F386646

General Info

Members Datasets Scaffolds Average Seq Length
285 165 570 488

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100158342|Ga0070694_1001583421
Length 528
Sequence MSARRPLTVVLASVAATAIAFAQTQTGGDVLAKIREEGLQRSQVAPVFQMLTVDIGPRLTASPAHKRAAEWTRDRLASYGLANVHLEPWKFGRGWTLEKLTVELIEPRYLPLIAYADGWSAPTSGEIVATPVFIGGKSLEEVEAMGAGLKGAIVMGQAMMTNFVRRDRPNPSAADYQPNAAAYATSVGRSNAPASPGSAATSGRPSTLREPQGRPEPGRGTTGSGQAVQTAAQRALQILRDAGAGVILRPSVGEHGTVFVTGRDGGPGATPTVTLSGEHYNMIARMLEKNIPVQLRVNVQSKFYDAEGGNAYNVIAELPGTDPVLRDEVVMIGAHLDSWHTGVGATDNADGSTTVMEAMRILKAIGARPRRTIRMALWAGEEQGLLGARAWVAQHLAGDANKAARDKFDVYFNIDNGTGPIYGWYLQNNEEVRAIFDGWLEPLKTLGARRNNIEPVGSTDHLAFIDAGVPGFNPIQDYVNYDIRTHHTNVDTNERVDEKDVQQAAIVMATFAYNAANLDRKIPHKPAR

