F387078

General Info

Members Datasets Scaffolds Average Seq Length
285 158 570 139

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0550498|Ga0501034_0550498_328_828
Length 166
Sequence MSATQTHNAVAKRSERFKNLQQTLVLVKPDSVQRGLIGEIVGRFERRGLAVKGLKMIHMDAARAGKLYAPHEGKPFYNDLVEYMTSGPIVALCLEGVNAIPTVRTMMGATNPAEAAPGTIRGDLAQRLDNNCVHGSDSPESAERELPIFFDAGEIVDHDPSYTHRI

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
92 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
93 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
94 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
95 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
96 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
97 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
98 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
101 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
102 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
103 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
104 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
105 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
106 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
107 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
120 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
121 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
122 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
123 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
124 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
125 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
126 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
127 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
128 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
141 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
142 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
143 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
144 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
155 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
156 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
157 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.7
Rhizosphere 99.3
Stem 0
Stem Tuber 0
Unclassified 2.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0550498 3300049571 Bacteria 1063
2 Ga0070676_11292179 3300005328 Bacteria 557
3 Ga0070683_100000016 3300005329 Bacteria 207892
4 Ga0070683_100065864 3300005329 Bacteria 3374
5 Ga0070683_100607086 3300005329 Bacteria 1047
6 Ga0070670_100638169 3300005331 Bacteria 955
7 Ga0070670_101385014 3300005331 Bacteria 645
8 Ga0068869_101050450 3300005334 Bacteria 711
9 Ga0068868_100467031 3300005338 Bacteria 1100
10 Ga0068868_100595558 3300005338 Bacteria 979
11 Ga0068868_101899043 3300005338 Bacteria 564
12 Ga0070661_100557975 3300005344 Bacteria 922
13 Ga0070671_101450746 3300005355 Bacteria 607
14 Ga0070667_101504697 3300005367 Bacteria 632
15 Ga0070709_10102434 3300005434 Bacteria 1910
16 Ga0070714_101738085 3300005435 Unclassified 609
17 Ga0070713_100050572 3300005436 Bacteria 3434
