F386413

General Info

Members Datasets Scaffolds Average Seq Length
284 202 568 126

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_0573264|Ga0496114_0573264_376_840
Length 154
Sequence MPARRRLLCLAEFNTNRKDICMATLELTASNFEDTVAGDGIVLVDFWAAWCGPCRMFAPVFEAASDNHTDIVFGKIDTEAQQGLAAAANIRSIPTLMAFRDGILVFSQPGALPAPSLEQLIGAVRDLDMDDVRRQIAEASTAADAAQEQGATAR

Samples

Sample ID Description Type Environment
1 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
56 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
81 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
83 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
84 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
85 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
86 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
87 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
88 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
91 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
92 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
93 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
101 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
103 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
104 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
107 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
108 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
109 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
110 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
111 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
114 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
115 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
118 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
125 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
126 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
127 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
128 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
132 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
133 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
141 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
142 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
143 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
149 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
150 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
153 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
154 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
155 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
156 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
157 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
158 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
159 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
160 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
161 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
162 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
163 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
183 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
200 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
201 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.48
Metatranscriptomes 3.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.27
Rhizosphere 85.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496114_0573264 3300048917 Bacteria 996
2 LJQas_1002400 3300000549 Bacteria 2609
3 rootH1_10253420 3300003323 Bacteria 4272
4 Ga0070658_10074299 3300005327 Bacteria 2788
5 Ga0070683_100088769 3300005329 Bacteria 2901
6 Ga0070683_100333839 3300005329 Bacteria 1443
7 Ga0070683_100355157 3300005329 Bacteria 1396
8 Ga0070680_100411701 3300005336 Bacteria 1153
9 Ga0070682_100093965 3300005337 Bacteria 1967
10 Ga0070660_101179652 3300005339 Bacteria 649
11 Ga0070660_101180368 3300005339 Bacteria 649
12 Ga0070692_10090056 3300005345 Bacteria 1666
13 Ga0070674_100402257 3300005356 Bacteria 1119
14 Ga0070659_100983308 3300005366 Bacteria 740
15 Ga0070709_10058218 3300005434 Bacteria 2450
16 Ga0070714_100288862 3300005435 Bacteria 1526
17 Ga0070714_100631338 3300005435 Bacteria 1030
18 Ga0070714_101004868 3300005435 Bacteria 812
19 Ga0070713_100030807 3300005436 Bacteria 4266
20 Ga0070713_100348482 3300005436 Bacteria 1373
21 Ga0070713_100563741 3300005436 Bacteria 1079
22 Ga0070713_101417622 3300005436 Bacteria 674
23 Ga0070711_100053734 3300005439 Bacteria 2777
24 Ga0070711_100072917 3300005439 Bacteria 2424
25 Ga0070678_100169833 3300005456 Bacteria 1775
26 Ga0070681_10114215 3300005458 Bacteria 2639
27 Ga0070706_100151577 3300005467 Bacteria 2164
28 Ga0070706_100538842 3300005467 Bacteria 1086
29 Ga0070707_100061439 3300005468 Bacteria 3603
30 Ga0070707_100736372 3300005468 Bacteria 949
31 Ga0070707_100910739 3300005468 Bacteria 844
32 Ga0070698_100038294 3300005471 Bacteria 4941
33 Ga0070698_100289081 3300005471 Bacteria 1570
34 Ga0070679_100044140 3300005530 Bacteria 4441
35 Ga0070684_100031729 3300005535 Bacteria 4500
36 Ga0070684_100094392 3300005535 Bacteria 2664
37 Ga0070684_100267800 3300005535 Bacteria 1563
38 Ga0070684_101005365 3300005535 Bacteria 783
39 Ga0068857_100620953 3300005577 Bacteria 1023
40 Ga0068857_101247077 3300005577 Bacteria 721
41 Ga0068856_100218765 3300005614 Bacteria 1920
42 Ga0068852_101545119 3300005616 Bacteria 686
43 Ga0068870_10169307 3300005840 Bacteria 1302
44 Ga0068860_101987774 3300005843 Bacteria 603
45 Ga0081539_10011542 3300005985 Bacteria 6967
46 Ga0070717_10027559 3300006028 Bacteria 4542
47 Ga0070717_10309540 3300006028 Bacteria 1405
48 Ga0070716_100256675 3300006173 Bacteria 1194
49 Ga0070712_100018256 3300006175 Bacteria 4553
50 Ga0070712_100039738 3300006175 Bacteria 3221
51 Ga0070712_100294540 3300006175 Bacteria 1311
52 Ga0070712_100296850 3300006175 Bacteria 1306
53 Ga0075428_100325194 3300006844 Bacteria 1652
54 Ga0075431_100169757 3300006847 Bacteria 2242
55 Ga0111539_11447017 3300009094 Bacteria 797
56 Ga0105245_11249140 3300009098 Bacteria 791
57 Ga0114129_10493297 3300009147 Bacteria 1600
58 Ga0114129_11953167 3300009147 Bacteria 710
59 Ga0105243_10280176 3300009148 Bacteria 1501
60 Ga0105243_10996484 3300009148 Bacteria 840
61 Ga0105242_10082546 3300009176 Bacteria 2690
