F387238

General Info

Members Datasets Scaffolds Average Seq Length
286 162 572 209

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100736494|Ga0070669_1007364941
Length 249
Sequence LLKPAFSLYPFSCVNRFERPIAQMLQVSSNFARHQTRHSMRQQIASILKVLRLAERLKFELRHSYTSSGRQESVAEHTWRMALMSVLIEPLLKQKVDTARLLKMIIIHDLVEAEATDISALEVLRNPEIKIQKIEKEKQAIQNLRLALKETNGQEIYDLFYEFEEKETYESKVGNALDKLEVQLQHNHADFSTWEEIEYDMTFMMDKHVLFDPALVEIKNQIEQEAEQKMQMNGIDTAVVRQRVVGGTQ

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
55 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
56 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
88 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
131 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
132 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
133 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
134 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
135 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
138 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
153 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
154 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
160 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
161 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
162 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.08
Nodule 0
Rhizoplane 0.35
Rhizosphere 80.07
Stem 0
Stem Tuber 0
Unclassified 12.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100736494 3300005353 Bacteria 834
2 SwRhRL2b_contig_3200134 2162886007 Bacteria 14107
3 JGI24739J22299_10001266 3300001989 Bacteria 9481
4 JGI24751J29686_10000822 3300002459 Bacteria 7205
5 JGI25151J46595_10003435 3300003187 Bacteria 8760
6 JGI25151J46595_10005588 3300003187 Bacteria 6470
7 JGI25151J46595_10037021 3300003187 Bacteria 1834
8 JGI25153J46596_10031382 3300003215 Unclassified 1790
9 JGI25153J46596_10036325 3300003215 Unclassified 1582
10 rootH2_10130930 3300003320 Bacteria 5447
11 rootL2_10382502 3300003322 Bacteria 1171
12 JGI25160J50197_1003189 3300003354 Bacteria 7436
13 JGI25160J50197_1052642 3300003354 Bacteria 854
14 Ga0055526_1016328 3300003771 Bacteria 2914
15 Ga0055526_1027780 3300003771 Unclassified 1735
16 Ga0055528_1000491 3300003790 Bacteria 31269
17 Ga0055530_10001657 3300003791 Bacteria 15859
18 Ga0055541_1000181 3300003841 Bacteria 29147
19 Ga0055543_1002474 3300004625 Bacteria 6097
20 Ga0065165_1008167 3300005262 Unclassified 4972
21 Ga0065704_10070540 3300005289 Bacteria 21281
22 Ga0065704_10088065 3300005289 Bacteria 2958
23 Ga0070683_100034680 3300005329 Bacteria 4611
24 Ga0070683_100133694 3300005329 Bacteria 2348
25 Ga0070670_100009010 3300005331 Bacteria 8526
26 Ga0070670_100038347 3300005331 Bacteria 4120
27 Ga0068869_100014987 3300005334 Bacteria 5185
28 Ga0068869_100057548 3300005334 Bacteria 2839
29 Ga0068869_100106430 3300005334 Bacteria 2128
30 Ga0070666_10635256 3300005335 Bacteria 780
31 Ga0070689_100072296 3300005340 Bacteria 2696
32 Ga0070661_100120536 3300005344 Bacteria 1964
33 Ga0070668_100017544 3300005347 Viruses 5368
34 Ga0070668_100244801 3300005347 Bacteria 1486
35 Ga0070669_100110180 3300005353 Bacteria 2088