18 Ga0070708_100829032 3300005445 Bacteria 869
19 Ga0070706_100148425 3300005467 Bacteria 2189
20 Ga0070706_100874614 3300005467 Bacteria 831
21 Ga0070684_100000005 3300005535 Bacteria 230164
22 Ga0070684_100464059 3300005535 Bacteria 1171
23 Ga0070684_100592977 3300005535 Bacteria 1030
24 Ga0070697_100797996 3300005536 Bacteria 835
25 Ga0070665_100773960 3300005548 Bacteria 973
26 Ga0070665_101464005 3300005548 Bacteria 692
27 Ga0068855_100589640 3300005563 Bacteria 1200
28 Ga0068855_101996013 3300005563 Bacteria 586
29 Ga0070702_100641265 3300005615 Bacteria 802
30 Ga0068852_100255128 3300005616 Bacteria 1682
31 Ga0068864_100401202 3300005618 Bacteria 1303
32 Ga0068870_11041542 3300005840 Bacteria 585
33 Ga0068863_100073717 3300005841 Bacteria 3230
34 Ga0068863_101311320 3300005841 Bacteria 731
35 Ga0068858_100275303 3300005842 Bacteria 1602
36 Ga0068858_100684165 3300005842 Bacteria 998
37 Ga0068860_100721985 3300005843 Bacteria 1007
38 Ga0068860_101161740 3300005843 Bacteria 792
39 Ga0068860_101807158 3300005843 Bacteria 633
40 Ga0068862_101201209 3300005844 Bacteria 757
41 Ga0070717_10036822 3300006028 Bacteria 3971
42 Ga0070717_10206711 3300006028 Bacteria 1722
43 Ga0070717_11091269 3300006028 Bacteria 727
44 Ga0097621_101870820 3300006237 Bacteria 572
45 Ga0068871_100555682 3300006358 Bacteria 1040
46 Ga0068871_100852074 3300006358 Bacteria 842
47 Ga0068871_100853274 3300006358 Bacteria 842
48 Ga0075428_101630589 3300006844 Bacteria 674
49 Ga0075433_11322357 3300006852 Bacteria 624
50 Ga0068865_100550020 3300006881 Bacteria 969
51 Ga0075436_100130463 3300006914 Bacteria 1762
52 Ga0075436_101210900 3300006914 Bacteria 570
53 Ga0099795_10155626 3300007788 Bacteria 939
54 Ga0105240_10018092 3300009093 Bacteria 9475
55 Ga0105240_10027566 3300009093 Bacteria 7436
56 Ga0105240_10300851 3300009093 Bacteria 1835
57 Ga0111539_10084502 3300009094 Bacteria 3731
58 Ga0111539_11276871 3300009094 Bacteria 852
59 Ga0105245_10248021 3300009098 Bacteria 1729
60 Ga0105245_10458741 3300009098 Bacteria 1284
61 Ga0105245_10672454 3300009098 Bacteria 1067
62 Ga0105247_11079562 3300009101 Unclassified 632
63 Ga0114129_12770850 3300009147 Bacteria 583
64 Ga0105243_10952963 3300009148 Bacteria 857
65 Ga0105242_10955992 3300009176 Bacteria 861
66 Ga0105242_11724700 3300009176 Bacteria 663
67 Ga0105248_10056137 3300009177 Bacteria 4417
68 Ga0105248_10065519 3300009177 Bacteria 4079
69 Ga0105248_10375954 3300009177 Bacteria 1599
70 Ga0105248_10614288 3300009177 Bacteria 1226
71 Ga0105237_10100264 3300009545 Bacteria 2887
72 Ga0105237_10246545 3300009545 Bacteria 1788
73 Ga0105238_10451452 3300009551 Bacteria 1282
74 Ga0105238_11616965 3300009551 Bacteria 678
75 Ga0105239_10151481 3300010375 Bacteria 2588
76 Ga0105239_10216129 3300010375 Bacteria 2149
77 Ga0105239_10399085 3300010375 Bacteria 1556
78 Ga0105246_10130441 3300011119 Bacteria 1877
79 Ga0105246_11070227 3300011119 Bacteria 734
80 Ga0105246_11246168 3300011119 Bacteria 687
81 Ga0157373_10948647 3300013100 Unclassified 640
