F386460

General Info

Members Datasets Scaffolds Average Seq Length
284 171 568 241

Family's Representative Sequence

Representative Sequence 3300050513|nmdc:mga0rr50_1202_c1|nmdc:mga0rr50_1202_c1_12222_13061
Length 279
Sequence VVTGPRKHEATKTHEHDFVFKKEMRESLCSRVFVAPGVSDSVTVHRRQTLTEVRDAIVSCDRCARLRTYCAEVARVKRRAFRDEIYWGKPVPGFGDPQARMVLVGLAPAAHGANRTGRVFTGDGPNGSGDFLMAALHRAGFANIPTARHPDDGLQLRDAFIAAAVRCAPPDNKPTTDEIANCLPHLDAELAALPNVRVVVALGRIGFDAYLQLLKRRGVTIRPKPLFGHAAVHRLPNGQTLIGCYHPSRQNTNTGKLDGTMMDEVFVRAARALRYKYVR

Samples

Sample ID Description Type Environment
1 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
110 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
111 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
112 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
113 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
114 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
115 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
116 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
117 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
118 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
119 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
120 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
121 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
122 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
123 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
124 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
125 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
126 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
127 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
137 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
156 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
157 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
168 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.11
Rhizosphere 97.89
Stem 0
Stem Tuber 0
Unclassified 2.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0rr50_1202_c1 3300050513 Bacteria 14056
2 JGI25406J46586_10000536 3300003203 Bacteria 17741
3 Ga0065712_10072559 3300005290 Bacteria 4706
4 Ga0070676_10010150 3300005328 Bacteria 5104
5 Ga0070682_100504301 3300005337 Unclassified 938
6 Ga0068868_100189784 3300005338 Bacteria 1709
7 Ga0070660_100001981 3300005339 Bacteria 14130
8 Ga0070660_100300927 3300005339 Bacteria 1315
9 Ga0070689_100029163 3300005340 Bacteria 4174
10 Ga0070687_100048356 3300005343 Bacteria 2187
11 Ga0070692_10338533 3300005345 Bacteria 931
12 Ga0070669_100011932 3300005353 Bacteria 6164
13 Ga0070675_100001400 3300005354 Bacteria 17695
14 Ga0070675_100004078 3300005354 Bacteria 11088
15 Ga0070673_100039434 3300005364 Bacteria 3614
16 Ga0070688_100087585 3300005365 Bacteria 2028
17 Ga0070688_100232840 3300005365 Bacteria 1304
18 Ga0070709_10058524 3300005434 Bacteria 2444
19 Ga0070710_10434919 3300005437 Unclassified 886
20 Ga0070701_10014286 3300005438 Bacteria 3637
21 Ga0070705_100125928 3300005440 Bacteria 1663
22 Ga0070705_100344629 3300005440 Bacteria 1084