36 Ga0070675_100072217 3300005354 Bacteria 2865
37 Ga0070675_100080987 3300005354 Bacteria 2707
38 Ga0070675_100346918 3300005354 Bacteria 1316
39 Ga0070673_100381088 3300005364 Bacteria 1257
40 Ga0070688_100006998 3300005365 Bacteria 6062
41 Ga0070667_100097748 3300005367 Bacteria 2533
42 Ga0070667_100151099 3300005367 Bacteria 2040
43 Ga0070667_100314873 3300005367 Bacteria 1411
44 Ga0070667_100348014 3300005367 Bacteria 1341
45 Ga0070663_100141868 3300005455 Bacteria 1835
46 Ga0070678_100113162 3300005456 Bacteria 2127
47 Ga0070678_100158498 3300005456 Bacteria 1831
48 Ga0070662_100091159 3300005457 Bacteria 2289
49 Ga0068867_100005456 3300005459 Bacteria 8999
50 Ga0068867_100251095 3300005459 Unclassified 1438
51 Ga0070685_10025057 3300005466 Bacteria 3283
52 Ga0070684_100010233 3300005535 Bacteria 7424
53 Ga0070684_100112517 3300005535 Bacteria 2442
54 Ga0068853_100026318 3300005539 Unclassified 4884
55 Ga0068853_100048753 3300005539 Unclassified 3639
56 Ga0070672_100074324 3300005543 Unclassified 2711
57 Ga0070672_100143244 3300005543 Bacteria 1973
58 Ga0070672_100178185 3300005543 Bacteria 1770
59 Ga0070693_100115992 3300005547 Bacteria 1655
60 Ga0070664_100002738 3300005564 Bacteria 14221
61 Ga0070664_100082097 3300005564 Bacteria 2779
62 Ga0068857_100037069 3300005577 Bacteria 4318
63 Ga0068852_100193841 3300005616 Bacteria 1919
64 Ga0068852_100198871 3300005616 Unclassified 1896
65 Ga0068852_100431665 3300005616 Bacteria 1301
66 Ga0068859_100023102 3300005617 Bacteria 6237
67 Ga0068859_100127986 3300005617 Bacteria 2610
68 Ga0068864_100001741 3300005618 Bacteria 17886
69 Ga0068864_100105330 3300005618 Bacteria 2506
70 Ga0068864_100136401 3300005618 Bacteria 2210
71 Ga0068866_10063891 3300005718 Unclassified 1920
72 Ga0068866_10474535 3300005718 Bacteria 823
73 Ga0068861_100011334 3300005719 Bacteria 6191
74 Ga0068870_10393182 3300005840 Bacteria 900
75 Ga0068863_100134722 3300005841 Bacteria 2360
76 Ga0068860_100000003 3300005843 Bacteria 575741
77 Ga0068860_100000879 3300005843 Bacteria 33346
78 Ga0068860_100062851 3300005843 Unclassified 3528
79 Ga0068862_100002725 3300005844 Bacteria 15511
80 Ga0068862_100159436 3300005844 Unclassified 2013
81 Ga0081540_1009932 3300005983 Bacteria 6491
82 Ga0075366_10073535 3300006195 Bacteria 2038
83 Ga0075366_10269348 3300006195 Bacteria 1040
84 Ga0097621_100018709 3300006237 Bacteria 5300
85 Ga0068871_100342950 3300006358 Bacteria 1320
86 Ga0068865_100041413 3300006881 Bacteria 3134
87 Ga0068865_100166259 3300006881 Bacteria 1687
88 Ga0068865_100215572 3300006881 Unclassified 1498
89 Ga0097620_100023103 3300006931 Bacteria 6237
90 Ga0097620_100127985 3300006931 Bacteria 2610
91 Ga0105251_10286127 3300009011 Unclassified 746
92 Ga0105244_10011690 3300009036 Bacteria 5240
93 Ga0105250_10004131 3300009092 Bacteria 6737
94 Ga0105250_10138767 3300009092 Bacteria 1007
95 Ga0105240_10000414 3300009093 Bacteria 79229
96 Ga0105240_10000723 3300009093 Bacteria 60353
97 Ga0105240_10000822 3300009093 Bacteria 56372
98 Ga0105240_10093844 3300009093 Bacteria 3662
99 Ga0111539_10053904 3300009094 Bacteria 4787
100 Ga0105245_11612413 3300009098 Bacteria 701