82 Ga0157369_10076447 3300013105 Bacteria 3589
83 Ga0157369_10113818 3300013105 Bacteria 2874
84 Ga0157369_10233167 3300013105 Bacteria 1924
85 Ga0157369_10560541 3300013105 Bacteria 1180
86 Ga0157374_10379158 3300013296 Bacteria 1409
87 Ga0157374_11038052 3300013296 Bacteria 839
88 Ga0157374_11096347 3300013296 Bacteria 816
89 Ga0157374_12044353 3300013296 Bacteria 599
90 Ga0157374_12338724 3300013296 Bacteria 562
91 Ga0157374_12467076 3300013296 Bacteria 547
92 Ga0157378_10611291 3300013297 Bacteria 1102
93 Ga0157378_11200635 3300013297 Bacteria 798
94 Ga0157378_11819639 3300013297 Bacteria 657
95 Ga0157378_12997529 3300013297 Bacteria 524
96 Ga0163162_10556953 3300013306 Bacteria 1274
97 Ga0163162_11256217 3300013306 Bacteria 841
98 Ga0157372_10738368 3300013307 Bacteria 1145
99 Ga0157372_11018342 3300013307 Bacteria 959
100 Ga0157375_10380008 3300013308 Bacteria 1579
101 Ga0157375_10432836 3300013308 Bacteria 1481
102 Ga0157375_10595571 3300013308 Bacteria 1265
103 Ga0163163_10023720 3300014325 Bacteria 5828
104 Ga0163163_10125023 3300014325 Bacteria 2609
105 Ga0163163_10599824 3300014325 Bacteria 1164
106 Ga0163163_10692425 3300014325 Bacteria 1083
107 Ga0163163_10811266 3300014325 Bacteria 999
108 Ga0163163_11108019 3300014325 Bacteria 855
109 Ga0163163_11622295 3300014325 Bacteria 708
110 Ga0157380_13255055 3300014326 Unclassified 519
111 Ga0157376_10272399 3300014969 Bacteria 1591
112 Ga0157376_10393419 3300014969 Bacteria 1338
113 Ga0157376_11126393 3300014969 Bacteria 811
114 Ga0157376_13130312 3300014969 Bacteria 501
115 Ga0163161_11151652 3300017792 Bacteria 669
116 Ga0206350_10154552 3300020080 Bacteria 837
117 Ga0207680_10858486 3300025903 Bacteria 651
118 Ga0207685_10837036 3300025905 Bacteria 509
119 Ga0207699_10191134 3300025906 Bacteria 1382
120 Ga0207699_10487783 3300025906 Bacteria 888
121 Ga0207699_10839875 3300025906 Bacteria 676
122 Ga0207645_11207903 3300025907 Bacteria 507
123 Ga0207643_10417655 3300025908 Bacteria 850
124 Ga0207684_10364272 3300025910 Bacteria 1244
125 Ga0207695_10025561 3300025913 Bacteria 6608
126 Ga0207695_10068123 3300025913 Bacteria 3647
127 Ga0207695_10260307 3300025913 Bacteria 1632
128 Ga0207671_10048760 3300025914 Bacteria 3134
129 Ga0207693_10395110 3300025915 Bacteria 1081
130 Ga0207694_10565866 3300025924 Bacteria 955
131 Ga0207694_10731709 3300025924 Bacteria 835
132 Ga0207650_10411655 3300025925 Bacteria 1121
133 Ga0207700_10082736 3300025928 Bacteria 2511
134 Ga0207644_10672115 3300025931 Bacteria 863
135 Ga0207686_10873138 3300025934 Bacteria 724
136 Ga0207670_11156221 3300025936 Bacteria 654
137 Ga0207665_10697750 3300025939 Bacteria 798
138 Ga0207711_10054065 3300025941 Bacteria 3444
139 Ga0207711_10100221 3300025941 Bacteria 2562
140 Ga0207711_10281294 3300025941 Bacteria 1532
141 Ga0207689_10880080 3300025942 Bacteria 756
142 Ga0207689_11090527 3300025942 Bacteria 673
143 Ga0207661_10000033 3300025944 Bacteria 156468
144 Ga0207661_10674833 3300025944 Bacteria 950
145 Ga0207667_11831652 3300025949 Bacteria 570