23 Ga0070700_100068633 3300005441 Bacteria 2255
24 Ga0070700_100259434 3300005441 Bacteria 1251
25 Ga0070694_100138497 3300005444 Bacteria 1765
26 Ga0070708_100374258 3300005445 Bacteria 1343
27 Ga0068867_100109648 3300005459 Bacteria 2119
28 Ga0070685_10229534 3300005466 Bacteria 1220
29 Ga0070706_100390299 3300005467 Bacteria 1296
30 Ga0070699_100008889 3300005518 Bacteria 8700
31 Ga0070699_100012742 3300005518 Bacteria 7246
32 Ga0070699_100123916 3300005518 Bacteria 2274
33 Ga0070697_100326939 3300005536 Bacteria 1321
34 Ga0070672_100015934 3300005543 Bacteria 5368
35 Ga0070672_100170073 3300005543 Bacteria 1812
36 Ga0070672_100191421 3300005543 Bacteria 1708
37 Ga0070686_100207312 3300005544 Bacteria 1409
38 Ga0070695_100078079 3300005545 Bacteria 2182
39 Ga0070696_100022878 3300005546 Bacteria 4249
40 Ga0070665_100975031 3300005548 Bacteria 860
41 Ga0070704_100141024 3300005549 Bacteria 1882
42 Ga0068855_100058770 3300005563 Bacteria 4501
43 Ga0068854_100049423 3300005578 Bacteria 3004
44 Ga0068856_100164882 3300005614 Unclassified 2227
45 Ga0068859_101087176 3300005617 Bacteria 879
46 Ga0068864_100042681 3300005618 Bacteria 3881
47 Ga0068866_10066080 3300005718 Bacteria 1894
48 Ga0068861_100235787 3300005719 Bacteria 1554
49 Ga0068861_100415681 3300005719 Bacteria 1197
50 Ga0068861_100463065 3300005719 Bacteria 1138
51 Ga0068870_10100713 3300005840 Bacteria 1632
52 Ga0068863_100130688 3300005841 Bacteria 2398
53 Ga0068863_100188475 3300005841 Bacteria 1982
54 Ga0068863_100484291 3300005841 Bacteria 1217
55 Ga0068863_100732864 3300005841 Bacteria 984
56 Ga0068858_100015009 3300005842 Bacteria 7289
57 Ga0068858_100109871 3300005842 Bacteria 2574
58 Ga0068858_100519999 3300005842 Bacteria 1151
59 Ga0068860_100037830 3300005843 Bacteria 4618
60 Ga0068860_100605605 3300005843 Bacteria 1101
61 Ga0068862_100140045 3300005844 Bacteria 2146
62 Ga0081539_10000084 3300005985 Bacteria 218801
63 Ga0081539_10003287 3300005985 Bacteria 20253
64 Ga0070717_10671095 3300006028 Unclassified 941
65 Ga0097621_100480555 3300006237 Bacteria 1123
66 Ga0075428_100690369 3300006844 Bacteria 1088
67 Ga0075430_100000214 3300006846 Bacteria 39791
68 Ga0075431_100035074 3300006847 Bacteria 5167
69 Ga0075433_10001660 3300006852 Bacteria 16551
70 Ga0075433_10113030 3300006852 Bacteria 2409
71 Ga0075433_10343139 3300006852 Bacteria 1320
72 Ga0075433_10526832 3300006852 Bacteria 1039
73 Ga0075434_100002478 3300006871 Bacteria 16249
74 Ga0075434_100006901 3300006871 Bacteria 10462
75 Ga0075434_100009501 3300006871 Bacteria 9071
76 Ga0075434_100426523 3300006871 Bacteria 1347
77 Ga0075429_100013412 3300006880 Bacteria 7107
78 Ga0068865_100005724 3300006881 Bacteria 7554
79 Ga0075436_100011744 3300006914 Bacteria 6013
80 Ga0075436_100016726 3300006914 Bacteria 5020
81 Ga0075436_100135374 3300006914 Bacteria 1729
82 Ga0075436_100140283 3300006914 Bacteria 1698
83 Ga0075436_100262609 3300006914 Bacteria 1231
84 Ga0097620_101087256 3300006931 Bacteria 879
85 Ga0075435_100001102 3300007076 Bacteria 17190