101 Ga0114129_10107671 3300009147 Bacteria 3849
102 Ga0105243_10376124 3300009148 Bacteria 1312
103 Ga0105243_10557766 3300009148 Bacteria 1096
104 Ga0105241_10000516 3300009174 Bacteria 29076
105 Ga0105241_10327265 3300009174 Bacteria 1323
106 Ga0105242_10049778 3300009176 Unclassified 3411
107 Ga0105242_10475178 3300009176 Unclassified 1183
108 Ga0105237_10000220 3300009545 Bacteria 80336
109 Ga0105237_10055137 3300009545 Bacteria 3982
110 Ga0105238_10000678 3300009551 Bacteria 35832
111 Ga0105238_10123559 3300009551 Unclassified 2568
112 Ga0105249_10001363 3300009553 Bacteria 21359
113 Ga0105249_10085021 3300009553 Bacteria 2947
114 Ga0105249_10460048 3300009553 Bacteria 1312
115 Ga0105249_10486583 3300009553 Bacteria 1277
116 Ga0105249_10881650 3300009553 Bacteria 961
117 Ga0105239_10003481 3300010375 Bacteria 19263
118 Ga0105239_10042759 3300010375 Unclassified 4965
119 Ga0105239_10128834 3300010375 Bacteria 2813
120 Ga0105239_10200655 3300010375 Bacteria 2235
121 Ga0105239_10228591 3300010375 Unclassified 2087
122 Ga0105239_10267098 3300010375 Bacteria 1924
123 Ga0105246_10130129 3300011119 Bacteria 1879
124 Ga0105246_10379381 3300011119 Bacteria 1168
125 Ga0105246_10917251 3300011119 Bacteria 787
126 Ga0157370_10417370 3300013104 Unclassified 1235
127 Ga0157369_10121052 3300013105 Bacteria 2777
128 Ga0157374_10000013 3300013296 Bacteria 461240
129 Ga0157374_10015811 3300013296 Bacteria 6629
130 Ga0157374_10129057 3300013296 Unclassified 2445
131 Ga0157374_10157683 3300013296 Unclassified 2210
132 Ga0157378_10036566 3300013297 Bacteria 4346
133 Ga0157378_10471204 3300013297 Bacteria 1250
134 Ga0157378_11007016 3300013297 Bacteria 868
135 Ga0163162_10000391 3300013306 Bacteria 40141
136 Ga0163162_10001340 3300013306 Bacteria 22932
137 Ga0163162_10249967 3300013306 Bacteria 1905
138 Ga0163162_10481053 3300013306 Bacteria 1373
139 Ga0163162_10635506 3300013306 Bacteria 1192
140 Ga0157375_10021990 3300013308 Bacteria 5863
141 Ga0157375_10085183 3300013308 Bacteria 3210
142 Ga0157375_10721465 3300013308 Bacteria 1150
143 Ga0163163_10001644 3300014325 Bacteria 18813
144 Ga0163163_10081798 3300014325 Bacteria 3232
145 Ga0163163_10245256 3300014325 Bacteria 1841
146 Ga0157380_10031146 3300014326 Bacteria 4093
147 Ga0157380_10838326 3300014326 Bacteria 940
148 Ga0157377_10010551 3300014745 Bacteria 4573
149 Ga0157377_10709931 3300014745 Bacteria 731
150 Ga0157379_10036244 3300014968 Bacteria 4399
151 Ga0157376_10022700 3300014969 Bacteria 4897
152 Ga0157376_10029186 3300014969 Bacteria 4392
153 Ga0157376_10532631 3300014969 Bacteria 1160
154 Ga0157376_10866893 3300014969 Unclassified 919
155 Ga0209566_100042 3300025225 Bacteria 287384
156 Ga0209566_100175 3300025225 Bacteria 70229
157 Ga0209258_103573 3300025242 Bacteria 3294
158 Ga0209673_1000014 3300025273 Bacteria 537082
159 Ga0209673_1000018 3300025273 Bacteria 458281
160 Ga0209130_1000504 3300025284 Bacteria 39736
161 Ga0209130_1002695 3300025284 Bacteria 8455
162 Ga0209676_1008403 3300025292 Bacteria 4608
163 Ga0209025_1000588 3300025294 Bacteria 65615
164 Ga0209025_1000674 3300025294 Bacteria 58837