146 Ga0207658_11371529 3300025986 Bacteria 647
147 Ga0207677_11075888 3300026023 Bacteria 732
148 Ga0207702_10284804 3300026078 Unclassified 1563
149 Ga0207641_10026272 3300026088 Bacteria 4805
150 Ga0207641_11159501 3300026088 Bacteria 772
151 Ga0207641_11819840 3300026088 Bacteria 611
152 Ga0207648_10182866 3300026089 Bacteria 1856
153 Ga0207676_10440739 3300026095 Bacteria 1226
154 Ga0207683_11754582 3300026121 Bacteria 570
155 Ga0207698_10031940 3300026142 Bacteria 3808
156 Ga0268266_10309727 3300028379 Bacteria 1475
157 Ga0268266_10405760 3300028379 Bacteria 1289
158 Ga0268266_11063951 3300028379 Bacteria 783
159 Ga0268265_10942157 3300028380 Bacteria 850
160 Ga0268264_11650594 3300028381 Bacteria 651
161 Ga0265338_10830861 3300028800 Bacteria 632
162 Ga0265332_10207808 3300031238 Bacteria 813
163 Ga0265325_10038050 3300031241 Bacteria 2541
164 Ga0265325_10093552 3300031241 Bacteria 1479
165 Ga0265329_10214552 3300031242 Bacteria 636
166 Ga0265331_10033970 3300031250 Bacteria 2519
167 Ga0265316_10000900 3300031344 Bacteria 32550
168 Ga0265316_10022510 3300031344 Bacteria 5311
169 Ga0265316_10097601 3300031344 Bacteria 2236
170 Ga0265316_10557637 3300031344 Bacteria 815
171 Ga0265314_10128323 3300031711 Bacteria 1585
172 Ga0265342_10040591 3300031712 Bacteria 2822
173 Ga0316576_10000798 3300031727 Bacteria 15863
174 Ga0307409_102550054 3300031995 Bacteria 540
175 Ga0373926_0020458 3300035083 Bacteria 2286
176 Ga0373923_0570195 3300035111 Bacteria 556
177 Ga0373953_0175619 3300035117 Bacteria 923
178 Ga0373954_0060123 3300035118 Bacteria 1792
179 Ga0373954_0595575 3300035118 Bacteria 548
180 Ga0373943_0216827 3300035170 Bacteria 1065
181 Ga0373943_0279789 3300035170 Bacteria 943
182 Ga0373946_0494758 3300035171 Bacteria 627
183 Ga0373955_0217646 3300035172 Bacteria 1140
184 Ga0373924_0413369 3300035410 Bacteria 603
185 Ga0373935_0494352 3300035692 Bacteria 888
186 Ga0373935_1160133 3300035692 Bacteria 576
187 Ga0373935_1170339 3300035692 Bacteria 573
188 Ga0373927_0000355 3300035695 Bacteria 35764
189 Ga0373927_0477553 3300035695 Bacteria 824
190 Ga0373947_0002647 3300035725 Bacteria 10756
191 Ga0373947_0334914 3300035725 Bacteria 1014
192 Ga0373947_0344882 3300035725 Bacteria 999
193 Ga0373947_0452302 3300035725 Bacteria 870
194 Ga0373947_0823139 3300035725 Bacteria 634
195 Ga0373937_0292716 3300036401 Bacteria 1538
196 Ga0373937_0774946 3300036401 Bacteria 907
197 Ga0373937_1674194 3300036401 Bacteria 583
198 Ga0373925_0005410 3300037068 Bacteria 9515
199 Ga0373925_0375395 3300037068 Bacteria 1157
200 Ga0373925_0840426 3300037068 Bacteria 757
201 Ga0373925_1611350 3300037068 Bacteria 530
202 Ga0436362_0009344 3300039453 Unclassified 578
203 Ga0451577_1165626 3300042876 Bacteria 688
204 Ga0453683_0691258 3300044673 Bacteria 668
205 Ga0466966_0263252 3300044684 Bacteria 1038
206 Ga0466963_0923250 3300044694 Bacteria 615
207 Ga0451576_0133181 3300045051 Bacteria 2591
208 Ga0451576_0363969 3300045051 Bacteria 1515
209 Ga0495592_0016305 3300046454 Bacteria 5638
