5092
151 Ga0495662_0135621 3300046476 Bacteria 1211
152 Ga0495606_0000221 3300046507 Bacteria 101157
153 Ga0495608_0000189 3300046511 Bacteria 43800
154 Ga0495608_0000305 3300046511 Bacteria 34510
155 Ga0495608_0005739 3300046511 Bacteria 8857
156 Ga0495608_0049051 3300046511 Bacteria 2804
157 Ga0495618_0000207 3300046514 Bacteria 42305
158 Ga0495620_0000210 3300046515 Bacteria 44013
159 Ga0495628_0002445 3300046516 Bacteria 16746
160 Ga0495628_0039160 3300046516 Bacteria 3792
161 Ga0495628_0092503 3300046516 Bacteria 2339
162 Ga0495628_0114668 3300046516 Bacteria 2070
163 Ga0495628_0138251 3300046516 Bacteria 1860
164 Ga0495628_0175826 3300046516 Bacteria 1621
165 Ga0495630_0013914 3300046517 Bacteria 5852
166 Ga0495630_0159906 3300046517 Bacteria 1715
167 Ga0495644_0000380 3300046523 Bacteria 20202
168 Ga0495640_0021518 3300046533 Bacteria 4731
169 Ga0495586_0001014 3300046535 Bacteria 15853
170 Ga0495587_0081839 3300046536 Bacteria 1871
171 Ga0495598_0006836 3300046537 Bacteria 2589
172 Ga0495621_0225855 3300046539 Bacteria 759
173 Ga0495645_0657202 3300046543 Unclassified 640
174 Ga0495667_0124419 3300046559 Bacteria 1664
175 Ga0495656_0059423 3300046615 Bacteria 1663
176 Ga0495668_0050260 3300046616 Bacteria 2311
177 Ga0495634_0000401 3300046642 Bacteria 42619
178 Ga0495634_0019664 3300046642 Bacteria 4796
179 Ga0495635_0000016 3300046663 Bacteria 214088
180 Ga0495588_0753488 3300046674 Bacteria 509
181 Ga0495657_0000004 3300046675 Bacteria 266465
182 Ga0495599_0014348 3300046678 Bacteria 4906
183 Ga0495647_0000054 3300046681 Bacteria 30734
184 Ga0495647_0000997 3300046681 Bacteria 8591
185 Ga0495647_0019128 3300046681 Bacteria 2447
186 Ga0495658_0005713 3300046683 Bacteria 6110
187 Ga0495669_0000088 3300046684 Bacteria 61314
188 Ga0495669_0008122 3300046684 Bacteria 4404
189 Ga0495613_0000370 3300046689 Bacteria 38906
190 Ga0495613_0000577 3300046689 Bacteria 29814
191 Ga0495613_0082037 3300046689 Bacteria 2342
192 Ga0495624_0000008 3300046690 Bacteria 145035
193 Ga0495624_0001409 3300046690 Bacteria 18746
194 Ga0495624_0030707 3300046690 Bacteria 3498
195 Ga0495649_0001942 3300046694 Bacteria 15048
196 Ga0495600_0014661 3300046809 Bacteria 4941
197 Ga0495600_0121423 3300046809 Bacteria 1699
198 Ga0495604_0003700 3300047317 Bacteria 12179
199 Ga0495604_0020610 3300047317 Bacteria 5265
200 Ga0495674_0000251 3300047319 Bacteria 45351
201 Ga0495672_0226130 3300047320 Unclassified 921
202 Ga0495676_0001271 3300047321 Bacteria 21659
203 Ga0495676_0011361 3300047321 Bacteria 8038
204 Ga0495676_0317416 3300047321 Unclassified 1047
205 Ga0495680_0000317 3300047322 Bacteria 53949
206 Ga0495680_0000647 3300047322 Bacteria 39030
207 Ga0495675_0000380 3300047444 Bacteria 30671
208 Ga0495675_0005740 3300047444 Bacteria 7592
209 Ga0495685_009886 3300047447 Bacteria 3194
210 Ga0495602_0000021 3300048088 Bacteria 168585
211 Ga0495602_0227535 3300048088 Bacteria 1403
212 Ga0495602_0268153 3300048088 Bacteria 1263