Samples

Sample ID Description Type Environment
1 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
114 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
115 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
116 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
117 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
118 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
119 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
120 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
121 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
122 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
132 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
133 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
136 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
137 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
151 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
152 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
160 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
161 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
164 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 2.11
Rhizosphere 97.54
Stem 0
Stem Tuber 0
Unclassified 13.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070694_100158342 3300005444 Bacteria 1659
2 Ga0070658_10005691 3300005327 Bacteria 10105
3 Ga0068869_100023274 3300005334 Bacteria 4276
4 Ga0070660_100030631 3300005339 Bacteria 4036
5 Ga0070689_100029221 3300005340 Bacteria 4170
6 Ga0070689_100095295 3300005340 Unclassified 2351
7 Ga0070691_10015928 3300005341 Bacteria 3454
8 Ga0070687_100011172 3300005343 Bacteria 3917
9 Ga0070669_100015282 3300005353 Bacteria 5469
10 Ga0070675_100000227 3300005354 Bacteria 36055
11 Ga0070671_100008018 3300005355 Bacteria 8452
12 Ga0070671_100079182 3300005355 Bacteria 2746
13 Ga0070674_100008776 3300005356 Bacteria 6032
14 Ga0070688_100083722 3300005365 Bacteria 2070
15 Ga0070667_100025750 3300005367 Bacteria 4893
16 Ga0070714_100008637 3300005435 Bacteria 7968
17 Ga0070713_100019366 3300005436 Bacteria 5194
18 Ga0070705_100009317 3300005440 Bacteria 4879
19 Ga0070700_100010692 3300005441 Bacteria 5070
20 Ga0070694_100001305 3300005444 Bacteria 14495
21 Ga0070694_100008161 3300005444 Bacteria 6393
22 Ga0070681_10012027 3300005458 Bacteria 8583
23 Ga0070681_10157156 3300005458 Unclassified 2198
24 Ga0068867_100056230 3300005459 Bacteria 2910
25 Ga0070698_100005771 3300005471 Bacteria 13537
26 Ga0070698_100105825 3300005471 Bacteria 2782
27 Ga0070698_100106163 3300005471 Bacteria 2777
28 Ga0070698_100125052 3300005471 Bacteria 2529
29 Ga0070698_100138998 3300005471 Bacteria 2382
30 Ga0070699_100013413 3300005518 Bacteria 7060
31 Ga0070699_100035152 3300005518 Bacteria 4331
32 Ga0070679_100035099 3300005530 Bacteria 4974
33 Ga0070684_100195087 3300005535 Bacteria 1844
34 Ga0068853_100055447 3300005539 Unclassified 3416
35 Ga0070686_100072791 3300005544 Bacteria 2254
36 Ga0070695_100070713 3300005545 Bacteria 2283
37 Ga0070695_100097659 3300005545 Bacteria 1972
38 Ga0070696_100015694 3300005546 Bacteria 5090
39 Ga0070665_100001801 3300005548 Bacteria 24297
40 Ga0070665_100006842 3300005548 Bacteria 11598
41 Ga0070704_100003239 3300005549 Bacteria 9304
42 Ga0068855_100003423 3300005563 Bacteria 19415
43 Ga0070664_100152782 3300005564 Unclassified 2039
44 Ga0068854_100043031 3300005578 Bacteria 3199
45 Ga0068856_100047108 3300005614 Bacteria 4247
46 Ga0068859_100015562 3300005617 Bacteria 7644
47 Ga0068859_100040937 3300005617 Bacteria 4654
48 Ga0068859_100118635 3300005617 Bacteria 2711
49 Ga0068864_100004180 3300005618 Bacteria 11866
50 Ga0068864_100011282 3300005618 Bacteria 7381