86 Ga0075435_100002602 3300007076 Bacteria 12043
87 Ga0075435_100014585 3300007076 Bacteria 5880
88 Ga0075435_100049994 3300007076 Bacteria 3363
89 Ga0075435_100203113 3300007076 Bacteria 1679
90 Ga0075435_100415733 3300007076 Bacteria 1158
91 Ga0075435_100457219 3300007076 Bacteria 1101
92 Ga0111539_10004988 3300009094 Bacteria 17270
93 Ga0111539_10030995 3300009094 Bacteria 6497
94 Ga0111539_10155693 3300009094 Bacteria 2674
95 Ga0111539_10285372 3300009094 Bacteria 1921
96 Ga0111539_10653330 3300009094 Bacteria 1225
97 Ga0105245_10069162 3300009098 Bacteria 3201
98 Ga0105245_10468163 3300009098 Bacteria 1272
99 Ga0105245_10961653 3300009098 Bacteria 897
100 Ga0105247_10216008 3300009101 Bacteria 1296
101 Ga0105247_10270275 3300009101 Bacteria 1169
102 Ga0114129_10030708 3300009147 Bacteria 7599
103 Ga0114129_10038252 3300009147 Bacteria 6770
104 Ga0114129_10044701 3300009147 Bacteria 6231
105 Ga0114129_10063793 3300009147 Bacteria 5142
106 Ga0114129_10084672 3300009147 Bacteria 4402
107 Ga0114129_10161423 3300009147 Bacteria 3061
108 Ga0114129_10162656 3300009147 Bacteria 3048
109 Ga0114129_10503069 3300009147 Bacteria 1582
110 Ga0114129_11244608 3300009147 Bacteria 925
111 Ga0105243_10282356 3300009148 Bacteria 1496
112 Ga0105248_10008538 3300009177 Bacteria 11245
113 Ga0105248_10034449 3300009177 Bacteria 5662
114 Ga0105248_10208060 3300009177 Bacteria 2204
115 Ga0105248_11038264 3300009177 Bacteria 926
116 Ga0105248_11487783 3300009177 Bacteria 766
117 Ga0105239_10831759 3300010375 Bacteria 1058
118 Ga0157375_10391185 3300013308 Bacteria 1557
119 Ga0163163_10010151 3300014325 Bacteria 8449
120 Ga0163163_10010553 3300014325 Bacteria 8314
121 Ga0163163_10067968 3300014325 Bacteria 3545
122 Ga0163163_10210516 3300014325 Bacteria 1993
123 Ga0157380_10260974 3300014326 Bacteria 1574
124 Ga0157380_11077734 3300014326 Bacteria 841
125 Ga0157377_10033194 3300014745 Bacteria 2816
126 Ga0157379_10026170 3300014968 Bacteria 5192
127 Ga0207682_10031162 3300025893 Bacteria 2139
128 Ga0207642_10017985 3300025899 Bacteria 2702
129 Ga0207710_10015014 3300025900 Bacteria 3271
130 Ga0207710_10147302 3300025900 Bacteria 1140
131 Ga0207688_10218558 3300025901 Bacteria 1147
132 Ga0207699_10120696 3300025906 Bacteria 1695
133 Ga0207645_10003917 3300025907 Bacteria 11116
134 Ga0207643_10155305 3300025908 Bacteria 1374
135 Ga0207684_10489898 3300025910 Bacteria 1054
136 Ga0207663_10599594 3300025916 Bacteria 865
137 Ga0207662_10065325 3300025918 Bacteria 2191
138 Ga0207681_10056684 3300025923 Bacteria 2673
139 Ga0207681_10077024 3300025923 Bacteria 2343
140 Ga0207650_10209533 3300025925 Bacteria 1565
141 Ga0207650_10554030 3300025925 Bacteria 964
142 Ga0207659_10010439 3300025926 Bacteria 5838
143 Ga0207659_10028096 3300025926 Bacteria 3818
144 Ga0207664_10158931 3300025929 Bacteria 1926
145 Ga0207644_10385268 3300025931 Bacteria 1144
146 Ga0207686_10007048 3300025934 Bacteria 6047
147 Ga0207691_10167971 3300025940 Bacteria 1922
148 Ga0207691_10289342 3300025940 Bacteria 1409
149 Ga0207711_10005475 3300025941 Bacteria 10733