62 Ga0105248_12566361 3300009177 Bacteria 581
63 Ga0105246_10827008 3300011119 Bacteria 824
64 Ga0157370_11595028 3300013104 Bacteria 586
65 Ga0157369_10029194 3300013105 Bacteria 6097
66 Ga0157369_10573381 3300013105 Bacteria 1166
67 Ga0157374_10321575 3300013296 Bacteria 1533
68 Ga0157374_11269542 3300013296 Bacteria 758
69 Ga0157378_12547021 3300013297 Bacteria 564
70 Ga0163162_10441118 3300013306 Bacteria 1434
71 Ga0157372_10242325 3300013307 Bacteria 2092
72 Ga0157375_10656881 3300013308 Bacteria 1204
73 Ga0163163_11599478 3300014325 Bacteria 713
74 Ga0182008_10080794 3300014497 Bacteria 1600
75 Ga0157377_10245123 3300014745 Bacteria 1159
76 Ga0206352_10360656 3300020078 Bacteria 567
77 Ga0206350_11418361 3300020080 Bacteria 1311
78 Ga0206354_10303338 3300020081 Bacteria 503
79 Ga0206353_10278253 3300020082 Bacteria 3186
80 Ga0213875_10001142 3300021388 Bacteria 18252
81 Ga0224712_10066775 3300022467 Bacteria 1449
82 Ga0224712_10189009 3300022467 Bacteria 931
83 Ga0207643_10229614 3300025908 Bacteria 1138
84 Ga0207705_10191764 3300025909 Bacteria 1546
85 Ga0207684_10767525 3300025910 Bacteria 816
86 Ga0207684_11093576 3300025910 Bacteria 664
87 Ga0207654_10510771 3300025911 Bacteria 850
88 Ga0207707_10449226 3300025912 Bacteria 1103
89 Ga0207693_10006999 3300025915 Bacteria 9315
90 Ga0207693_10033545 3300025915 Bacteria 4051
91 Ga0207693_10300599 3300025915 Bacteria 1257
92 Ga0207693_10580438 3300025915 Bacteria 873
93 Ga0207663_10134404 3300025916 Bacteria 1714
94 Ga0207657_11022666 3300025919 Bacteria 633
95 Ga0207652_10160773 3300025921 Bacteria 2013
96 Ga0207646_10117056 3300025922 Bacteria 2393
97 Ga0207650_10976853 3300025925 Bacteria 720
98 Ga0207687_10438720 3300025927 Bacteria 1081
99 Ga0207687_11526518 3300025927 Bacteria 574
100 Ga0207700_10060834 3300025928 Bacteria 2861
101 Ga0207700_10328361 3300025928 Bacteria 1327
102 Ga0207700_10468303 3300025928 Bacteria 1112
103 Ga0207664_10119560 3300025929 Bacteria 2203
104 Ga0207690_10192129 3300025932 Bacteria 1544
105 Ga0207690_10439147 3300025932 Bacteria 1047
106 Ga0207686_10185142 3300025934 Bacteria 1480
107 Ga0207669_10972860 3300025937 Bacteria 712
108 Ga0207669_11378218 3300025937 Bacteria 600
109 Ga0207665_10195238 3300025939 Bacteria 1472
110 Ga0207689_11448153 3300025942 Bacteria 575
111 Ga0207661_10224315 3300025944 Bacteria 1662
112 Ga0207661_10298185 3300025944 Bacteria 1444
113 Ga0207661_11566201 3300025944 Bacteria 603
114 Ga0207674_10155776 3300026116 Bacteria 2240
115 Ga0207674_10990783 3300026116 Bacteria 809
116 Ga0207674_11804074 3300026116 Bacteria 579
117 Ga0307515_10123002 3300028794 Bacteria 2922
118 Ga0265338_10000714 3300028800 Bacteria 56753
119 Ga0307511_10405239 3300030521 Bacteria 558
120 Ga0265763_1016260 3300030763 Bacteria 745
121 Ga0265330_10188238 3300031235 Bacteria 874
122 Ga0265328_10017548 3300031239 Bacteria 2772
123 Ga0265320_10232348 3300031240 Bacteria 820
124 Ga0265325_10008023 3300031241 Bacteria 6262
125 Ga0265340_10128041 3300031247 Bacteria 1166
126 Ga0265340_10162674 3300031247 Bacteria 1014
127 Ga0265327_10023340 3300031251 Bacteria 3665