213 Ga0495614_0067164 3300048089 Bacteria 1543
214 Ga0496100_0000002 3300048903 Bacteria 489057
215 Ga0496100_0000018 3300048903 Bacteria 162451
216 Ga0496100_0152501 3300048903 Bacteria 1650
217 Ga0496101_0000001 3300048904 Bacteria 489057
218 Ga0496101_0000308 3300048904 Bacteria 33852
219 Ga0496102_1207073 3300048905 Bacteria 676
220 Ga0496104_0000009 3300048907 Bacteria 488055
221 Ga0496104_0074323 3300048907 Bacteria 3236
222 Ga0496105_0000027 3300048908 Bacteria 148197
223 Ga0496105_0008230 3300048908 Bacteria 8106
224 Ga0496106_0000081 3300048909 Bacteria 76468
225 Ga0496106_0000098 3300048909 Bacteria 66098
226 Ga0496106_0000229 3300048909 Bacteria 39124
227 Ga0496107_0000006 3300048910 Bacteria 258746
228 Ga0496107_0000013 3300048910 Bacteria 178284
229 Ga0496107_0011995 3300048910 Bacteria 6048
230 Ga0496108_0000001 3300048911 Bacteria 919044
231 Ga0496108_0000132 3300048911 Bacteria 73888
232 Ga0496108_0001220 3300048911 Bacteria 20175
233 Ga0496109_0000003 3300048912 Bacteria 420862
234 Ga0496109_0000007 3300048912 Bacteria 247554
235 Ga0496109_0000168 3300048912 Bacteria 64462
236 Ga0496109_0003056 3300048912 Bacteria 13946
237 Ga0496109_0191246 3300048912 Bacteria 1923
238 Ga0496110_0000389 3300048913 Bacteria 29588
239 Ga0496110_0018459 3300048913 Bacteria 5850
240 Ga0496110_0645292 3300048913 Bacteria 958
241 Ga0496111_0000093 3300048914 Bacteria 38167
242 Ga0496112_0156357 3300048915 Bacteria 2247
243 Ga0496112_1761862 3300048915 Bacteria 531
244 Ga0496113_0027643 3300048916 Bacteria 4069
245 Ga0496113_0485643 3300048916 Bacteria 992
246 Ga0496114_0010381 3300048917 Bacteria 7410
247 Ga0496114_0923790 3300048917 Bacteria 754
248 Ga0496115_0000003 3300048918 Bacteria 354994
249 Ga0501031_0419424 3300049568 Bacteria 865
250 Ga0501033_0620615 3300049570 Bacteria 740
251 Ga0501040_0270111 3300049576 Bacteria 1214
252 Ga0501042_0089545 3300049578 Bacteria 2208
253 Ga0501042_0359889 3300049578 Bacteria 1053
254 Ga0501048_0258994 3300049582 Bacteria 1236
255 Ga0501070_0036990 3300049586 Bacteria 4075
256 Ga0501070_0210728 3300049586 Bacteria 1595
257 Ga0501071_0054424 3300049587 Bacteria 2888
258 Ga0501072_0054633 3300049588 Bacteria 3147
259 Ga0501075_0000392 3300049591 Bacteria 25374
260 Ga0501075_0186376 3300049591 Bacteria 1583
261 Ga0501076_0225272 3300049592 Bacteria 1532
262 Ga0501076_0318906 3300049592 Bacteria 1275
263 Ga0501077_0276445 3300049593 Bacteria 1069
264 Ga0501081_0052142 3300049743 Bacteria 2822
265 Ga0501044_0237897 3300049823 Unclassified 1766
266 Ga0501045_0066489 3300049824 Bacteria 2647
267 nmdc:mga03n38_551871_c1 3300050490 Bacteria 652
268 nmdc:mga0qj67_143094_c1 3300050509 Unclassified 1939
269 nmdc:mga0rr50_143735_c1 3300050513 Bacteria 1921
270 Ga0495601_0000375 3300053077 Bacteria 23634
271 Ga0495601_0038315 3300053077 Bacteria 2998
272 Ga0495612_0000068 3300053078 Bacteria 47169
273 Ga0495612_0001764 3300053078 Bacteria 8870