150 Ga0207711_10220829 3300025941 Bacteria 1733
151 Ga0207711_10402760 3300025941 Unclassified 1271
152 Ga0207689_10000699 3300025942 Bacteria 32122
153 Ga0207679_10011832 3300025945 Bacteria 5671
154 Ga0207679_10251316 3300025945 Bacteria 1503
155 Ga0207651_10026835 3300025960 Bacteria 3606
156 Ga0207651_10134554 3300025960 Bacteria 1899
157 Ga0207640_10057183 3300025981 Bacteria 2564
158 Ga0207703_10037512 3300026035 Bacteria 3861
159 Ga0207703_10229863 3300026035 Bacteria 1662
160 Ga0207703_10237320 3300026035 Bacteria 1637
161 Ga0207703_10262883 3300026035 Bacteria 1560
162 Ga0207703_10304166 3300026035 Bacteria 1455
163 Ga0207639_10154111 3300026041 Bacteria 1928
164 Ga0207708_10008342 3300026075 Bacteria 7673
165 Ga0207708_10317654 3300026075 Bacteria 1270
166 Ga0207708_10325925 3300026075 Bacteria 1254
167 Ga0207641_10066515 3300026088 Bacteria 3085
168 Ga0207641_10206414 3300026088 Bacteria 1815
169 Ga0207641_10234491 3300026088 Bacteria 1707
170 Ga0207641_10245817 3300026088 Bacteria 1669
171 Ga0207641_10462197 3300026088 Bacteria 1228
172 Ga0207648_10000406 3300026089 Bacteria 47912
173 Ga0207648_10135074 3300026089 Bacteria 2173
174 Ga0207676_10032929 3300026095 Bacteria 3912
175 Ga0207676_10037042 3300026095 Bacteria 3714
176 Ga0207675_100037659 3300026118 Bacteria 4512
177 Ga0207675_100052802 3300026118 Bacteria 3792
178 Ga0207675_100121436 3300026118 Bacteria 2472
179 Ga0207675_100166903 3300026118 Bacteria 2103
180 Ga0207675_100497124 3300026118 Bacteria 1214
181 Ga0207683_10037027 3300026121 Bacteria 4249
182 Ga0207428_10024072 3300027907 Bacteria 5112
183 Ga0207428_10106377 3300027907 Bacteria 2163
184 Ga0268265_10170494 3300028380 Bacteria 1859
185 Ga0268264_10467584 3300028381 Bacteria 1224
186 Ga0268264_10492076 3300028381 Bacteria 1195
187 Ga0268264_10603581 3300028381 Bacteria 1082
188 Ga0307405_10007720 3300031731 Bacteria 5407
189 Ga0307413_10106656 3300031824 Bacteria 1865
190 Ga0307410_10008499 3300031852 Bacteria 5696
191 Ga0307407_10004170 3300031903 Bacteria 6092
192 Ga0307409_100217531 3300031995 Bacteria 1722
193 Ga0307411_10136062 3300032005 Bacteria 1804
194 Ga0373930_0001544 3300034816 Bacteria 3449
195 Ga0373948_0001519 3300034817 Bacteria 3242
196 Ga0373950_0000454 3300034818 Bacteria 5021
197 Ga0373958_0009495 3300034819 Bacteria 1602
198 Ga0373959_0001475 3300034820 Bacteria 3757
199 Ga0373938_0001595 3300034957 Bacteria 3645
200 Ga0373929_0001745 3300035085 Bacteria 4089
201 Ga0373940_0001159 3300035088 Bacteria 4620
202 Ga0373949_0001742 3300035090 Bacteria 6012
203 Ga0373951_0001595 3300035091 Bacteria 5949
204 Ga0373952_0000300 3300035092 Bacteria 8234
205 Ga0373932_0000266 3300035112 Bacteria 15761
206 Ga0373939_0000560 3300035114 Bacteria 9295
207 Ga0373941_0000826 3300035115 Bacteria 6366
208 Ga0373960_0001964 3300035121 Bacteria 4608
209 Ga0373955_0178643 3300035172 Bacteria 1259
210 Ga0373942_0001954 3300035207 Bacteria 5155
211 Ga0373961_0000668 3300035241 Bacteria 12146
212 Ga0373962_0023130 3300035242 Bacteria 1653