210 Ga0495592_0497505 3300046454 Bacteria 757
211 Ga0495651_0030396 3300046462 Bacteria 4212
212 Ga0495580_0001964 3300046472 Bacteria 18057
213 Ga0495580_0069830 3300046472 Bacteria 2454
214 Ga0495580_0188557 3300046472 Bacteria 1423
215 Ga0495639_0149863 3300046475 Bacteria 1125
216 Ga0495639_0229320 3300046475 Bacteria 915
217 Ga0495639_0317013 3300046475 Bacteria 779
218 Ga0495662_0449986 3300046476 Bacteria 632
219 Ga0495664_0050904 3300046477 Bacteria 2459
220 Ga0495664_0222029 3300046477 Bacteria 1144
221 Ga0495594_0026080 3300046499 Bacteria 3143
222 Ga0495608_0064160 3300046511 Bacteria 2408
223 Ga0495608_0376341 3300046511 Bacteria 871
224 Ga0495618_0042782 3300046514 Bacteria 2857
225 Ga0495618_0610311 3300046514 Bacteria 648
226 Ga0495628_0251415 3300046516 Bacteria 1320
227 Ga0495628_0374371 3300046516 Bacteria 1044
228 Ga0495630_0809612 3300046517 Unclassified 715
229 Ga0495666_0244819 3300046526 Bacteria 818
230 Ga0495652_0160602 3300046529 Bacteria 1745
231 Ga0495652_0203407 3300046529 Bacteria 1501
232 Ga0495665_0036322 3300046531 Bacteria 2631
233 Ga0495665_0119886 3300046531 Bacteria 1378
234 Ga0495665_0319311 3300046531 Bacteria 793
235 Ga0495640_0023444 3300046533 Bacteria 4496
236 Ga0495640_0301064 3300046533 Bacteria 996
237 Ga0495640_0574995 3300046533 Bacteria 682
238 Ga0495640_0707814 3300046533 Bacteria 604
239 Ga0495586_0474484 3300046535 Bacteria 721
240 Ga0495587_0020478 3300046536 Bacteria 4083
241 Ga0495587_0033646 3300046536 Bacteria 3093
242 Ga0495587_0715762 3300046536 Bacteria 548
243 Ga0495645_0004516 3300046543 Bacteria 9499
244 Ga0495645_0023859 3300046543 Bacteria 4434
245 Ga0495645_0245936 3300046543 Bacteria 1191
246 Ga0495667_0158267 3300046559 Bacteria 1457
247 Ga0495667_0237308 3300046559 Bacteria 1162
248 Ga0495634_0060516 3300046642 Bacteria 2519
249 Ga0495635_0013817 3300046663 Bacteria 5648
250 Ga0495635_0155104 3300046663 Bacteria 1559
251 Ga0495599_0136141 3300046678 Bacteria 1525
252 Ga0495599_0294437 3300046678 Bacteria 981
253 Ga0495599_0563578 3300046678 Bacteria 666
254 Ga0495623_0085821 3300046679 Bacteria 1941
255 Ga0495623_0387175 3300046679 Bacteria 755
256 Ga0495646_0200963 3300046680 Bacteria 1085
257 Ga0495658_0748833 3300046683 Bacteria 626
258 Ga0495581_0217162 3300047315 Bacteria 1118
259 Ga0495581_0451304 3300047315 Bacteria 749
260 Ga0495674_0028354 3300047319 Bacteria 5106
261 Ga0495674_0036189 3300047319 Bacteria 4446
262 Ga0495674_0102208 3300047319 Bacteria 2438
263 Ga0495674_0983271 3300047319 Bacteria 648
264 Ga0495680_0155008 3300047322 Bacteria 1667
265 Ga0495680_0196693 3300047322 Bacteria 1448
266 Ga0495675_0084772 3300047444 Bacteria 1993
267 Ga0495675_0172447 3300047444 Bacteria 1328
268 Ga0495675_0228804 3300047444 Bacteria 1123
269 Ga0495684_0039780 3300047471 Bacteria 3605
270 Ga0495684_0111025 3300047471 Bacteria 2069
271 Ga0495684_0172772 3300047471 Bacteria 1606
272 Ga0495684_0242328 3300047471 Bacteria 1314
273 Ga0495602_0026931 3300048088 Bacteria 5537