51 Ga0068864_100019596 3300005618 Bacteria 5659
52 Ga0068861_100037527 3300005719 Bacteria 3602
53 Ga0068861_100078161 3300005719 Bacteria 2583
54 Ga0068861_100082214 3300005719 Bacteria 2524
55 Ga0068863_100013660 3300005841 Bacteria 7830
56 Ga0068858_100026233 3300005842 Bacteria 5417
57 Ga0068858_100095407 3300005842 Unclassified 2771
58 Ga0068858_100155336 3300005842 Bacteria 2152
59 Ga0068860_100112052 3300005843 Bacteria 2609
60 Ga0068862_100003512 3300005844 Bacteria 13459
61 Ga0097621_100002434 3300006237 Bacteria 12741
62 Ga0068871_100036325 3300006358 Bacteria 3922
63 Ga0075428_100080176 3300006844 Unclassified 3562
64 Ga0075430_100011805 3300006846 Bacteria 7435
65 Ga0075430_100018779 3300006846 Bacteria 5882
66 Ga0075431_100020663 3300006847 Bacteria 6728
67 Ga0075431_100030419 3300006847 Bacteria 5562
68 Ga0075431_100047799 3300006847 Bacteria 4412
69 Ga0075433_10009230 3300006852 Bacteria 7883
70 Ga0075433_10060444 3300006852 Bacteria 3318
71 Ga0075434_100007025 3300006871 Bacteria 10384
72 Ga0075434_100011893 3300006871 Bacteria 8230
73 Ga0075434_100016514 3300006871 Bacteria 7097
74 Ga0075434_100062947 3300006871 Bacteria 3693
75 Ga0075429_100003128 3300006880 Bacteria 14064
76 Ga0068865_100167973 3300006881 Bacteria 1679
77 Ga0075436_100003213 3300006914 Bacteria 11203
78 Ga0075436_100010693 3300006914 Bacteria 6295
79 Ga0097620_100015563 3300006931 Bacteria 7644
80 Ga0097620_100040937 3300006931 Bacteria 4654
81 Ga0097620_100118637 3300006931 Bacteria 2711
82 Ga0075435_100000057 3300007076 Bacteria 58158
83 Ga0075435_100001894 3300007076 Bacteria 13619
84 Ga0075435_100019167 3300007076 Bacteria 5217
85 Ga0075435_100035940 3300007076 Bacteria 3934
86 Ga0075435_100072407 3300007076 Bacteria 2816
87 Ga0105240_10071606 3300009093 Bacteria 4286
88 Ga0105240_10294553 3300009093 Unclassified 1859
89 Ga0111539_10001311 3300009094 Bacteria 33232
90 Ga0111539_10013147 3300009094 Bacteria 10353
91 Ga0111539_10014194 3300009094 Bacteria 9949
92 Ga0111539_10030401 3300009094 Bacteria 6564
93 Ga0111539_10121411 3300009094 Bacteria 3061
94 Ga0111539_10161116 3300009094 Bacteria 2624
95 Ga0105245_10029657 3300009098 Bacteria 4835
96 Ga0105245_10038809 3300009098 Bacteria 4238
97 Ga0105245_10038912 3300009098 Bacteria 4232
98 Ga0105245_10078503 3300009098 Bacteria 3012
99 Ga0114129_10001910 3300009147 Bacteria 28419
100 Ga0114129_10024491 3300009147 Bacteria 8552
101 Ga0114129_10068192 3300009147 Bacteria 4960
102 Ga0114129_10080662 3300009147 Bacteria 4523
103 Ga0114129_10099117 3300009147 Bacteria 4033
104 Ga0114129_10171184 3300009147 Unclassified 2961
105 Ga0114129_10179091 3300009147 Bacteria 2886
106 Ga0114129_10185093 3300009147 Bacteria 2831
107 Ga0114129_10185336 3300009147 Bacteria 2829
108 Ga0114129_10190833 3300009147 Unclassified 2782
109 Ga0114129_10242822 3300009147 Bacteria 2421
110 Ga0114129_10286502 3300009147 Bacteria 2199
111 Ga0105243_10000429 3300009148 Bacteria 43901
112 Ga0105243_10004170 3300009148 Bacteria 11463
113 Ga0105242_10007851 3300009176 Bacteria 8212
114 Ga0105242_10037161 3300009176 Unclassified 3911
115 Ga0105242_10060130 3300009176 Bacteria 3120
116 Ga0105242_10088906 3300009176 Unclassified 2596
117 Ga0105242_10125371 3300009176 Unclassified 2210
118 Ga0105248_10036287 3300009177 Bacteria 5514
119 Ga0105248_10049868 3300009177 Bacteria 4694
120 Ga0105248_10163946 3300009177 Bacteria 2506
121 Ga0105237_10013355 3300009545 Bacteria 8615
122 Ga0105249_10035111 3300009553 Unclassified 4545
123 Ga0105249_10046797 3300009553 Unclassified 3938
124 Ga0105239_10109058 3300010375 Unclassified 3067
125 Ga0157373_10083204 3300013100 Unclassified 2256