213 Ga0373931_0001252 3300035691 Bacteria 10842
214 Ga0373935_0789127 3300035692 Bacteria 701
215 Ga0373937_0341381 3300036401 Bacteria 1418
216 Ga0451576_0004446 3300045051 Bacteria 18204
217 Ga0466958_0431000 3300045836 Bacteria 853
218 Ga0495603_0166174 3300046455 Bacteria 1279
219 Ga0495628_0091858 3300046516 Bacteria 2349
220 Ga0495635_0381667 3300046663 Bacteria 937
221 Ga0495658_0201762 3300046683 Bacteria 1240
222 Ga0495669_0034883 3300046684 Bacteria 2219
223 Ga0496104_0122353 3300048907 Bacteria 2498
224 Ga0496106_0115291 3300048909 Bacteria 2095
225 Ga0496106_0422789 3300048909 Bacteria 1071
226 Ga0496108_0002916 3300048911 Bacteria 13751
227 Ga0496112_0015097 3300048915 Bacteria 7194
228 Ga0496114_0024280 3300048917 Bacteria 4947
229 Ga0501032_0295457 3300049569 Bacteria 1048
230 Ga0501036_0129103 3300049572 Bacteria 2134
231 Ga0501038_0182115 3300049574 Bacteria 1695
232 Ga0501039_0025287 3300049575 Bacteria 4561
233 Ga0501040_0077764 3300049576 Bacteria 2295
234 Ga0501042_0127031 3300049578 Bacteria 1836
235 Ga0501046_0166484 3300049580 Bacteria 1656
236 Ga0501048_0048643 3300049582 Bacteria 3024
237 Ga0501068_0496251 3300049584 Unclassified 792
238 Ga0501072_0113201 3300049588 Bacteria 2160
239 Ga0501075_0032990 3300049591 Bacteria 3851
240 Ga0501076_0057757 3300049592 Bacteria 3082
241 Ga0501077_0024396 3300049593 Bacteria 3841
242 Ga0501079_0263022 3300049741 Bacteria 1348
243 Ga0501083_0426330 3300049744 Unclassified 863
244 Ga0501045_0256193 3300049824 Bacteria 1302
245 nmdc:mga05p37_217873_c1 3300050507 Bacteria 2305
246 nmdc:mga05p37_249074_c1 3300050507 Bacteria 2132
247 nmdc:mga05p37_254800_c1 3300050507 Bacteria 2103
248 nmdc:mga05p37_548978_c1 3300050507 Bacteria 1316
249 nmdc:mga05p37_58910_c1 3300050507 Bacteria 4729
250 nmdc:mga05p37_7192_c1 3300050507 Bacteria 13128
251 nmdc:mga09592_325099_c1 3300050508 Bacteria 1332
252 nmdc:mga09592_9335_c1 3300050508 Bacteria 7975
253 nmdc:mga0qj67_167920_c1 3300050509 Bacteria 1781
254 nmdc:mga0qj67_4616_c1 3300050509 Bacteria 9991
255 nmdc:mga06r32_16525_c1 3300050510 Bacteria 6727
256 nmdc:mga06r32_389357_c1 3300050510 Bacteria 1376
257 nmdc:mga08y16_105932_c1 3300050511 Bacteria 2927
258 nmdc:mga08y16_115701_c1 3300050511 Bacteria 2792
259 nmdc:mga08y16_130224_c1 3300050511 Bacteria 2617
260 nmdc:mga08y16_203374_c1 3300050511 Bacteria 2052
261 nmdc:mga08y16_37088_c1 3300050511 Bacteria 5119
262 nmdc:mga08y16_491391_c1 3300050511 Bacteria 1248
263 nmdc:mga0n895_162669_c1 3300050512 Bacteria 2264
264 nmdc:mga0n895_484127_c1 3300050512 Bacteria 1248
265 nmdc:mga0n895_4932_c1 3300050512 Bacteria 11070
266 nmdc:mga0n895_709996_c1 3300050512 Bacteria 1001
267 nmdc:mga0n895_84363_c1 3300050512 Bacteria 3170
268 nmdc:mga0rr50_1667_c1 3300050513 Bacteria 12240
269 nmdc:mga0rr50_214926_c1 3300050513 Bacteria 1586
270 nmdc:mga08x19_10991_c1 3300050514 Bacteria 5447
271 nmdc:mga08x19_292232_c1 3300050514 Bacteria 1131
272 nmdc:mga08x19_326995_c1 3300050514 Bacteria 1068
273 nmdc:mga08x19_425308_c1 3300050514 Bacteria 933