128 Ga0265316_10047174 3300031344 Bacteria 3409
129 Ga0307408_100647115 3300031548 Bacteria 945
130 Ga0265313_10002998 3300031595 Bacteria 14056
131 Ga0265314_10078841 3300031711 Bacteria 2179
132 Ga0316578_10095595 3300031728 Bacteria 1778
133 Ga0307516_10006695 3300031730 Bacteria 13464
134 Ga0307413_10186217 3300031824 Bacteria 1486
135 Ga0307406_10017627 3300031901 Bacteria 4161
136 Ga0307406_10694155 3300031901 Bacteria 849
137 Ga0307409_100154353 3300031995 Bacteria 1998
138 Ga0307416_100203578 3300032002 Bacteria 1881
139 Ga0307416_100339383 3300032002 Bacteria 1514
140 Ga0307416_100462612 3300032002 Bacteria 1324
141 Ga0307411_11076728 3300032005 Bacteria 723
142 Ga0307415_100003392 3300032126 Bacteria 8107
143 Ga0307415_100597675 3300032126 Bacteria 981
144 Ga0307415_101490537 3300032126 Bacteria 647
145 Ga0316580_10021036 3300032139 Bacteria 2010
146 Ga0316587_1014733 3300033529 Bacteria 1292
147 Ga0373926_0023850 3300035083 Bacteria 2127
148 Ga0373934_0261867 3300035086 Bacteria 715
149 Ga0373923_0134362 3300035111 Bacteria 1114
150 Ga0373936_0000509 3300035113 Bacteria 13224
151 Ga0373945_0015716 3300035116 Bacteria 2549
152 Ga0373943_0002210 3300035170 Bacteria 8847
153 Ga0373946_0000120 3300035171 Bacteria 22841
154 Ga0373955_0147119 3300035172 Bacteria 1385
155 Ga0316574_0013269 3300035398 Bacteria 4733
156 Ga0316574_0188785 3300035398 Bacteria 1325
157 Ga0373924_0013155 3300035410 Bacteria 3105
158 Ga0373935_0000289 3300035692 Bacteria 24895
159 Ga0373935_0359699 3300035692 Bacteria 1039
160 Ga0373927_0001351 3300035695 Bacteria 18476
161 Ga0373933_0046366 3300035724 Bacteria 2581
162 Ga0373947_0000175 3300035725 Bacteria 35027
163 Ga0373937_0025788 3300036401 Bacteria 5308
164 Ga0373937_1337803 3300036401 Bacteria 664
165 Ga0316582_0202281 3300036647 Bacteria 1355
166 Ga0316584_0210066 3300036712 Bacteria 1433
167 Ga0373925_0000677 3300037068 Bacteria 32007
168 Ga0395898_0219230 3300037466 Bacteria 1815
169 Ga0395898_1046264 3300037466 Bacteria 751
170 Ga0395905_0477599 3300037471 Bacteria 1146
171 Ga0436364_1401376 3300037853 Bacteria 69007
172 Ga0395901_0247124 3300038443 Bacteria 1859
173 Ga0395901_1745430 3300038443 Bacteria 573
174 Ga0451807_2425105 3300041486 Bacteria 979
175 Ga0451853_1663054 3300041512 Bacteria 640
176 Ga0451577_0322089 3300042876 Bacteria 1402
177 Ga0466972_0130664 3300044658 Bacteria 1183
178 Ga0466965_0107047 3300044683 Bacteria 1435
179 Ga0466961_0470801 3300044693 Bacteria 760
180 Ga0466963_0559213 3300044694 Bacteria 808
181 Ga0466964_0130685 3300044706 Bacteria 1143
182 Ga0466957_0161710 3300044842 Bacteria 1455
183 Ga0466957_1317966 3300044842 Bacteria 524
184 Ga0466960_0503032 3300044901 Bacteria 710
185 Ga0466967_0494487 3300045976 Bacteria 1200
186 Ga0495603_0642673 3300046455 Bacteria 607
187 Ga0495629_0089995 3300046459 Bacteria 2141
188 Ga0495651_0049084 3300046462 Bacteria 3258
189 Ga0495653_0018064 3300046463 Bacteria 5733
190 Ga0495653_0044388 3300046463 Bacteria 3449
191 Ga0495582_0290972 3300046473 Bacteria 938
192 Ga0495639_0038449 3300046475 Bacteria 2149
193 Ga0495662_0010084 3300046476 Bacteria 4634
