F386384
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 284 | 76 | 568 | 309 |
Family's Representative Sequence
| Representative Sequence | 3300046542|Ga0495597_0002267|Ga0495597_0002267_5414_6412 |
| Length | 332 |
| Sequence | MKRLPIRLRSGGFTLVEAIITIAIIGIIGGIVAVFIRAPILSYRDTVDRAELSDQADLALRRMARDIRLALPNSVRIAATTDDQGEHPGAHLELLLTRSGARYLSADDGVAVDKTLSFDDAAKRDFLALAPPRTFDDVRVGDFVVVYNLGPGLAPADAYALEDTGEINGNVGRAGNKDACPSGAPVTAAGNIARICLLNAAATDADLNAPVRGITLARNPFALQQPTTMASPLQRFQVVSGPVSFYCAKNTDGRWALWRAWDYPIAATQAVPAGGKRALVATGLDSCDNIFAYGSAASQRTGLVRIALSLRGRTENPPVIRLVHQVHVDNTP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 3 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 4 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 5 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 6 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 7 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 8 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 9 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 10 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 11 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 12 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 13 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 14 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 15 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 16 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 17 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 18 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 19 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 20 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 21 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 22 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 23 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 24 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 25 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 26 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 27 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 28 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 29 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 30 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 31 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 32 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 33 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 34 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 35 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 36 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 37 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 38 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 39 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 40 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 41 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 42 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 43 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 44 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 45 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 46 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 47 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 48 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 49 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 50 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 51 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 52 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 53 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 54 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 55 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 56 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 57 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 58 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 59 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 60 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 61 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 62 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 63 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 64 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 65 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 66 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 67 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 68 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 69 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 70 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 71 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 72 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 73 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 74 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 75 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.35 |
| Nodule | 0 |
| Rhizoplane | 3.17 |
| Rhizosphere | 96.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495597_0002267 | 3300046542 | Bacteria | 12501 |
| 2 | Ga0065165_1000243 | 3300005262 | Bacteria | 93455 |
| 3 | Ga0395900_0080030 | 3300037418 | Bacteria | 3358 |
| 4 | Ga0395898_0079997 | 3300037466 | Bacteria | 3152 |
| 5 | Ga0395901_0100862 | 3300038443 | Bacteria | 3029 |
| 6 | Ga0450904_000691 | 3300042139 | Bacteria | 5981 |
| 7 | Ga0451577_0265498 | 3300042876 | Bacteria | 1554 |
| 8 | Ga0451576_0012842 | 3300045051 | Bacteria | 9395 |
| 9 | Ga0495617_000060 | 3300046452 | Bacteria | 97123 |
| 10 | Ga0495627_000272 | 3300046453 | Bacteria | 52368 |
| 11 | Ga0495627_002379 | 3300046453 | Bacteria | 9151 |