274 nmdc:mga0a205_100667_c1 3300050515 Bacteria 2788
275 nmdc:mga0a205_12677_c1 3300050515 Bacteria 7808
276 nmdc:mga0a205_284579_c1 3300050515 Bacteria 1528
277 nmdc:mga0a205_46_c2 3300050515 Bacteria 44620
278 nmdc:mga0a205_525491_c1 3300050515 Bacteria 1040
279 nmdc:mga0a205_68869_c1 3300050515 Bacteria 3418
280 Ga0495601_0053234 3300053077 Bacteria 2558
281 Ga0495619_0108873 3300053085 Bacteria 1892
282 Ga0501084_0289470 3300054114 Bacteria 1383
283 Ga0501082_0264938 3300060353 Bacteria 1495
284 Ga0530510_0007704 3300061734 Bacteria 7499
285 nmdc:mga0rr50_1202_c1
286 JGI25406J46586_10000536
287 Ga0065712_10072559
288 Ga0070676_10010150
289 Ga0070682_100504301
290 Ga0068868_100189784
291 Ga0070660_100001981
292 Ga0070660_100300927
293 Ga0070689_100029163
294 Ga0070687_100048356
295 Ga0070692_10338533
296 Ga0070669_100011932
297 Ga0070675_100001400
298 Ga0070675_100004078
299 Ga0070673_100039434
300 Ga0070688_100087585
301 Ga0070688_100232840
302 Ga0070709_10058524
303 Ga0070710_10434919
304 Ga0070701_10014286
305 Ga0070705_100125928
306 Ga0070705_100344629
307 Ga0070700_100068633
308 Ga0070700_100259434
309 Ga0070694_100138497
310 Ga0070708_100374258
311 Ga0068867_100109648
312 Ga0070685_10229534
313 Ga0070706_100390299
314 Ga0070699_100008889
315 Ga0070699_100012742
316 Ga0070699_100123916
317 Ga0070697_100326939
318 Ga0070672_100015934
319 Ga0070672_100170073
320 Ga0070672_100191421
321 Ga0070686_100207312
322 Ga0070695_100078079
323 Ga0070696_100022878
324 Ga0070665_100975031
325 Ga0070704_100141024
326 Ga0068855_100058770
327 Ga0068854_100049423
328 Ga0068856_100164882
329 Ga0068859_101087176
330 Ga0068864_100042681
331 Ga0068866_10066080
332 Ga0068861_100235787
333 Ga0068861_100415681
334 Ga0068861_100463065
335 Ga0068870_10100713
336 Ga0068863_100130688
337 Ga0068863_100188475
338 Ga0068863_100484291
339 Ga0068863_100732864
340 Ga0068858_100015009
341 Ga0068858_100109871
342 Ga0068858_100519999
343 Ga0068860_100037830
344 Ga0068860_100605605
345 Ga0068862_100140045
346 Ga0081539_10000084
347 Ga0081539_10003287
348 Ga0070717_10671095
349 Ga0097621_100480555
350 Ga0075428_100690369
351 Ga0075430_100000214
352 Ga0075431_100035074
353 Ga0075433_10001660
354 Ga0075433_10113030
355 Ga0075433_10343139
356 Ga0075433_10526832
357 Ga0075434_100002478
358 Ga0075434_100006901
359 Ga0075434_100009501
360 Ga0075434_100426523
361 Ga0075429_100013412
362 Ga0068865_100005724
363 Ga0075436_100011744
364 Ga0075436_100016726
365 Ga0075436_100135374
366 Ga0075436_100140283
367 Ga0075436_100262609
368 Ga0097620_101087256
369 Ga0075435_100001102
370 Ga0075435_100002602
371 Ga0075435_100014585
372 Ga0075435_100049994
373 Ga0075435_100203113
374 Ga0075435_100415733
375 Ga0075435_100457219
376 Ga0111539_10004988
377 Ga0111539_10030995
378 Ga0111539_10155693
379 Ga0111539_10285372
380 Ga0111539_10653330
381 Ga0105245_10069162
382 Ga0105245_10468163
383 Ga0105245_10961653
384 Ga0105247_10216008
385 Ga0105247_10270275
386 Ga0114129_10030708
387 Ga0114129_10038252
388 Ga0114129_10044701
389 Ga0114129_10063793