126 Ga0157378_10000047 3300013297 Bacteria 104964
127 Ga0163162_10008777 3300013306 Bacteria 9826
128 Ga0163162_10068576 3300013306 Bacteria 3598
129 Ga0157372_10080141 3300013307 Bacteria 3693
130 Ga0157372_10133391 3300013307 Bacteria 2859
131 Ga0157375_10010684 3300013308 Bacteria 8085
132 Ga0157375_10096167 3300013308 Bacteria 3034
133 Ga0163163_10010314 3300014325 Bacteria 8398
134 Ga0163163_10020841 3300014325 Bacteria 6179
135 Ga0163163_10297534 3300014325 Unclassified 1666
136 Ga0157380_10052182 3300014326 Bacteria 3237
137 Ga0157380_10097817 3300014326 Bacteria 2437
138 Ga0157380_10099968 3300014326 Unclassified 2414
139 Ga0157379_10022541 3300014968 Bacteria 5578
140 Ga0157379_10070307 3300014968 Bacteria 3131
141 Ga0207645_10014864 3300025907 Bacteria 5194
142 Ga0207705_10006089 3300025909 Bacteria 8976
143 Ga0207705_10020819 3300025909 Bacteria 4681
144 Ga0207707_10025100 3300025912 Bacteria 5213
145 Ga0207707_10196511 3300025912 Bacteria 1759
146 Ga0207695_10093441 3300025913 Bacteria 3017
147 Ga0207695_10163561 3300025913 Unclassified 2155
148 Ga0207695_10268616 3300025913 Bacteria 1602
149 Ga0207671_10017006 3300025914 Bacteria 5628
150 Ga0207662_10023265 3300025918 Bacteria 3558
151 Ga0207657_10001888 3300025919 Bacteria 22647
152 Ga0207646_10018425 3300025922 Bacteria 6513
153 Ga0207681_10125242 3300025923 Unclassified 1891
154 Ga0207650_10129950 3300025925 Bacteria 1970
155 Ga0207659_10000289 3300025926 Bacteria 30497
156 Ga0207687_10058268 3300025927 Unclassified 2717
157 Ga0207687_10140108 3300025927 Bacteria 1834
158 Ga0207700_10005130 3300025928 Bacteria 7789
159 Ga0207706_10050222 3300025933 Bacteria 3686
160 Ga0207686_10003711 3300025934 Bacteria 8188
161 Ga0207686_10037190 3300025934 Unclassified 2936
162 Ga0207709_10000725 3300025935 Bacteria 26439
163 Ga0207670_10061423 3300025936 Bacteria 2564
164 Ga0207669_10038830 3300025937 Bacteria 2745
165 Ga0207704_10027999 3300025938 Bacteria 3119
166 Ga0207691_10093458 3300025940 Unclassified 2693
167 Ga0207711_10023649 3300025941 Bacteria 5145
168 Ga0207711_10086908 3300025941 Unclassified 2742
169 Ga0207689_10013192 3300025942 Bacteria 7052
170 Ga0207689_10022945 3300025942 Bacteria 5242
171 Ga0207689_10221355 3300025942 Bacteria 1564
172 Ga0207712_10017610 3300025961 Unclassified 4644
173 Ga0207712_10051459 3300025961 Bacteria 2881
174 Ga0207712_10052804 3300025961 Bacteria 2848
175 Ga0207640_10032503 3300025981 Bacteria 3236
176 Ga0207658_10034264 3300025986 Unclassified 3628
177 Ga0207703_10070890 3300026035 Unclassified 2877
178 Ga0207639_10008250 3300026041 Bacteria 7135
179 Ga0207708_10005839 3300026075 Bacteria 9106
180 Ga0207702_10151382 3300026078 Bacteria 2110
181 Ga0207641_10000550 3300026088 Bacteria 42009
182 Ga0207641_10090437 3300026088 Unclassified 2677
183 Ga0207648_10005462 3300026089 Bacteria 12804
184 Ga0207648_10044952 3300026089 Bacteria 3874
185 Ga0207676_10007011 3300026095 Bacteria 7985
186 Ga0207676_10025869 3300026095 Bacteria 4358
187 Ga0207676_10173455 3300026095 Archaea 1881
188 Ga0207676_10179510 3300026095 Bacteria 1852
189 Ga0207674_10142226 3300026116 Bacteria 2358
190 Ga0207675_100000840 3300026118 Bacteria 30546
191 Ga0207675_100002096 3300026118 Bacteria 19789
192 Ga0207675_100113219 3300026118 Bacteria 2562
193 Ga0207675_100216752 3300026118 Bacteria 1843
194 Ga0207698_10068542 3300026142 Bacteria 2802
195 Ga0207428_10012992 3300027907 Bacteria 7292
196 Ga0268266_10163916 3300028379 Unclassified 2012
197 Ga0268265_10057457 3300028380 Bacteria 2965
198 Ga0268264_10006836 3300028381 Bacteria 9580
199 Ga0307408_100053613 3300031548 Unclassified 2913
200 Ga0307416_100057070 3300032002 Bacteria 3156