165 Ga0209025_1000965 3300025294 Bacteria 43341
166 Ga0209025_1001041 3300025294 Bacteria 40734
167 Ga0209025_1004237 3300025294 Bacteria 12626
168 Ga0209025_1005376 3300025294 Bacteria 10484
169 Ga0209564_1000465 3300025295 Bacteria 67957
170 Ga0209564_1002499 3300025295 Bacteria 14320
171 Ga0209758_1004573 3300025297 Bacteria 11406
172 Ga0209758_1010416 3300025297 Bacteria 5566
173 Ga0209050_1000177 3300025298 Bacteria 146637
174 Ga0207426_1002181 3300025302 Bacteria 13237
175 Ga0207426_1014357 3300025302 Unclassified 2902
176 Ga0209051_1029528 3300025303 Unclassified 2144
177 Ga0209257_1002645 3300025304 Bacteria 17239
178 Ga0207696_1004314 3300025711 Bacteria 6153
179 Ga0207655_1039316 3300025728 Bacteria 2056
180 Ga0207642_10047463 3300025899 Unclassified 1920
181 Ga0207647_10125262 3300025904 Bacteria 1512
182 Ga0207645_10014178 3300025907 Bacteria 5338
183 Ga0207643_10173108 3300025908 Bacteria 1304
184 Ga0207654_10005895 3300025911 Bacteria 6170
185 Ga0207695_10000169 3300025913 Bacteria 192566
186 Ga0207695_10000648 3300025913 Bacteria 69088
187 Ga0207695_10000839 3300025913 Bacteria 56384
188 Ga0207695_10054246 3300025913 Bacteria 4188
189 Ga0207671_10001433 3300025914 Bacteria 27663
190 Ga0207671_10007549 3300025914 Bacteria 9416
191 Ga0207649_10115239 3300025920 Bacteria 1802
192 Ga0207681_10130756 3300025923 Bacteria 1856
193 Ga0207694_10057566 3300025924 Bacteria 3022
194 Ga0207694_10101093 3300025924 Unclassified 2284
195 Ga0207650_10013630 3300025925 Bacteria 5634
196 Ga0207650_10114544 3300025925 Bacteria 2092
197 Ga0207650_10203398 3300025925 Bacteria 1587
198 Ga0207659_10058591 3300025926 Bacteria 2765
199 Ga0207706_10032059 3300025933 Bacteria 4680
200 Ga0207706_10212427 3300025933 Bacteria 1695
201 Ga0207686_10094257 3300025934 Bacteria 1984
202 Ga0207686_10141598 3300025934 Unclassified 1663
203 Ga0207670_10006987 3300025936 Bacteria 6284
204 Ga0207704_10212606 3300025938 Unclassified 1425
205 Ga0207691_10054623 3300025940 Bacteria 3643
206 Ga0207691_10101894 3300025940 Bacteria 2561
207 Ga0207691_10189841 3300025940 Bacteria 1792
208 Ga0207691_10408811 3300025940 Bacteria 1157
209 Ga0207689_10014539 3300025942 Bacteria 6694
210 Ga0207689_10108217 3300025942 Bacteria 2284
211 Ga0207689_10109576 3300025942 Bacteria 2269
212 Ga0207689_10152188 3300025942 Bacteria 1907
213 Ga0207661_10021406 3300025944 Bacteria 4844
214 Ga0207661_10221085 3300025944 Bacteria 1674
215 Ga0207679_10002893 3300025945 Bacteria 10653
216 Ga0207679_10029273 3300025945 Bacteria 3833
217 Ga0207651_10341844 3300025960 Bacteria 1257
218 Ga0207712_10058210 3300025961 Bacteria 2730
219 Ga0207712_10528944 3300025961 Bacteria 1011
220 Ga0207658_10105335 3300025986 Bacteria 2218
221 Ga0207658_10599898 3300025986 Bacteria 989
222 Ga0207639_10010025 3300026041 Bacteria 6549
223 Ga0207639_10057766 3300026041 Bacteria 2981
224 Ga0207678_10119375 3300026067 Bacteria 2250
225 Ga0207702_10373900 3300026078 Bacteria 1369
226 Ga0207641_10342166 3300026088 Bacteria 1424
227 Ga0207648_10051786 3300026089 Bacteria 3588
228 Ga0207648_10088956 3300026089 Bacteria 2696
229 Ga0207676_10000899 3300026095 Bacteria 23060