194 Ga0495664_0000479 3300046477 Bacteria 19870
195 Ga0495608_0014109 3300046511 Bacteria 5545
196 Ga0495618_0052902 3300046514 Bacteria 2567
197 Ga0495628_0023018 3300046516 Bacteria 5115
198 Ga0495628_0066894 3300046516 Bacteria 2808
199 Ga0495628_0184946 3300046516 Bacteria 1575
200 Ga0495630_0519725 3300046517 Bacteria 913
201 Ga0495652_0010997 3300046529 Bacteria 8201
202 Ga0495652_0064594 3300046529 Bacteria 3078
203 Ga0495665_0021910 3300046531 Bacteria 3436
204 Ga0495586_0301696 3300046535 Bacteria 918
205 Ga0495587_0453741 3300046536 Bacteria 710
206 Ga0495645_0040393 3300046543 Bacteria 3404
207 Ga0495645_0146366 3300046543 Bacteria 1645
208 Ga0495667_0004805 3300046559 Bacteria 9135
209 Ga0495667_0192518 3300046559 Bacteria 1306
210 Ga0495667_0321170 3300046559 Bacteria 980
211 Ga0495656_0200073 3300046615 Bacteria 991
212 Ga0495635_0002062 3300046663 Bacteria 13614
213 Ga0495588_0289097 3300046674 Bacteria 864
214 Ga0495657_0007053 3300046675 Bacteria 8718
215 Ga0495599_0016816 3300046678 Bacteria 4544
216 Ga0495623_0056130 3300046679 Bacteria 2480
217 Ga0495647_0026729 3300046681 Bacteria 2117
218 Ga0495658_0456718 3300046683 Bacteria 816
219 Ga0495658_0532305 3300046683 Bacteria 752
220 Ga0495624_0008708 3300046690 Bacteria 7065
221 Ga0495600_0912388 3300046809 Bacteria 518
222 Ga0495581_0014996 3300047315 Bacteria 4497
223 Ga0495604_0263133 3300047317 Bacteria 1171
224 Ga0495674_0000832 3300047319 Bacteria 29501
225 Ga0495674_0088058 3300047319 Bacteria 2656
226 Ga0495676_0005724 3300047321 Bacteria 11397
227 Ga0495676_0062772 3300047321 Bacteria 2899
228 Ga0495676_0521966 3300047321 Bacteria 778
229 Ga0495680_0003056 3300047322 Bacteria 16681
230 Ga0495680_0036080 3300047322 Bacteria 3974
231 Ga0495684_0008492 3300047471 Bacteria 7954
232 Ga0496101_0373847 3300048904 Bacteria 1121
233 Ga0496102_0054526 3300048905 Bacteria 3646
234 Ga0496102_0099997 3300048905 Bacteria 2693
235 Ga0496104_0084992 3300048907 Bacteria 3020
236 Ga0496104_0173960 3300048907 Bacteria 2064
237 Ga0496105_0751591 3300048908 Bacteria 745
238 Ga0496106_0337187 3300048909 Bacteria 1211
239 Ga0496107_0751981 3300048910 Bacteria 715
240 Ga0496108_0027040 3300048911 Bacteria 4734
241 Ga0496108_0412076 3300048911 Bacteria 1180
242 Ga0496108_0599338 3300048911 Bacteria 960
243 Ga0496108_0772745 3300048911 Bacteria 830
244 Ga0496109_0503536 3300048912 Bacteria 1143
245 Ga0496110_0298605 3300048913 Bacteria 1467
246 Ga0496110_0591213 3300048913 Bacteria 1007
247 Ga0496110_0614710 3300048913 Bacteria 985
248 Ga0496111_0347550 3300048914 Bacteria 1098
249 Ga0496112_0024472 3300048915 Bacteria 5782
250 Ga0496112_0322863 3300048915 Bacteria 1488
251 Ga0496112_0423963 3300048915 Bacteria 1269
252 Ga0496112_0728484 3300048915 Bacteria 919
253 Ga0496113_0032696 3300048916 Bacteria 3781
254 Ga0496113_0182671 3300048916 Bacteria 1663
255 Ga0496113_0652654 3300048916 Bacteria 841
256 Ga0496113_0687188 3300048916 Bacteria 817
257 Ga0496113_0787263 3300048916 Bacteria 756
258 Ga0496115_0122438 3300048918 Bacteria 2141
259 Ga0496115_0151452 3300048918 Bacteria 1916