390 Ga0114129_10084672
391 Ga0114129_10161423
392 Ga0114129_10162656
393 Ga0114129_10503069
394 Ga0114129_11244608
395 Ga0105243_10282356
396 Ga0105248_10008538
397 Ga0105248_10034449
398 Ga0105248_10208060
399 Ga0105248_11038264
400 Ga0105248_11487783
401 Ga0105239_10831759
402 Ga0157375_10391185
403 Ga0163163_10010151
404 Ga0163163_10010553
405 Ga0163163_10067968
406 Ga0163163_10210516
407 Ga0157380_10260974
408 Ga0157380_11077734
409 Ga0157377_10033194
410 Ga0157379_10026170
411 Ga0207682_10031162
412 Ga0207642_10017985
413 Ga0207710_10015014
414 Ga0207710_10147302
415 Ga0207688_10218558
416 Ga0207699_10120696
417 Ga0207645_10003917
418 Ga0207643_10155305
419 Ga0207684_10489898
420 Ga0207663_10599594
421 Ga0207662_10065325
422 Ga0207681_10056684
423 Ga0207681_10077024
424 Ga0207650_10209533
425 Ga0207650_10554030
426 Ga0207659_10010439
427 Ga0207659_10028096
428 Ga0207664_10158931
429 Ga0207644_10385268
430 Ga0207686_10007048
431 Ga0207691_10167971
432 Ga0207691_10289342
433 Ga0207711_10005475
434 Ga0207711_10220829
435 Ga0207711_10402760
436 Ga0207689_10000699
437 Ga0207679_10011832
438 Ga0207679_10251316
439 Ga0207651_10026835
440 Ga0207651_10134554
441 Ga0207640_10057183
442 Ga0207703_10037512
443 Ga0207703_10229863
444 Ga0207703_10237320
445 Ga0207703_10262883
446 Ga0207703_10304166
447 Ga0207639_10154111
448 Ga0207708_10008342
449 Ga0207708_10317654
450 Ga0207708_10325925
451 Ga0207641_10066515
452 Ga0207641_10206414
453 Ga0207641_10234491
454 Ga0207641_10245817
455 Ga0207641_10462197
456 Ga0207648_10000406
457 Ga0207648_10135074
458 Ga0207676_10032929
459 Ga0207676_10037042
460 Ga0207675_100037659
461 Ga0207675_100052802
462 Ga0207675_100121436
463 Ga0207675_100166903
464 Ga0207675_100497124
465 Ga0207683_10037027
466 Ga0207428_10024072
467 Ga0207428_10106377
468 Ga0268265_10170494
469 Ga0268264_10467584
470 Ga0268264_10492076
471 Ga0268264_10603581
472 Ga0307405_10007720
473 Ga0307413_10106656
474 Ga0307410_10008499
475 Ga0307407_10004170
476 Ga0307409_100217531
477 Ga0307411_10136062
478 Ga0373930_0001544
479 Ga0373948_0001519
480 Ga0373950_0000454
481 Ga0373958_0009495
482 Ga0373959_0001475
483 Ga0373938_0001595
484 Ga0373929_0001745
485 Ga0373940_0001159
486 Ga0373949_0001742
487 Ga0373951_0001595
488 Ga0373952_0000300
489 Ga0373932_0000266
490 Ga0373939_0000560
491 Ga0373941_0000826
492 Ga0373960_0001964
493 Ga0373955_0178643
494 Ga0373942_0001954
495 Ga0373961_0000668
496 Ga0373962_0023130
497 Ga0373931_0001252
498 Ga0373935_0789127
499 Ga0373937_0341381
500 Ga0451576_0004446
501 Ga0466958_0431000
502 Ga0495603_0166174
503 Ga0495628_0091858
504 Ga0495635_0381667
505 Ga0495658_0201762
506 Ga0495669_0034883
507 Ga0496104_0122353
508 Ga0496106_0115291
509 Ga0496106_0422789
510 Ga0496108_0002916
511 Ga0496112_0015097
512 Ga0496114_0024280
513 Ga0501032_0295457
514 Ga0501036_0129103
515 Ga0501038_0182115
516 Ga0501039_0025287
517 Ga0501040_0077764
518 Ga0501042_0127031
519 Ga0501046_0166484
520 Ga0501048_0048643
521 Ga0501068_0496251
522 Ga0501072_0113201