201 Ga0307411_10104976 3300032005 Bacteria 2008
202 Ga0373930_0002848 3300034816 Bacteria 2712
203 Ga0373950_0000622 3300034818 Bacteria 4401
204 Ga0373929_0001996 3300035085 Bacteria 3811
205 Ga0373949_0004408 3300035090 Bacteria 3230
206 Ga0373951_0000858 3300035091 Bacteria 8217
207 Ga0373952_0000445 3300035092 Bacteria 7185
208 Ga0373939_0000229 3300035114 Bacteria 15384
209 Ga0373960_0000006 3300035121 Bacteria 28659
210 Ga0373942_0000938 3300035207 Bacteria 7960
211 Ga0373962_0000843 3300035242 Bacteria 6998
212 Ga0373937_0017229 3300036401 Bacteria 6432
213 Ga0453683_0061870 3300044673 Unclassified 2340
214 Ga0451576_0118719 3300045051 Bacteria 2753
215 Ga0451576_0169447 3300045051 Unclassified 2279
216 Ga0495592_0047243 3300046454 Bacteria 3206
217 Ga0495628_0029397 3300046516 Bacteria 4456
218 Ga0495628_0061504 3300046516 Bacteria 2945
219 Ga0495587_0027282 3300046536 Bacteria 3478
220 Ga0495645_0001180 3300046543 Bacteria 17820
221 Ga0495667_0008183 3300046559 Bacteria 7096
222 Ga0495635_0019211 3300046663 Bacteria 4768
223 Ga0495599_0066726 3300046678 Bacteria 2248
224 Ga0495623_0065956 3300046679 Bacteria 2263
225 Ga0495658_0032114 3300046683 Bacteria 2865
226 Ga0495600_0023290 3300046809 Bacteria 3983
227 Ga0495604_0018021 3300047317 Bacteria 5651
228 Ga0495636_0013430 3300047318 Bacteria 3251
229 Ga0495674_0014199 3300047319 Bacteria 7459
230 Ga0495674_0048222 3300047319 Bacteria 3771
231 Ga0495675_0015108 3300047444 Unclassified 4881
232 Ga0495684_0064006 3300047471 Bacteria 2795
233 Ga0496104_0035578 3300048907 Bacteria 4650
234 Ga0496106_0008250 3300048909 Bacteria 7701
235 Ga0496108_0018543 3300048911 Bacteria 5699
236 Ga0496112_0005582 3300048915 Bacteria 10910
237 Ga0496112_0075060 3300048915 Bacteria 3344
238 Ga0496115_0118535 3300048918 Unclassified 2177
239 Ga0501034_0005014 3300049571 Bacteria 14557
240 Ga0501034_0089048 3300049571 Bacteria 3084
241 Ga0501040_0015909 3300049576 Bacteria 4973
242 Ga0501047_0022863 3300049581 Bacteria 6002
243 Ga0501072_0020791 3300049588 Bacteria 5087
244 Ga0501076_0094300 3300049592 Bacteria 2410
245 Ga0501077_0089146 3300049593 Bacteria 1955
246 Ga0501081_0084292 3300049743 Bacteria 2229
247 Ga0501044_0064969 3300049823 Bacteria 3722
248 nmdc:mga05p37_140294_c1 3300050507 Unclassified 2961
249 nmdc:mga05p37_176044_c1 3300050507 Bacteria 2606
250 nmdc:mga05p37_263263_c1 3300050507 Bacteria 2063
251 nmdc:mga05p37_44420_c1 3300050507 Bacteria 5466
252 nmdc:mga05p37_47964_c1 3300050507 Bacteria 5253
253 nmdc:mga05p37_56785_c1 3300050507 Bacteria 4820
254 nmdc:mga05p37_7777_c1 3300050507 Bacteria 9521
255 nmdc:mga09592_126239_c1 3300050508 Bacteria 2199
256 nmdc:mga0qj67_57404_c1 3300050509 Bacteria 3086
257 nmdc:mga06r32_27226_c1 3300050510 Bacteria 5338
258 nmdc:mga06r32_58912_c1 3300050510 Bacteria 3692
259 nmdc:mga06r32_76201_c1 3300050510 Bacteria 3257
260 nmdc:mga06r32_98789_c1 3300050510 Bacteria 2862
261 nmdc:mga08y16_11831_c1 3300050511 Bacteria 9166
262 nmdc:mga08y16_151626_c1 3300050511 Bacteria 2409
263 nmdc:mga08y16_15789_c1 3300050511 Bacteria 7940
264 nmdc:mga0n895_15652_c1 3300050512 Bacteria 6926
265 nmdc:mga0n895_166997_c1 3300050512 Bacteria 2233
266 nmdc:mga0n895_218616_c1 3300050512 Bacteria 1935
267 nmdc:mga0n895_29785_c1 3300050512 Bacteria 5209
268 nmdc:mga0n895_38_c1 3300050512 Bacteria 76202
269 nmdc:mga0n895_59746_c1 3300050512 Bacteria 3761
270 nmdc:mga0n895_63415_c1 3300050512 Bacteria 3654
271 nmdc:mga0rr50_110505_c1 3300050513 Unclassified 2174
272 nmdc:mga0rr50_2_c1 3300050513 Bacteria 373938
273 nmdc:mga0rr50_30877_c1 3300050513 Bacteria 3799
274 nmdc:mga0rr50_57275_c1 3300050513 Unclassified 2915