274 Ga0495655_0001497 3300053083 Bacteria 3592
275 Ga0495595_0000003 3300053084 Bacteria 266465
276 Ga0495595_0000087 3300053084 Bacteria 43931
277 Ga0495595_0027767 3300053084 Bacteria 2524
278 Ga0495619_0000021 3300053085 Bacteria 187095
279 Ga0495619_0000055 3300053085 Bacteria 95570
280 Ga0495619_0000705 3300053085 Bacteria 21841
281 Ga0495619_0003006 3300053085 Bacteria 10949
282 Ga0495619_0006064 3300053085 Bacteria 7655
283 Ga0495619_0247490 3300053085 Bacteria 1235
284 Ga0500614_000514 3300053123 Bacteria 10031
285 Ga0501084_0343384 3300054114 Bacteria 1261
286 Ga0501082_0174208 3300060353 Bacteria 1871
287 Ga0070675_100000101
288 Ga0070683_100016439
289 Ga0070683_100129029
290 Ga0070670_100060586
291 Ga0070677_10000304
292 Ga0070682_100000013
293 Ga0070682_100000045
294 Ga0068868_100000932
295 Ga0070660_100288705
296 Ga0070689_100054339
297 Ga0070689_100224239
298 Ga0070674_100000420
299 Ga0070688_100000252
300 Ga0070659_100001961
301 Ga0070667_100407563
302 Ga0070714_100017531
303 Ga0070714_100161935
304 Ga0070701_10069638
305 Ga0070663_100243703
306 Ga0070678_100120750
307 Ga0070662_100000016
308 Ga0070681_10008161
309 Ga0068867_100000266
310 Ga0070685_10000127
311 Ga0070679_100000312
312 Ga0070684_100059984
313 Ga0070684_100342352
314 Ga0068853_100007219
315 Ga0070686_100261945
316 Ga0070693_100001154
317 Ga0070665_100000244
318 Ga0070665_100124491
319 Ga0070665_100159694
320 Ga0068855_100791990
321 Ga0070664_100027653
322 Ga0070664_100038597
323 Ga0068854_100000114
324 Ga0068856_100014215
325 Ga0068856_100016413
326 Ga0068852_100380766
327 Ga0068866_10000001
328 Ga0068861_100325099
329 Ga0068851_10004594
330 Ga0068863_100000021
331 Ga0068858_100000267
332 Ga0068858_100000590
333 Ga0068860_100047750
334 Ga0081540_1083384
335 Ga0081539_10001929
336 Ga0075363_100125602
337 Ga0070715_10000001
338 Ga0097621_100388028
339 Ga0075430_100127711
340 Ga0068865_100126446
341 Ga0075435_100189913
342 Ga0105245_10000016
343 Ga0105245_10001174
344 Ga0105245_10001295
345 Ga0105242_10465454
346 Ga0105238_10000011
347 Ga0105249_10000068
348 Ga0105249_11221989
349 Ga0105239_10390905
350 Ga0157371_10015152
351 Ga0157370_10046026
352 Ga0157370_10802759
353 Ga0157369_10000110
354 Ga0157374_10042277
355 Ga0157372_10000409
356 Ga0157375_10000112
357 Ga0157375_10083533
358 Ga0157375_10322779
359 Ga0163163_10271507
360 Ga0163163_10767681
361 Ga0157380_10000093
362 Ga0157380_10000815
363 Ga0157379_10011336
364 Ga0157376_10066353
365 Ga0163161_10000032
366 Ga0206356_11667875
367 Ga0207656_10000116
368 Ga0207682_10000557
369 Ga0207642_10000031
370 Ga0207680_10001098
371 Ga0207685_10000036
372 Ga0207657_10298239
373 Ga0207652_10000483
374 Ga0207694_10000004
375 Ga0207650_10069751
376 Ga0207659_10000010
377 Ga0207687_10000018
378 Ga0207687_10000247
379 Ga0207687_10006221
380 Ga0207664_10080689
381 Ga0207690_10001068
382 Ga0207706_10000068
383 Ga0207686_10063289
384 Ga0207670_10040032