274 Ga0495602_0170837 3300048088 Bacteria 1688
275 Ga0495602_0335472 3300048088 Bacteria 1095
276 Ga0495602_0569689 3300048088 Bacteria 782
277 Ga0496104_1757621 3300048907 Bacteria 522
278 Ga0496112_0405892 3300048915 Bacteria 1302
279 Ga0501073_0000865 3300049589 Bacteria 21667
280 Ga0501080_1770455 3300049742 Unclassified 520
281 nmdc:mga08y16_77727_c1 3300050511 Bacteria 3460
282 nmdc:mga08x19_161066_c1 3300050514 Bacteria 1524
283 nmdc:mga0a205_1051385_c1 3300050515 Bacteria 661
284 Ga0495601_0113014 3300053077 Bacteria 1760
285 Ga0501082_0010506 3300060353 Bacteria 7965
286 Ga0501034_0550498
287 Ga0070676_11292179
288 Ga0070683_100000016
289 Ga0070683_100065864
290 Ga0070683_100607086
291 Ga0070670_100638169
292 Ga0070670_101385014
293 Ga0068869_101050450
294 Ga0068868_100467031
295 Ga0068868_100595558
296 Ga0068868_101899043
297 Ga0070661_100557975
298 Ga0070671_101450746
299 Ga0070667_101504697
300 Ga0070709_10102434
301 Ga0070714_101738085
302 Ga0070713_100050572
303 Ga0070708_100829032
304 Ga0070706_100148425
305 Ga0070706_100874614
306 Ga0070684_100000005
307 Ga0070684_100464059
308 Ga0070684_100592977
309 Ga0070697_100797996
310 Ga0070665_100773960
311 Ga0070665_101464005
312 Ga0068855_100589640
313 Ga0068855_101996013
314 Ga0070702_100641265
315 Ga0068852_100255128
316 Ga0068864_100401202
317 Ga0068870_11041542
318 Ga0068863_100073717
319 Ga0068863_101311320
320 Ga0068858_100275303
321 Ga0068858_100684165
322 Ga0068860_100721985
323 Ga0068860_101161740
324 Ga0068860_101807158
325 Ga0068862_101201209
326 Ga0070717_10036822
327 Ga0070717_10206711
328 Ga0070717_11091269
329 Ga0097621_101870820
330 Ga0068871_100555682
331 Ga0068871_100852074
332 Ga0068871_100853274
333 Ga0075428_101630589
334 Ga0075433_11322357
335 Ga0068865_100550020
336 Ga0075436_100130463
337 Ga0075436_101210900
338 Ga0099795_10155626
339 Ga0105240_10018092
340 Ga0105240_10027566
341 Ga0105240_10300851
342 Ga0111539_10084502
343 Ga0111539_11276871
344 Ga0105245_10248021
345 Ga0105245_10458741
346 Ga0105245_10672454
347 Ga0105247_11079562
348 Ga0114129_12770850
349 Ga0105243_10952963
350 Ga0105242_10955992
351 Ga0105242_11724700
352 Ga0105248_10056137
353 Ga0105248_10065519
354 Ga0105248_10375954
355 Ga0105248_10614288
356 Ga0105237_10100264
357 Ga0105237_10246545
358 Ga0105238_10451452
359 Ga0105238_11616965
360 Ga0105239_10151481
361 Ga0105239_10216129
362 Ga0105239_10399085
363 Ga0105246_10130441
364 Ga0105246_11070227
365 Ga0105246_11246168
366 Ga0157373_10948647
367 Ga0157369_10076447
368 Ga0157369_10113818
369 Ga0157369_10233167
370 Ga0157369_10560541
371 Ga0157374_10379158
372 Ga0157374_11038052
373 Ga0157374_11096347
374 Ga0157374_12044353
375 Ga0157374_12338724
376 Ga0157374_12467076
377 Ga0157378_10611291
378 Ga0157378_11200635
379 Ga0157378_11819639
380 Ga0157378_12997529
381 Ga0163162_10556953
382 Ga0163162_11256217
383 Ga0157372_10738368
384 Ga0157372_11018342
385 Ga0157375_10380008
386 Ga0157375_10432836
387 Ga0157375_10595571
388 Ga0163163_10023720
389 Ga0163163_10125023
390 Ga0163163_10599824