275 nmdc:mga08x19_795_c1 3300050514 Bacteria 20152
276 nmdc:mga08x19_88553_c1 3300050514 Unclassified 2041
277 nmdc:mga08x19_9232_c1 3300050514 Bacteria 5893
278 nmdc:mga0a205_121698_c1 3300050515 Bacteria 2509
279 nmdc:mga0a205_20258_c1 3300050515 Bacteria 6274
280 nmdc:mga0a205_26368_c1 3300050515 Bacteria 5542
281 nmdc:mga0a205_46184_c1 3300050515 Bacteria 4200
282 nmdc:mga0a205_77326_c1 3300050515 Unclassified 3215
283 Ga0495601_0024300 3300053077 Bacteria 3732
284 Ga0500568_0014133 3300053139 Bacteria 3615
285 Ga0501082_0199259 3300060353 Bacteria 1742
286 Ga0070694_100158342
287 Ga0070658_10005691
288 Ga0068869_100023274
289 Ga0070660_100030631
290 Ga0070689_100029221
291 Ga0070689_100095295
292 Ga0070691_10015928
293 Ga0070687_100011172
294 Ga0070669_100015282
295 Ga0070675_100000227
296 Ga0070671_100008018
297 Ga0070671_100079182
298 Ga0070674_100008776
299 Ga0070688_100083722
300 Ga0070667_100025750
301 Ga0070714_100008637
302 Ga0070713_100019366
303 Ga0070705_100009317
304 Ga0070700_100010692
305 Ga0070694_100001305
306 Ga0070694_100008161
307 Ga0070681_10012027
308 Ga0070681_10157156
309 Ga0068867_100056230
310 Ga0070698_100005771
311 Ga0070698_100105825
312 Ga0070698_100106163
313 Ga0070698_100125052
314 Ga0070698_100138998
315 Ga0070699_100013413
316 Ga0070699_100035152
317 Ga0070679_100035099
318 Ga0070684_100195087
319 Ga0068853_100055447
320 Ga0070686_100072791
321 Ga0070695_100070713
322 Ga0070695_100097659
323 Ga0070696_100015694
324 Ga0070665_100001801
325 Ga0070665_100006842
326 Ga0070704_100003239
327 Ga0068855_100003423
328 Ga0070664_100152782
329 Ga0068854_100043031
330 Ga0068856_100047108
331 Ga0068859_100015562
332 Ga0068859_100040937
333 Ga0068859_100118635
334 Ga0068864_100004180
335 Ga0068864_100011282
336 Ga0068864_100019596
337 Ga0068861_100037527
338 Ga0068861_100078161
339 Ga0068861_100082214
340 Ga0068863_100013660
341 Ga0068858_100026233
342 Ga0068858_100095407
343 Ga0068858_100155336
344 Ga0068860_100112052
345 Ga0068862_100003512
346 Ga0097621_100002434
347 Ga0068871_100036325
348 Ga0075428_100080176
349 Ga0075430_100011805
350 Ga0075430_100018779
351 Ga0075431_100020663
352 Ga0075431_100030419
353 Ga0075431_100047799
354 Ga0075433_10009230
355 Ga0075433_10060444
356 Ga0075434_100007025
357 Ga0075434_100011893
358 Ga0075434_100016514
359 Ga0075434_100062947
360 Ga0075429_100003128
361 Ga0068865_100167973
362 Ga0075436_100003213
363 Ga0075436_100010693
364 Ga0097620_100015563
365 Ga0097620_100040937
366 Ga0097620_100118637
367 Ga0075435_100000057
368 Ga0075435_100001894
369 Ga0075435_100019167
370 Ga0075435_100035940
371 Ga0075435_100072407
372 Ga0105240_10071606
373 Ga0105240_10294553
374 Ga0111539_10001311
375 Ga0111539_10013147
376 Ga0111539_10014194
377 Ga0111539_10030401
378 Ga0111539_10121411
379 Ga0111539_10161116
380 Ga0105245_10029657
381 Ga0105245_10038809
382 Ga0105245_10038912
383 Ga0105245_10078503
384 Ga0114129_10001910
385 Ga0114129_10024491
386 Ga0114129_10068192
387 Ga0114129_10080662
388 Ga0114129_10099117
389 Ga0114129_10171184
390 Ga0114129_10179091
391 Ga0114129_10185093
392 Ga0114129_10185336
393 Ga0114129_10190833
394 Ga0114129_10242822
395 Ga0114129_10286502
396 Ga0105243_10000429
397 Ga0105243_10004170
398 Ga0105242_10007851
399 Ga0105242_10037161
400 Ga0105242_10060130
401 Ga0105242_10088906
402 Ga0105242_10125371
403 Ga0105248_10036287
404 Ga0105248_10049868
405 Ga0105248_10163946
406 Ga0105237_10013355
407 Ga0105249_10035111
408 Ga0105249_10046797
409 Ga0105239_10109058
410 Ga0157373_10083204
411 Ga0157378_10000047
412 Ga0163162_10008777
413 Ga0163162_10068576
414 Ga0157372_10080141
415 Ga0157372_10133391