230 Ga0207676_10085891 3300026095 Bacteria 2569
231 Ga0207674_10018853 3300026116 Bacteria 7484
232 Ga0207674_10113599 3300026116 Bacteria 2681
233 Ga0207675_100036610 3300026118 Unclassified 4577
234 Ga0207675_100150577 3300026118 Bacteria 2214
235 Ga0207675_100314492 3300026118 Bacteria 1528
236 Ga0207683_10139228 3300026121 Bacteria 2186
237 Ga0207683_10286598 3300026121 Bacteria 1505
238 Ga0207698_10169507 3300026142 Bacteria 1920
239 Ga0207698_10414366 3300026142 Unclassified 1291
240 Ga0207428_10049790 3300027907 Bacteria 3355
241 Ga0268265_10101519 3300028380 Bacteria 2324
242 Ga0268264_10000063 3300028381 Bacteria 301702
243 Ga0268264_10015491 3300028381 Bacteria 6250
244 Ga0268264_10055545 3300028381 Bacteria 3309
245 Ga0268264_10070557 3300028381 Bacteria 2958
246 Ga0268264_10210502 3300028381 Unclassified 1785
247 Ga0307511_10000181 3300030521 Bacteria 62420
248 Ga0307511_10044197 3300030521 Bacteria 3705
249 Ga0265327_10040061 3300031251 Bacteria 2538
250 Ga0307509_10012465 3300031507 Bacteria 10167
251 Ga0307509_10207420 3300031507 Bacteria 1789
252 Ga0307516_10000119 3300031730 Bacteria 92189
253 Ga0307507_10119517 3300033179 Bacteria 2114
254 Ga0307510_10068486 3300033180 Bacteria 3560
255 Ga0373937_0026224 3300036401 Bacteria 5265
256 Ga0373937_0039958 3300036401 Bacteria 4276
257 Ga0400487_56765 3300039110 Bacteria 3140
258 Ga0451577_0840890 3300042876 Bacteria 828
259 Ga0453684_0228818 3300044712 Bacteria 2148
260 Ga0466968_0054515 3300044735 Bacteria 1714
261 Ga0466970_0138289 3300044765 Unclassified 1341
262 Ga0466960_0044629 3300044901 Bacteria 2114
263 Ga0495638_0140556 3300046460 Bacteria 1410
264 Ga0495608_0123144 3300046511 Bacteria 1662
265 Ga0495628_0095046 3300046516 Bacteria 2303
266 Ga0495630_0002528 3300046517 Bacteria 12685
267 Ga0495643_0233006 3300046522 Unclassified 867
268 Ga0495587_0021019 3300046536 Unclassified 4026
269 Ga0495633_0017715 3300046558 Bacteria 3634
270 Ga0495634_0172657 3300046642 Bacteria 1358
271 Ga0495625_0185247 3300046660 Bacteria 1382
272 Ga0495646_0226059 3300046680 Bacteria 1010
273 Ga0495670_0032406 3300046691 Bacteria 2600
274 Ga0495672_0002893 3300047320 Bacteria 15188
275 Ga0495672_0020551 3300047320 Unclassified 4321
276 Ga0495672_0066292 3300047320 Bacteria 2061
277 Ga0496109_0186685 3300048912 Bacteria 1948
278 nmdc:mga0k408_12117_c2 3300050493 Bacteria 4006
279 nmdc:mga0k408_161019_c1 3300050493 Bacteria 1337
280 nmdc:mga0k408_68408_c1 3300050493 Bacteria 1744
281 nmdc:mga05p37_370143_c1 3300050507 Unclassified 1682
282 nmdc:mga08y16_67231_c1 3300050511 Bacteria 3739
283 Ga0500583_0000023 3300053092 Bacteria 123584
284 Ga0500568_0002550 3300053139 Bacteria 10624
285 Ga0500588_0004205 3300053146 Bacteria 3103
286 Ga0500611_000037 3300053727 Bacteria 72513
287 Ga0070669_100736494
288 SwRhRL2b_contig_3200134
289 JGI24739J22299_10001266
290 JGI24751J29686_10000822
291 JGI25151J46595_10003435
292 JGI25151J46595_10005588
293 JGI25151J46595_10037021
294 JGI25153J46596_10031382
295 JGI25153J46596_10036325
296 rootH2_10130930
297 rootL2_10382502
298 JGI25160J50197_1003189
299 JGI25160J50197_1052642
300 Ga0055526_1016328