391 Ga0163163_10692425
392 Ga0163163_10811266
393 Ga0163163_11108019
394 Ga0163163_11622295
395 Ga0157380_13255055
396 Ga0157376_10272399
397 Ga0157376_10393419
398 Ga0157376_11126393
399 Ga0157376_13130312
400 Ga0163161_11151652
401 Ga0206350_10154552
402 Ga0207680_10858486
403 Ga0207685_10837036
404 Ga0207699_10191134
405 Ga0207699_10487783
406 Ga0207699_10839875
407 Ga0207645_11207903
408 Ga0207643_10417655
409 Ga0207684_10364272
410 Ga0207695_10025561
411 Ga0207695_10068123
412 Ga0207695_10260307
413 Ga0207671_10048760
414 Ga0207693_10395110
415 Ga0207694_10565866
416 Ga0207694_10731709
417 Ga0207650_10411655
418 Ga0207700_10082736
419 Ga0207644_10672115
420 Ga0207686_10873138
421 Ga0207670_11156221
422 Ga0207665_10697750
423 Ga0207711_10054065
424 Ga0207711_10100221
425 Ga0207711_10281294
426 Ga0207689_10880080
427 Ga0207689_11090527
428 Ga0207661_10000033
429 Ga0207661_10674833
430 Ga0207667_11831652
431 Ga0207658_11371529
432 Ga0207677_11075888
433 Ga0207702_10284804
434 Ga0207641_10026272
435 Ga0207641_11159501
436 Ga0207641_11819840
437 Ga0207648_10182866
438 Ga0207676_10440739
439 Ga0207683_11754582
440 Ga0207698_10031940
441 Ga0268266_10309727
442 Ga0268266_10405760
443 Ga0268266_11063951
444 Ga0268265_10942157
445 Ga0268264_11650594
446 Ga0265338_10830861
447 Ga0265332_10207808
448 Ga0265325_10038050
449 Ga0265325_10093552
450 Ga0265329_10214552
451 Ga0265331_10033970
452 Ga0265316_10000900
453 Ga0265316_10022510
454 Ga0265316_10097601
455 Ga0265316_10557637
456 Ga0265314_10128323
457 Ga0265342_10040591
458 Ga0316576_10000798
459 Ga0307409_102550054
460 Ga0373926_0020458
461 Ga0373923_0570195
462 Ga0373953_0175619
463 Ga0373954_0060123
464 Ga0373954_0595575
465 Ga0373943_0216827
466 Ga0373943_0279789
467 Ga0373946_0494758
468 Ga0373955_0217646
469 Ga0373924_0413369
470 Ga0373935_0494352
471 Ga0373935_1160133
472 Ga0373935_1170339
473 Ga0373927_0000355
474 Ga0373927_0477553
475 Ga0373947_0002647
476 Ga0373947_0334914
477 Ga0373947_0344882
478 Ga0373947_0452302
479 Ga0373947_0823139
480 Ga0373937_0292716
481 Ga0373937_0774946
482 Ga0373937_1674194
483 Ga0373925_0005410
484 Ga0373925_0375395
485 Ga0373925_0840426
486 Ga0373925_1611350
487 Ga0436362_0009344
488 Ga0451577_1165626
489 Ga0453683_0691258
490 Ga0466966_0263252
491 Ga0466963_0923250
492 Ga0451576_0133181
493 Ga0451576_0363969
494 Ga0495592_0016305
495 Ga0495592_0497505
496 Ga0495651_0030396
497 Ga0495580_0001964
498 Ga0495580_0069830
499 Ga0495580_0188557
500 Ga0495639_0149863
501 Ga0495639_0229320
502 Ga0495639_0317013
503 Ga0495662_0449986
504 Ga0495664_0050904
505 Ga0495664_0222029
506 Ga0495594_0026080
507 Ga0495608_0064160
508 Ga0495608_0376341
509 Ga0495618_0042782
510 Ga0495618_0610311
511 Ga0495628_0251415
512 Ga0495628_0374371
513 Ga0495630_0809612
514 Ga0495666_0244819
515 Ga0495652_0160602
516 Ga0495652_0203407
517 Ga0495665_0036322
518 Ga0495665_0119886
519 Ga0495665_0319311
520 Ga0495640_0023444
521 Ga0495640_0301064
522 Ga0495640_0574995
523 Ga0495640_0707814
524 Ga0495586_0474484