523 Ga0501075_0032990
524 Ga0501076_0057757
525 Ga0501077_0024396
526 Ga0501079_0263022
527 Ga0501083_0426330
528 Ga0501045_0256193
529 nmdc:mga05p37_217873_c1
530 nmdc:mga05p37_249074_c1
531 nmdc:mga05p37_254800_c1
532 nmdc:mga05p37_548978_c1
533 nmdc:mga05p37_58910_c1
534 nmdc:mga05p37_7192_c1
535 nmdc:mga09592_325099_c1
536 nmdc:mga09592_9335_c1
537 nmdc:mga0qj67_167920_c1
538 nmdc:mga0qj67_4616_c1
539 nmdc:mga06r32_16525_c1
540 nmdc:mga06r32_389357_c1
541 nmdc:mga08y16_105932_c1
542 nmdc:mga08y16_115701_c1
543 nmdc:mga08y16_130224_c1
544 nmdc:mga08y16_203374_c1
545 nmdc:mga08y16_37088_c1
546 nmdc:mga08y16_491391_c1
547 nmdc:mga0n895_162669_c1
548 nmdc:mga0n895_484127_c1
549 nmdc:mga0n895_4932_c1
550 nmdc:mga0n895_709996_c1
551 nmdc:mga0n895_84363_c1
552 nmdc:mga0rr50_1667_c1
553 nmdc:mga0rr50_214926_c1
554 nmdc:mga08x19_10991_c1
555 nmdc:mga08x19_292232_c1
556 nmdc:mga08x19_326995_c1
557 nmdc:mga08x19_425308_c1
558 nmdc:mga0a205_100667_c1
559 nmdc:mga0a205_12677_c1
560 nmdc:mga0a205_284579_c1
561 nmdc:mga0a205_46_c2
562 nmdc:mga0a205_525491_c1
563 nmdc:mga0a205_68869_c1
564 Ga0495601_0053234
565 Ga0495619_0108873
566 Ga0501084_0289470
567 Ga0501082_0264938
568 Ga0530510_0007704

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

92

274

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dp6-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase in complex with ap:c containing dna 0.898 14 240
2dp6-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase in complex with ap:c containing dna 0.8709 14 240
1vk2-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase (tm0511) from thermotoga maritima at 1.90 a resolution 0.7996 9 240
1vk2-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase (tm0511) from thermotoga maritima at 1.90 a resolution 0.7724 9 240
4zbz-assembly1.cif.gz_A family 4 uracil-dna glycosylase from sulfolobus tokodaii (free form, x-ray wavelength=1.5418) 0.7632 13 235
ID Description Score Start End Superfamily
2d3yA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9026 14 240 3.40.470.10
af_P9WM53_47_267_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8984 14 240 3.40.470.10
af_P9WM53_47_267_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8794 14 240 3.40.470.10
2d3yA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8754 14 240 3.40.470.10
4zbzA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7631 13 235 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A6J6Z1A5-F1-model_v4 Type-5 uracil-DNA glycosylase 0.9601 50 240 GO:0004844
GO:0006284
GO:0033958
GO:0046872
GO:0051539
AF-A0A534Y0X0-F1-model_v4 Uracil-DNA glycosylase 0.9568 95 240 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A399YHM3-F1-model_v4 Type-5 uracil-DNA glycosylase 0.9538 50 243 GO:0004844
GO:0006284
GO:0033958
GO:0046872
GO:0051539
AF-A0A7W0U9T2-F1-model_v4 Type-5 uracil-DNA glycosylase 0.9538 53 240 GO:0004844
GO:0006284
GO:0033958
GO:0046872
GO:0051539
AF-A0A7W0KXM7-F1-model_v4 Uracil-DNA glycosylase 0.9511 62 240 GO:0006281
GO:0046872
GO:0051539
GO:0097506

Map