385 Ga0207670_10252024
386 Ga0207669_10000012
387 Ga0207661_10010833
388 Ga0207661_10036599
389 Ga0207679_10015693
390 Ga0207712_10000007
391 Ga0207712_10566015
392 Ga0207640_10000015
393 Ga0207677_10000654
394 Ga0207703_10000020
395 Ga0207703_10000040
396 Ga0207639_10000915
397 Ga0207702_10000060
398 Ga0207702_10062631
399 Ga0207702_10105565
400 Ga0207702_11027402
401 Ga0207641_10000151
402 Ga0207648_10000848
403 Ga0207698_10041501
404 Ga0268266_10000020
405 Ga0268266_10091822
406 Ga0268266_10114474
407 Ga0265319_1000025
408 Ga0265322_10103144
409 Ga0265336_10038275
410 Ga0265338_10000473
411 Ga0265324_10031080
412 Ga0307511_10063286
413 Ga0265325_10009973
414 Ga0373956_0117671
415 Ga0373957_0148285
416 Ga0373955_0140333
417 Ga0316574_0749227
418 Ga0373937_1381302
419 Ga0451853_0656289
420 Ga0451853_3487497
421 Ga0466963_0000282
422 Ga0466958_0267130
423 Ga0466967_0000027
424 Ga0466967_0644313
425 Ga0495592_0000036
426 Ga0495603_0010294
427 Ga0495629_0214655
428 Ga0495629_0637528
429 Ga0495638_0064197
430 Ga0495641_0004274
431 Ga0495641_0008569
432 Ga0495653_0240383
433 Ga0495653_0296805
434 Ga0495582_0000112
435 Ga0495662_0000083
436 Ga0495662_0008350
437 Ga0495662_0135621
438 Ga0495606_0000221
439 Ga0495608_0000189
440 Ga0495608_0000305
441 Ga0495608_0005739
442 Ga0495608_0049051
443 Ga0495618_0000207
444 Ga0495620_0000210
445 Ga0495628_0002445
446 Ga0495628_0039160
447 Ga0495628_0092503
448 Ga0495628_0114668
449 Ga0495628_0138251
450 Ga0495628_0175826
451 Ga0495630_0013914
452 Ga0495630_0159906
453 Ga0495644_0000380
454 Ga0495640_0021518
455 Ga0495586_0001014
456 Ga0495587_0081839
457 Ga0495598_0006836
458 Ga0495621_0225855
459 Ga0495645_0657202
460 Ga0495667_0124419
461 Ga0495656_0059423
462 Ga0495668_0050260
463 Ga0495634_0000401
464 Ga0495634_0019664
465 Ga0495635_0000016
466 Ga0495588_0753488
467 Ga0495657_0000004
468 Ga0495599_0014348
469 Ga0495647_0000054
470 Ga0495647_0000997
471 Ga0495647_0019128
472 Ga0495658_0005713
473 Ga0495669_0000088
474 Ga0495669_0008122
475 Ga0495613_0000370
476 Ga0495613_0000577
477 Ga0495613_0082037
478 Ga0495624_0000008
479 Ga0495624_0001409
480 Ga0495624_0030707
481 Ga0495649_0001942
482 Ga0495600_0014661
483 Ga0495600_0121423
484 Ga0495604_0003700
485 Ga0495604_0020610
486 Ga0495674_0000251
487 Ga0495672_0226130
488 Ga0495676_0001271
489 Ga0495676_0011361
490 Ga0495676_0317416
491 Ga0495680_0000317
492 Ga0495680_0000647
493 Ga0495675_0000380
494 Ga0495675_0005740
495 Ga0495685_009886
496 Ga0495602_0000021
497 Ga0495602_0227535
498 Ga0495602_0268153
499 Ga0495614_0067164
500 Ga0496100_0000002
501 Ga0496100_0000018
502 Ga0496100_0152501
503 Ga0496101_0000001
504 Ga0496101_0000308
505 Ga0496102_1207073
506 Ga0496104_0000009
507 Ga0496104_0074323
508 Ga0496105_0000027
509 Ga0496105_0008230
510 Ga0496106_0000081
511 Ga0496106_0000098
512 Ga0496106_0000229
513 Ga0496107_0000006
514 Ga0496107_0000013
515 Ga0496107_0011995
516 Ga0496108_0000001