301 Ga0055526_1027780
302 Ga0055528_1000491
303 Ga0055530_10001657
304 Ga0055541_1000181
305 Ga0055543_1002474
306 Ga0065165_1008167
307 Ga0065704_10070540
308 Ga0065704_10088065
309 Ga0070683_100034680
310 Ga0070683_100133694
311 Ga0070670_100009010
312 Ga0070670_100038347
313 Ga0068869_100014987
314 Ga0068869_100057548
315 Ga0068869_100106430
316 Ga0070666_10635256
317 Ga0070689_100072296
318 Ga0070661_100120536
319 Ga0070668_100017544
320 Ga0070668_100244801
321 Ga0070669_100110180
322 Ga0070675_100072217
323 Ga0070675_100080987
324 Ga0070675_100346918
325 Ga0070673_100381088
326 Ga0070688_100006998
327 Ga0070667_100097748
328 Ga0070667_100151099
329 Ga0070667_100314873
330 Ga0070667_100348014
331 Ga0070663_100141868
332 Ga0070678_100113162
333 Ga0070678_100158498
334 Ga0070662_100091159
335 Ga0068867_100005456
336 Ga0068867_100251095
337 Ga0070685_10025057
338 Ga0070684_100010233
339 Ga0070684_100112517
340 Ga0068853_100026318
341 Ga0068853_100048753
342 Ga0070672_100074324
343 Ga0070672_100143244
344 Ga0070672_100178185
345 Ga0070693_100115992
346 Ga0070664_100002738
347 Ga0070664_100082097
348 Ga0068857_100037069
349 Ga0068852_100193841
350 Ga0068852_100198871
351 Ga0068852_100431665
352 Ga0068859_100023102
353 Ga0068859_100127986
354 Ga0068864_100001741
355 Ga0068864_100105330
356 Ga0068864_100136401
357 Ga0068866_10063891
358 Ga0068866_10474535
359 Ga0068861_100011334
360 Ga0068870_10393182
361 Ga0068863_100134722
362 Ga0068860_100000003
363 Ga0068860_100000879
364 Ga0068860_100062851
365 Ga0068862_100002725
366 Ga0068862_100159436
367 Ga0081540_1009932
368 Ga0075366_10073535
369 Ga0075366_10269348
370 Ga0097621_100018709
371 Ga0068871_100342950
372 Ga0068865_100041413
373 Ga0068865_100166259
374 Ga0068865_100215572
375 Ga0097620_100023103
376 Ga0097620_100127985
377 Ga0105251_10286127
378 Ga0105244_10011690
379 Ga0105250_10004131
380 Ga0105250_10138767
381 Ga0105240_10000414
382 Ga0105240_10000723
383 Ga0105240_10000822
384 Ga0105240_10093844
385 Ga0111539_10053904
386 Ga0105245_11612413
387 Ga0114129_10107671
388 Ga0105243_10376124
389 Ga0105243_10557766
390 Ga0105241_10000516
391 Ga0105241_10327265
392 Ga0105242_10049778
393 Ga0105242_10475178
394 Ga0105237_10000220
395 Ga0105237_10055137
396 Ga0105238_10000678
397 Ga0105238_10123559
398 Ga0105249_10001363
399 Ga0105249_10085021
400 Ga0105249_10460048
401 Ga0105249_10486583
402 Ga0105249_10881650
403 Ga0105239_10003481
404 Ga0105239_10042759
405 Ga0105239_10128834
406 Ga0105239_10200655
407 Ga0105239_10228591
408 Ga0105239_10267098
409 Ga0105246_10130129
410 Ga0105246_10379381
411 Ga0105246_10917251
412 Ga0157370_10417370
413 Ga0157369_10121052
414 Ga0157374_10000013
415 Ga0157374_10015811
416 Ga0157374_10129057
417 Ga0157374_10157683
418 Ga0157378_10036566
419 Ga0157378_10471204
420 Ga0157378_11007016
421 Ga0163162_10000391
422 Ga0163162_10001340
423 Ga0163162_10249967
424 Ga0163162_10481053
425 Ga0163162_10635506
426 Ga0157375_10021990
427 Ga0157375_10085183
428 Ga0157375_10721465
429 Ga0163163_10001644
430 Ga0163163_10081798
431 Ga0163163_10245256
432 Ga0157380_10031146
433 Ga0157380_10838326
434 Ga0157377_10010551