260 Ga0496115_0318224 3300048918 Bacteria 1273
261 Ga0496115_0926793 3300048918 Bacteria 670
262 Ga0496126_0009249 3300048929 Bacteria 10502
263 Ga0501316_036220 3300049532 Bacteria 675
264 Ga0501321_027178 3300049537 Bacteria 746
265 Ga0501034_0016239 3300049571 Bacteria 7640
266 Ga0501034_0090544 3300049571 Bacteria 3057
267 Ga0501047_0833830 3300049581 Bacteria 736
268 Ga0501070_0026109 3300049586 Bacteria 4901
269 Ga0501071_0258957 3300049587 Bacteria 1314
270 Ga0501071_0894764 3300049587 Bacteria 685
271 Ga0501073_0288508 3300049589 Bacteria 1132
272 Ga0501074_0014784 3300049590 Bacteria 5678
273 Ga0501079_1249098 3300049741 Bacteria 585
274 Ga0501080_0164863 3300049742 Bacteria 2045
275 Ga0501083_0886200 3300049744 Bacteria 581
276 Ga0501044_0045290 3300049823 Bacteria 4559
277 nmdc:mga05p37_2111279_c1 3300050507 Bacteria 527
278 nmdc:mga06r32_159925_c1 3300050510 Bacteria 2234
279 nmdc:mga08y16_2086304_c1 3300050511 Bacteria 515
280 nmdc:mga08x19_1067776_c1 3300050514 Bacteria 573
281 Ga0495601_0673077 3300053077 Bacteria 661
282 Ga0495612_0030638 3300053078 Bacteria 2167
283 Ga0495619_0432700 3300053085 Bacteria 907
284 Ga0501082_1245959 3300060353 Bacteria 650
285 Ga0496114_0573264
286 LJQas_1002400
287 rootH1_10253420
288 Ga0070658_10074299
289 Ga0070683_100088769
290 Ga0070683_100333839
291 Ga0070683_100355157
292 Ga0070680_100411701
293 Ga0070682_100093965
294 Ga0070660_101179652
295 Ga0070660_101180368
296 Ga0070692_10090056
297 Ga0070674_100402257
298 Ga0070659_100983308
299 Ga0070709_10058218
300 Ga0070714_100288862
301 Ga0070714_100631338
302 Ga0070714_101004868
303 Ga0070713_100030807
304 Ga0070713_100348482
305 Ga0070713_100563741
306 Ga0070713_101417622
307 Ga0070711_100053734
308 Ga0070711_100072917
309 Ga0070678_100169833
310 Ga0070681_10114215
311 Ga0070706_100151577
312 Ga0070706_100538842
313 Ga0070707_100061439
314 Ga0070707_100736372
315 Ga0070707_100910739
316 Ga0070698_100038294
317 Ga0070698_100289081
318 Ga0070679_100044140
319 Ga0070684_100031729
320 Ga0070684_100094392
321 Ga0070684_100267800
322 Ga0070684_101005365
323 Ga0068857_100620953
324 Ga0068857_101247077
325 Ga0068856_100218765
326 Ga0068852_101545119
327 Ga0068870_10169307
328 Ga0068860_101987774
329 Ga0081539_10011542
330 Ga0070717_10027559
331 Ga0070717_10309540
332 Ga0070716_100256675
333 Ga0070712_100018256
334 Ga0070712_100039738
335 Ga0070712_100294540
336 Ga0070712_100296850
337 Ga0075428_100325194
338 Ga0075431_100169757
339 Ga0111539_11447017
340 Ga0105245_11249140
341 Ga0114129_10493297
342 Ga0114129_11953167
343 Ga0105243_10280176
344 Ga0105243_10996484
345 Ga0105242_10082546
346 Ga0105248_12566361
347 Ga0105246_10827008
348 Ga0157370_11595028
349 Ga0157369_10029194
350 Ga0157369_10573381
351 Ga0157374_10321575
352 Ga0157374_11269542
353 Ga0157378_12547021
354 Ga0163162_10441118
355 Ga0157372_10242325
356 Ga0157375_10656881
357 Ga0163163_11599478
358 Ga0182008_10080794
359 Ga0157377_10245123
360 Ga0206352_10360656
361 Ga0206350_11418361
362 Ga0206354_10303338
363 Ga0206353_10278253
364 Ga0213875_10001142
365 Ga0224712_10066775
366 Ga0224712_10189009
367 Ga0207643_10229614