416 Ga0157375_10010684
417 Ga0157375_10096167
418 Ga0163163_10010314
419 Ga0163163_10020841
420 Ga0163163_10297534
421 Ga0157380_10052182
422 Ga0157380_10097817
423 Ga0157380_10099968
424 Ga0157379_10022541
425 Ga0157379_10070307
426 Ga0207645_10014864
427 Ga0207705_10006089
428 Ga0207705_10020819
429 Ga0207707_10025100
430 Ga0207707_10196511
431 Ga0207695_10093441
432 Ga0207695_10163561
433 Ga0207695_10268616
434 Ga0207671_10017006
435 Ga0207662_10023265
436 Ga0207657_10001888
437 Ga0207646_10018425
438 Ga0207681_10125242
439 Ga0207650_10129950
440 Ga0207659_10000289
441 Ga0207687_10058268
442 Ga0207687_10140108
443 Ga0207700_10005130
444 Ga0207706_10050222
445 Ga0207686_10003711
446 Ga0207686_10037190
447 Ga0207709_10000725
448 Ga0207670_10061423
449 Ga0207669_10038830
450 Ga0207704_10027999
451 Ga0207691_10093458
452 Ga0207711_10023649
453 Ga0207711_10086908
454 Ga0207689_10013192
455 Ga0207689_10022945
456 Ga0207689_10221355
457 Ga0207712_10017610
458 Ga0207712_10051459
459 Ga0207712_10052804
460 Ga0207640_10032503
461 Ga0207658_10034264
462 Ga0207703_10070890
463 Ga0207639_10008250
464 Ga0207708_10005839
465 Ga0207702_10151382
466 Ga0207641_10000550
467 Ga0207641_10090437
468 Ga0207648_10005462
469 Ga0207648_10044952
470 Ga0207676_10007011
471 Ga0207676_10025869
472 Ga0207676_10173455
473 Ga0207676_10179510
474 Ga0207674_10142226
475 Ga0207675_100000840
476 Ga0207675_100002096
477 Ga0207675_100113219
478 Ga0207675_100216752
479 Ga0207698_10068542
480 Ga0207428_10012992
481 Ga0268266_10163916
482 Ga0268265_10057457
483 Ga0268264_10006836
484 Ga0307408_100053613
485 Ga0307416_100057070
486 Ga0307411_10104976
487 Ga0373930_0002848
488 Ga0373950_0000622
489 Ga0373929_0001996
490 Ga0373949_0004408
491 Ga0373951_0000858
492 Ga0373952_0000445
493 Ga0373939_0000229
494 Ga0373960_0000006
495 Ga0373942_0000938
496 Ga0373962_0000843
497 Ga0373937_0017229
498 Ga0453683_0061870
499 Ga0451576_0118719
500 Ga0451576_0169447
501 Ga0495592_0047243
502 Ga0495628_0029397
503 Ga0495628_0061504
504 Ga0495587_0027282
505 Ga0495645_0001180
506 Ga0495667_0008183
507 Ga0495635_0019211
508 Ga0495599_0066726
509 Ga0495623_0065956
510 Ga0495658_0032114
511 Ga0495600_0023290
512 Ga0495604_0018021
513 Ga0495636_0013430
514 Ga0495674_0014199
515 Ga0495674_0048222
516 Ga0495675_0015108
517 Ga0495684_0064006
518 Ga0496104_0035578
519 Ga0496106_0008250
520 Ga0496108_0018543
521 Ga0496112_0005582
522 Ga0496112_0075060
523 Ga0496115_0118535
524 Ga0501034_0005014
525 Ga0501034_0089048
526 Ga0501040_0015909
527 Ga0501047_0022863
528 Ga0501072_0020791
529 Ga0501076_0094300
530 Ga0501077_0089146
531 Ga0501081_0084292
532 Ga0501044_0064969
533 nmdc:mga05p37_140294_c1
534 nmdc:mga05p37_176044_c1
535 nmdc:mga05p37_263263_c1
536 nmdc:mga05p37_44420_c1
537 nmdc:mga05p37_47964_c1
538 nmdc:mga05p37_56785_c1
539 nmdc:mga05p37_7777_c1
540 nmdc:mga09592_126239_c1
541 nmdc:mga0qj67_57404_c1
542 nmdc:mga06r32_27226_c1
543 nmdc:mga06r32_58912_c1
544 nmdc:mga06r32_76201_c1
545 nmdc:mga06r32_98789_c1
546 nmdc:mga08y16_11831_c1
547 nmdc:mga08y16_151626_c1
548 nmdc:mga08y16_15789_c1
549 nmdc:mga0n895_15652_c1
550 nmdc:mga0n895_166997_c1
551 nmdc:mga0n895_218616_c1
552 nmdc:mga0n895_29785_c1
553 nmdc:mga0n895_38_c1
554 nmdc:mga0n895_59746_c1
555 nmdc:mga0n895_63415_c1
556 nmdc:mga0rr50_110505_c1
557 nmdc:mga0rr50_2_c1
558 nmdc:mga0rr50_30877_c1
559 nmdc:mga0rr50_57275_c1
560 nmdc:mga08x19_795_c1
561 nmdc:mga08x19_88553_c1
562 nmdc:mga08x19_9232_c1
563 nmdc:mga0a205_121698_c1
564 nmdc:mga0a205_20258_c1
565 nmdc:mga0a205_26368_c1
566 nmdc:mga0a205_46184_c1
567 nmdc:mga0a205_77326_c1
568 Ga0495601_0024300
569 Ga0500568_0014133
570 Ga0501082_0199259