517 Ga0496108_0000132
518 Ga0496108_0001220
519 Ga0496109_0000003
520 Ga0496109_0000007
521 Ga0496109_0000168
522 Ga0496109_0003056
523 Ga0496109_0191246
524 Ga0496110_0000389
525 Ga0496110_0018459
526 Ga0496110_0645292
527 Ga0496111_0000093
528 Ga0496112_0156357
529 Ga0496112_1761862
530 Ga0496113_0027643
531 Ga0496113_0485643
532 Ga0496114_0010381
533 Ga0496114_0923790
534 Ga0496115_0000003
535 Ga0501031_0419424
536 Ga0501033_0620615
537 Ga0501040_0270111
538 Ga0501042_0089545
539 Ga0501042_0359889
540 Ga0501048_0258994
541 Ga0501070_0036990
542 Ga0501070_0210728
543 Ga0501071_0054424
544 Ga0501072_0054633
545 Ga0501075_0000392
546 Ga0501075_0186376
547 Ga0501076_0225272
548 Ga0501076_0318906
549 Ga0501077_0276445
550 Ga0501081_0052142
551 Ga0501044_0237897
552 Ga0501045_0066489
553 nmdc:mga03n38_551871_c1
554 nmdc:mga0qj67_143094_c1
555 nmdc:mga0rr50_143735_c1
556 Ga0495601_0000375
557 Ga0495601_0038315
558 Ga0495612_0000068
559 Ga0495612_0001764
560 Ga0495655_0001497
561 Ga0495595_0000003
562 Ga0495595_0000087
563 Ga0495595_0027767
564 Ga0495619_0000021
565 Ga0495619_0000055
566 Ga0495619_0000705
567 Ga0495619_0003006
568 Ga0495619_0006064
569 Ga0495619_0247490
570 Ga0500614_000514
571 Ga0501084_0343384
572 Ga0501082_0174208

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08002

DUF1697

Protein of unknown function (DUF1697)

10

148

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hiy-assembly1.cif.gz_A the structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. 0.7483 1 178
2hiy-assembly1.cif.gz_B the structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. 0.7446 2 174
2hiy-assembly1.cif.gz_A the structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. 0.7409 1 178
2hiy-assembly1.cif.gz_B the structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. 0.7192 2 174
3v97-assembly1.cif.gz_A crystal structure of bifunctional methyltransferase ycby (rlmlk) from escherichia coli, sah binding 0.7163 2 49
ID Description Score Start End Superfamily
af_O06552_36_123_3.30.70.1280 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.9346 2 84 3.30.70.1280
af_Q54C13_1_90_3.30.70.1280 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.8794 1 87 3.30.70.1280
af_O06552_36_123_3.30.70.1280 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.8741 2 84 3.30.70.1280
af_Q54C13_1_90_3.30.70.1280 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.8438 1 87 3.30.70.1280
af_Q54D49_1_88_3.30.70.1280 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.8243 2 84 3.30.70.1280
ID Description Score Start End GO Terms
AF-A0A838V2E6-F1-model_v4 DUF1697 domain-containing protein 0.9876 24 179
AF-A0A7W0S160-F1-model_v4 DUF1697 domain-containing protein 0.983 57 179
AF-A0A537Z6G1-F1-model_v4 DUF1697 domain-containing protein 0.9749 1 179
AF-A0A7W0H6G8-F1-model_v4 DUF1697 domain-containing protein 0.9716 1 177
AF-A0A537Z6G1-F1-model_v4 DUF1697 domain-containing protein 0.9695 1 179

Map