368 Ga0207705_10191764
369 Ga0207684_10767525
370 Ga0207684_11093576
371 Ga0207654_10510771
372 Ga0207707_10449226
373 Ga0207693_10006999
374 Ga0207693_10033545
375 Ga0207693_10300599
376 Ga0207693_10580438
377 Ga0207663_10134404
378 Ga0207657_11022666
379 Ga0207652_10160773
380 Ga0207646_10117056
381 Ga0207650_10976853
382 Ga0207687_10438720
383 Ga0207687_11526518
384 Ga0207700_10060834
385 Ga0207700_10328361
386 Ga0207700_10468303
387 Ga0207664_10119560
388 Ga0207690_10192129
389 Ga0207690_10439147
390 Ga0207686_10185142
391 Ga0207669_10972860
392 Ga0207669_11378218
393 Ga0207665_10195238
394 Ga0207689_11448153
395 Ga0207661_10224315
396 Ga0207661_10298185
397 Ga0207661_11566201
398 Ga0207674_10155776
399 Ga0207674_10990783
400 Ga0207674_11804074
401 Ga0307515_10123002
402 Ga0265338_10000714
403 Ga0307511_10405239
404 Ga0265763_1016260
405 Ga0265330_10188238
406 Ga0265328_10017548
407 Ga0265320_10232348
408 Ga0265325_10008023
409 Ga0265340_10128041
410 Ga0265340_10162674
411 Ga0265327_10023340
412 Ga0265316_10047174
413 Ga0307408_100647115
414 Ga0265313_10002998
415 Ga0265314_10078841
416 Ga0316578_10095595
417 Ga0307516_10006695
418 Ga0307413_10186217
419 Ga0307406_10017627
420 Ga0307406_10694155
421 Ga0307409_100154353
422 Ga0307416_100203578
423 Ga0307416_100339383
424 Ga0307416_100462612
425 Ga0307411_11076728
426 Ga0307415_100003392
427 Ga0307415_100597675
428 Ga0307415_101490537
429 Ga0316580_10021036
430 Ga0316587_1014733
431 Ga0373926_0023850
432 Ga0373934_0261867
433 Ga0373923_0134362
434 Ga0373936_0000509
435 Ga0373945_0015716
436 Ga0373943_0002210
437 Ga0373946_0000120
438 Ga0373955_0147119
439 Ga0316574_0013269
440 Ga0316574_0188785
441 Ga0373924_0013155
442 Ga0373935_0000289
443 Ga0373935_0359699
444 Ga0373927_0001351
445 Ga0373933_0046366
446 Ga0373947_0000175
447 Ga0373937_0025788
448 Ga0373937_1337803
449 Ga0316582_0202281
450 Ga0316584_0210066
451 Ga0373925_0000677
452 Ga0395898_0219230
453 Ga0395898_1046264
454 Ga0395905_0477599
455 Ga0436364_1401376
456 Ga0395901_0247124
457 Ga0395901_1745430
458 Ga0451807_2425105
459 Ga0451853_1663054
460 Ga0451577_0322089
461 Ga0466972_0130664
462 Ga0466965_0107047
463 Ga0466961_0470801
464 Ga0466963_0559213
465 Ga0466964_0130685
466 Ga0466957_0161710
467 Ga0466957_1317966
468 Ga0466960_0503032
469 Ga0466967_0494487
470 Ga0495603_0642673
471 Ga0495629_0089995
472 Ga0495651_0049084
473 Ga0495653_0018064
474 Ga0495653_0044388
475 Ga0495582_0290972
476 Ga0495639_0038449
477 Ga0495662_0010084
478 Ga0495664_0000479
479 Ga0495608_0014109
480 Ga0495618_0052902
481 Ga0495628_0023018
482 Ga0495628_0066894
483 Ga0495628_0184946
484 Ga0495630_0519725
485 Ga0495652_0010997
486 Ga0495652_0064594
487 Ga0495665_0021910
488 Ga0495586_0301696
489 Ga0495587_0453741
490 Ga0495645_0040393
491 Ga0495645_0146366
492 Ga0495667_0004805
493 Ga0495667_0192518
494 Ga0495667_0321170
495 Ga0495656_0200073
496 Ga0495635_0002062
497 Ga0495588_0289097
498 Ga0495657_0007053
499 Ga0495599_0016816
500 Ga0495623_0056130
501 Ga0495647_0026729
502 Ga0495658_0456718
503 Ga0495658_0532305
504 Ga0495624_0008708
505 Ga0495600_0912388