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04389

Peptidase_M28

Peptidase family M28

313

512

0.81

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

335

514

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
2anp-assembly1.cif.gz_A functional glutamate 151 to histidine mutant of the aminopeptidase from aeromonas proteolytica. 0.7948 265 476
6esl-assembly1.cif.gz_A crystal structure of the legionella pneumoppila lapa 0.7862 269 474
6ica-assembly2.cif.gz_B the crystal structure of legionella pneumophila lapa aminopeptidase 0.7862 269 476
3iib-assembly1.cif.gz_A-2 crystal structure of peptidase m28 precursor (yp_926796.1) from shewanella amazonensis sb2b at 1.70 a resolution 0.7853 24 482
6esl-assembly1.cif.gz_B crystal structure of the legionella pneumoppila lapa 0.7846 269 474
ID Description Score Start End Superfamily
3iibA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.861 24 482 3.40.630.10
3iibA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8473 24 482 3.40.630.10
1cp6A00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8004 269 476 3.40.630.10
af_Q5AA00_122_414_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.794 265 475 3.40.630.10
af_P37302_266_505_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.783 271 476 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A7W0LD96-F1-model_v4 Carboxypeptidase Q (Plasma glutamate carboxypeptidase) 0.9534 20 383 GO:0004180
GO:0005576
GO:0005764
GO:0070573
AF-A0A7C7PGW4-F1-model_v4 deleted 0.9464 271 483
AF-A0A2V8ICG9-F1-model_v4 Carboxypeptidase Q (Plasma glutamate carboxypeptidase) 0.9448 261 482 GO:0004180
GO:0005576
GO:0005764
GO:0070573
AF-A0A7X4FUV2-F1-model_v4 Carboxypeptidase Q (Plasma glutamate carboxypeptidase) 0.9448 271 484 GO:0004180
GO:0005576
GO:0005764
GO:0070573
AF-A0A7Y3MX03-F1-model_v4 Carboxypeptidase Q (Plasma glutamate carboxypeptidase) 0.9434 316 480 GO:0004180
GO:0005576
GO:0005764
GO:0070573

Map