435 Ga0157377_10709931
436 Ga0157379_10036244
437 Ga0157376_10022700
438 Ga0157376_10029186
439 Ga0157376_10532631
440 Ga0157376_10866893
441 Ga0209566_100042
442 Ga0209566_100175
443 Ga0209258_103573
444 Ga0209673_1000014
445 Ga0209673_1000018
446 Ga0209130_1000504
447 Ga0209130_1002695
448 Ga0209676_1008403
449 Ga0209025_1000588
450 Ga0209025_1000674
451 Ga0209025_1000965
452 Ga0209025_1001041
453 Ga0209025_1004237
454 Ga0209025_1005376
455 Ga0209564_1000465
456 Ga0209564_1002499
457 Ga0209758_1004573
458 Ga0209758_1010416
459 Ga0209050_1000177
460 Ga0207426_1002181
461 Ga0207426_1014357
462 Ga0209051_1029528
463 Ga0209257_1002645
464 Ga0207696_1004314
465 Ga0207655_1039316
466 Ga0207642_10047463
467 Ga0207647_10125262
468 Ga0207645_10014178
469 Ga0207643_10173108
470 Ga0207654_10005895
471 Ga0207695_10000169
472 Ga0207695_10000648
473 Ga0207695_10000839
474 Ga0207695_10054246
475 Ga0207671_10001433
476 Ga0207671_10007549
477 Ga0207649_10115239
478 Ga0207681_10130756
479 Ga0207694_10057566
480 Ga0207694_10101093
481 Ga0207650_10013630
482 Ga0207650_10114544
483 Ga0207650_10203398
484 Ga0207659_10058591
485 Ga0207706_10032059
486 Ga0207706_10212427
487 Ga0207686_10094257
488 Ga0207686_10141598
489 Ga0207670_10006987
490 Ga0207704_10212606
491 Ga0207691_10054623
492 Ga0207691_10101894
493 Ga0207691_10189841
494 Ga0207691_10408811
495 Ga0207689_10014539
496 Ga0207689_10108217
497 Ga0207689_10109576
498 Ga0207689_10152188
499 Ga0207661_10021406
500 Ga0207661_10221085
501 Ga0207679_10002893
502 Ga0207679_10029273
503 Ga0207651_10341844
504 Ga0207712_10058210
505 Ga0207712_10528944
506 Ga0207658_10105335
507 Ga0207658_10599898
508 Ga0207639_10010025
509 Ga0207639_10057766
510 Ga0207678_10119375
511 Ga0207702_10373900
512 Ga0207641_10342166
513 Ga0207648_10051786
514 Ga0207648_10088956
515 Ga0207676_10000899
516 Ga0207676_10085891
517 Ga0207674_10018853
518 Ga0207674_10113599
519 Ga0207675_100036610
520 Ga0207675_100150577
521 Ga0207675_100314492
522 Ga0207683_10139228
523 Ga0207683_10286598
524 Ga0207698_10169507
525 Ga0207698_10414366
526 Ga0207428_10049790
527 Ga0268265_10101519
528 Ga0268264_10000063
529 Ga0268264_10015491
530 Ga0268264_10055545
531 Ga0268264_10070557
532 Ga0268264_10210502
533 Ga0307511_10000181
534 Ga0307511_10044197
535 Ga0265327_10040061
536 Ga0307509_10012465
537 Ga0307509_10207420
538 Ga0307516_10000119
539 Ga0307507_10119517
540 Ga0307510_10068486
541 Ga0373937_0026224
542 Ga0373937_0039958
543 Ga0400487_56765
544 Ga0451577_0840890
545 Ga0453684_0228818
546 Ga0466968_0054515
547 Ga0466970_0138289
548 Ga0466960_0044629
549 Ga0495638_0140556
550 Ga0495608_0123144
551 Ga0495628_0095046
552 Ga0495630_0002528
553 Ga0495643_0233006
554 Ga0495587_0021019
555 Ga0495633_0017715
556 Ga0495634_0172657
557 Ga0495625_0185247
558 Ga0495646_0226059
559 Ga0495670_0032406
560 Ga0495672_0002893
561 Ga0495672_0020551
562 Ga0495672_0066292
563 Ga0496109_0186685
564 nmdc:mga0k408_12117_c2
565 nmdc:mga0k408_161019_c1
566 nmdc:mga0k408_68408_c1
567 nmdc:mga05p37_370143_c1
568 nmdc:mga08y16_67231_c1
569 Ga0500583_0000023
570 Ga0500568_0002550
571 Ga0500588_0004205
572 Ga0500611_000037