506 Ga0495581_0014996
507 Ga0495604_0263133
508 Ga0495674_0000832
509 Ga0495674_0088058
510 Ga0495676_0005724
511 Ga0495676_0062772
512 Ga0495676_0521966
513 Ga0495680_0003056
514 Ga0495680_0036080
515 Ga0495684_0008492
516 Ga0496101_0373847
517 Ga0496102_0054526
518 Ga0496102_0099997
519 Ga0496104_0084992
520 Ga0496104_0173960
521 Ga0496105_0751591
522 Ga0496106_0337187
523 Ga0496107_0751981
524 Ga0496108_0027040
525 Ga0496108_0412076
526 Ga0496108_0599338
527 Ga0496108_0772745
528 Ga0496109_0503536
529 Ga0496110_0298605
530 Ga0496110_0591213
531 Ga0496110_0614710
532 Ga0496111_0347550
533 Ga0496112_0024472
534 Ga0496112_0322863
535 Ga0496112_0423963
536 Ga0496112_0728484
537 Ga0496113_0032696
538 Ga0496113_0182671
539 Ga0496113_0652654
540 Ga0496113_0687188
541 Ga0496113_0787263
542 Ga0496115_0122438
543 Ga0496115_0151452
544 Ga0496115_0318224
545 Ga0496115_0926793
546 Ga0496126_0009249
547 Ga0501316_036220
548 Ga0501321_027178
549 Ga0501034_0016239
550 Ga0501034_0090544
551 Ga0501047_0833830
552 Ga0501070_0026109
553 Ga0501071_0258957
554 Ga0501071_0894764
555 Ga0501073_0288508
556 Ga0501074_0014784
557 Ga0501079_1249098
558 Ga0501080_0164863
559 Ga0501083_0886200
560 Ga0501044_0045290
561 nmdc:mga05p37_2111279_c1
562 nmdc:mga06r32_159925_c1
563 nmdc:mga08y16_2086304_c1
564 nmdc:mga08x19_1067776_c1
565 Ga0495601_0673077
566 Ga0495612_0030638
567 Ga0495619_0432700
568 Ga0501082_1245959

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00085

Thioredoxin

Thioredoxin

23

123

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tn8-assembly1.cif.gz_A crystal structure of thermus thermophilus thioredoxin solved by sulfur sad using swiss light source data 0.9788 5 101
3hhv-assembly1.cif.gz_A-2 the crystal structure of the thioredoxin a2 from sulfolobus solfataricus 0.9783 3 103
4xhm-assembly2.cif.gz_B archaeoglobus fulgidus thioredoxin 3 m60h 0.9746 2 101
3tco-assembly3.cif.gz_C crystallographic and spectroscopic characterization of sulfolobus solfataricus trxa1 provide insights into the determinants of thioredoxin fold stability 0.9693 2 103
3ul3-assembly2.cif.gz_A structural insights into thioredoxin-2: a component of malaria parasite protein secretion machinery 0.9682 18 101
ID Description Score Start End Superfamily
af_O53161_2_108_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9942 2 107 3.40.30.10
af_O53161_2_108_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9758 2 107 3.40.30.10
3ul3B01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9707 20 101 3.40.30.10
af_Q8VX13_95_193_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9694 3 87 3.40.30.10
3tcoC00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9693 2 103 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A3E0PZN8-F1-model_v4 Thioredoxin 1 3 98 GO:0005829
GO:0015035
AF-A0A7W3Y428-F1-model_v4 Thioredoxin 0.9988 1 100 GO:0005829
GO:0015035
AF-A0A6A2VEN3-F1-model_v4 Thioredoxin 0.9979 1 107 GO:0005829
GO:0015035
AF-A0A849CDE3-F1-model_v4 Thioredoxin 0.9978 1 111 GO:0005829
GO:0015035
AF-A0A255HAJ7-F1-model_v4 Thioredoxin 0.9978 1 107 GO:0005829
GO:0015035

Map