525 Ga0495587_0020478
526 Ga0495587_0033646
527 Ga0495587_0715762
528 Ga0495645_0004516
529 Ga0495645_0023859
530 Ga0495645_0245936
531 Ga0495667_0158267
532 Ga0495667_0237308
533 Ga0495634_0060516
534 Ga0495635_0013817
535 Ga0495635_0155104
536 Ga0495599_0136141
537 Ga0495599_0294437
538 Ga0495599_0563578
539 Ga0495623_0085821
540 Ga0495623_0387175
541 Ga0495646_0200963
542 Ga0495658_0748833
543 Ga0495581_0217162
544 Ga0495581_0451304
545 Ga0495674_0028354
546 Ga0495674_0036189
547 Ga0495674_0102208
548 Ga0495674_0983271
549 Ga0495680_0155008
550 Ga0495680_0196693
551 Ga0495675_0084772
552 Ga0495675_0172447
553 Ga0495675_0228804
554 Ga0495684_0039780
555 Ga0495684_0111025
556 Ga0495684_0172772
557 Ga0495684_0242328
558 Ga0495602_0026931
559 Ga0495602_0170837
560 Ga0495602_0335472
561 Ga0495602_0569689
562 Ga0496104_1757621
563 Ga0496112_0405892
564 Ga0501073_0000865
565 Ga0501080_1770455
566 nmdc:mga08y16_77727_c1
567 nmdc:mga08x19_161066_c1
568 nmdc:mga0a205_1051385_c1
569 Ga0495601_0113014
570 Ga0501082_0010506

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00334

NDK

Nucleoside diphosphate kinase

21

155

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nck-assembly1.cif.gz_R crystal structure of myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 angstroms resolution 0.9949 2 138
6ay1-assembly5.cif.gz_E crystal structure of a nucleoside diphosphate kinase ndk from helicobacter pylori 0.992 4 138
6aes-assembly2.cif.gz_B crystal structure of nucleoside diphosphate kinase from pseudomonas aeruginosa at 3.55 a resolution. 0.9915 1 138
5v6d-assembly3.cif.gz_F crystal structure of nucleoside diphosphate kinase from neisseria gonorrhoeae in complex with citrate 0.9906 1 138
6ay1-assembly8.cif.gz_H crystal structure of a nucleoside diphosphate kinase ndk from helicobacter pylori 0.9901 2 138
ID Description Score Start End Superfamily
6ay1G00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9876 4 138 3.30.70.141
af_Q6Z7E5_29_180_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9871 2 133 3.30.70.141
4w98A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9808 1 138 3.30.70.141
af_A4IG45_154_309_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.98 3 133 3.30.70.141
af_O88425_6_161_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9784 2 133 3.30.70.141
ID Description Score Start End GO Terms
AF-A0A0U5JAE4-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 0.9995 2 138 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-A0A538R0L5-F1-model_v4 Nucleoside-diphosphate kinase (EC 2.7.4.6) 0.9994 1 126 GO:0004550
GO:0005524
GO:0006183
GO:0006228
GO:0006241
AF-A0A2E1TJE2-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 0.9993 4 133 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-V6DH04-F1-model_v4 Nucleoside diphosphate kinase (EC 2.7.4.6) 0.9991 2 134 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-D6YS49-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 0.9986 2 138 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872

Map