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13023

HD_3

HD domain

54

219

0.94

PF12917

YfbR-like

5'-deoxynucleotidase YfbR-like

49

196

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yox-assembly1.cif.gz_G hd domain-containing protein ygk1(ygl101w) 0.7087 39 190
4l7w-assembly1.cif.gz_A-2 crystal structure mutant h77a of human hd domain-containing protein 2, genomics consortium (nesg) target hr6723 0.6971 11 193
4l7e-assembly1.cif.gz_A three dimensional structure of mutant d78a of human hd domain-containing protein 2, genomics consortium (nesg) target hr6723 0.6935 17 193
4dmb-assembly1.cif.gz_A x-ray structure of human hepatitus c virus ns5a-transactivated protein 2 at the resolution 1.9a, northeast structural genomics consortium (nesg) target hr6723 0.689 3 193
4dmb-assembly1.cif.gz_A x-ray structure of human hepatitus c virus ns5a-transactivated protein 2 at the resolution 1.9a, northeast structural genomics consortium (nesg) target hr6723 0.6824 3 193
ID Description Score Start End Superfamily
af_Q6ETL6_43_228_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6861 7 188 1.10.3210.10
af_Q4E4U5_1_183_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6827 12 188 1.10.3210.10
af_E1B6Q7_2_187_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6767 9 193 1.10.3210.10
af_Q6ETL6_43_228_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6633 7 188 1.10.3210.10
3kh1B00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6617 9 194 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A1E1VN92-F1-model_v4 deleted 0.947 41 128
AF-A0A4U3AZM5-F1-model_v4 HD domain-containing protein 0.925 63 200 GO:0002953
GO:0005737
AF-A0A1E1VN92-F1-model_v4 deleted 0.9172 41 128
AF-R5YAZ2-F1-model_v4 deleted 0.8933 41 196
AF-R6IQL3-F1-model_v4 deleted 0.8769 38 196

Map