| 12 | Ga0495627_025550 | 3300046453 | Bacteria | 1914 |
| 13 | Ga0495603_0007930 | 3300046455 | Bacteria | 6407 |
| 14 | Ga0495590_0000008 | 3300046457 | Bacteria | 330520 |
| 15 | Ga0495590_0000562 | 3300046457 | Bacteria | 17639 |
| 16 | Ga0495591_000051 | 3300046458 | Bacteria | 137457 |
| 17 | Ga0495629_0012458 | 3300046459 | Bacteria | 6160 |
| 18 | Ga0495638_0037794 | 3300046460 | Bacteria | 3071 |
| 19 | Ga0495653_0026991 | 3300046463 | Bacteria | 4599 |
| 20 | Ga0495650_0000229 | 3300046471 | Bacteria | 114086 |
| 21 | Ga0495650_0037255 | 3300046471 | Bacteria | 2119 |
| 22 | Ga0495605_0000049 | 3300046474 | Bacteria | 166669 |
| 23 | Ga0495605_0009857 | 3300046474 | Bacteria | 5359 |
| 24 | Ga0495605_0014261 | 3300046474 | Bacteria | 4357 |
| 25 | Ga0495605_0018024 | 3300046474 | Bacteria | 3792 |
| 26 | Ga0495605_0031638 | 3300046474 | Bacteria | 2701 |
| 27 | Ga0495605_0056395 | 3300046474 | Bacteria | 1895 |
| 28 | Ga0495605_0072259 | 3300046474 | Bacteria | 1627 |
| 29 | Ga0495584_0000236 | 3300046491 | Bacteria | 39815 |
| 30 | Ga0495584_0000830 | 3300046491 | Bacteria | 20251 |
| 31 | Ga0495584_0001282 | 3300046491 | Bacteria | 15288 |
| 32 | Ga0495584_0006567 | 3300046491 | Bacteria | 6079 |
| 33 | Ga0495584_0010465 | 3300046491 | Bacteria | 4766 |
| 34 | Ga0495584_0021450 | 3300046491 | Bacteria | 3281 |
| 35 | Ga0495584_0030027 | 3300046491 | Bacteria | 2755 |
| 36 | Ga0495585_0000414 | 3300046492 | Bacteria | 41285 |
| 37 | Ga0495585_0001906 | 3300046492 | Bacteria | 15684 |
| 38 | Ga0495585_0002144 | 3300046492 | Bacteria | 14400 |
| 39 | Ga0495585_0013042 | 3300046492 | Bacteria | 4876 |
| 40 | Ga0495585_0019535 | 3300046492 | Bacteria | 3906 |
| 41 | Ga0495585_0019906 | 3300046492 | Bacteria | 3863 |
| 42 | Ga0495585_0032478 | 3300046492 | Bacteria | 2957 |
| 43 | Ga0495585_0061296 | 3300046492 | Bacteria | 2069 |
| 44 | Ga0495585_0103272 | 3300046492 | Bacteria | 1522 |
| 45 | Ga0495585_0149444 | 3300046492 | Bacteria | 1219 |
| 46 | Ga0495594_0006492 | 3300046499 | Bacteria | 6018 |
| 47 | Ga0495594_0057299 | 3300046499 | Bacteria | 2151 |
| 48 | Ga0495596_0001664 | 3300046500 | Bacteria | 12618 |
| 49 | Ga0495596_0001992 | 3300046500 | Bacteria | 11243 |
| 50 | Ga0495596_0004386 | 3300046500 | Bacteria | 6890 |
| 51 | Ga0495596_0007264 | 3300046500 | Bacteria | 5011 |
| 52 | Ga0495596_0012776 | 3300046500 | Bacteria | 3581 |
| 53 | Ga0495596_0014635 | 3300046500 | Bacteria | 3302 |
| 54 | Ga0495596_0014694 | 3300046500 | Bacteria | 3295 |
| 55 | Ga0495596_0020158 | 3300046500 | Bacteria | 2731 |
| 56 | Ga0495596_0119081 | 3300046500 | Bacteria | 1025 |
| 57 | Ga0495607_0000473 | 3300046501 | Bacteria | 40325 |
| 58 | Ga0495607_0001183 | 3300046501 | Bacteria | 23566 |
| 59 | Ga0495607_0028113 | 3300046501 | Bacteria | 3472 |
| 60 | Ga0495607_0051376 | 3300046501 | Bacteria | 2394 |
| 61 | Ga0495607_0059590 | 3300046501 | Bacteria | 2177 |
| 62 | Ga0495583_0000314 | 3300046506 | Bacteria | 76522 |
| 63 | Ga0495583_0000408 | 3300046506 | Bacteria | 65197 |
| 64 | Ga0495583_0000792 | 3300046506 | Bacteria | 39204 |
| 65 | Ga0495583_0005334 | 3300046506 | Bacteria | 8773 |
| 66 | Ga0495583_0005790 | 3300046506 | Bacteria | 8258 |
| 67 | Ga0495583_0018569 | 3300046506 | Bacteria | 3657 |
| 68 | Ga0495583_0019883 | 3300046506 | Bacteria | 3494 |
| 69 | Ga0495583_0038889 | 3300046506 | Bacteria | 2245 |
| 70 | Ga0495606_0002093 | 3300046507 | Bacteria | 24302 |
| 71 | Ga0495606_0025064 | 3300046507 | Bacteria | 4281 |
| 72 | Ga0495606_0038717 | 3300046507 | Bacteria | 3222 |
| 73 | Ga0495606_0044512 | 3300046507 | Bacteria | 2951 |
| 74 | Ga0495606_0069205 | 3300046507 | Bacteria | 2230 |
| 75 | Ga0495606_0119338 | 3300046507 | Bacteria | 1580 |
| 76 | Ga0495606_0124275 | 3300046507 | Bacteria | 1540 |
| 77 | Ga0495606_0138963 | 3300046507 | Bacteria | 1436 |
| 78 | Ga0495610_0000771 | 3300046512 | Bacteria | 30226 |
| 79 | Ga0495610_0027301 | 3300046512 | Bacteria | 3036 |
| 80 | Ga0495616_0000080 | 3300046513 | Bacteria | 81238 |
| 81 | Ga0495616_0001149 | 3300046513 | Bacteria | 18706 |
| 82 | Ga0495616_0002515 | 3300046513 | Bacteria | 12123 |
| 83 | Ga0495616_0002583 | 3300046513 | Bacteria | 11921 |
| 84 | Ga0495616_0005258 | 3300046513 | Bacteria | 7991 |
| 85 | Ga0495616_0014500 | 3300046513 | Bacteria | 4410 |
| 86 | Ga0495616_0015012 | 3300046513 | Bacteria | 4314 |
| 87 | Ga0495616_0060722 | 3300046513 | Bacteria | 1856 |
| 88 | Ga0495616_0100638 | 3300046513 | Bacteria | 1356 |
| 89 | Ga0495631_0000527 | 3300046518 | Bacteria | 25718 |
| 90 | Ga0495631_0006380 | 3300046518 | Bacteria | 6095 |
| 91 | Ga0495631_0008144 | 3300046518 | Bacteria | 5290 |
| 92 | Ga0495631_0008889 | 3300046518 | Bacteria | 5041 |
| 93 | Ga0495631_0015639 | 3300046518 | Bacteria | 3630 |
| 94 | Ga0495631_0017026 | 3300046518 | Bacteria | 3446 |
| 95 | Ga0495631_0020369 | 3300046518 | Bacteria | 3099 |
| 96 | Ga0495631_0023086 | 3300046518 | Bacteria | 2887 |
| 97 | Ga0495631_0060522 | 3300046518 | Bacteria | 1643 |
| 98 | Ga0495632_0000044 | 3300046519 | Bacteria | 141051 |
| 99 | Ga0495632_0000066 | 3300046519 | Bacteria | 115170 |
| 100 | Ga0495632_0000285 | 3300046519 | Bacteria | 49299 |
| 101 | Ga0495632_0005387 | 3300046519 | Bacteria | 8466 |
| 102 | Ga0495632_0017883 | 3300046519 | Bacteria | 3901 |
| 103 | Ga0495637_0000009 | 3300046520 | Bacteria | 402028 |
| 104 | Ga0495637_0016976 | 3300046520 | Bacteria | 3399 |
| 105 | Ga0495637_0028848 | 3300046520 | Bacteria | 2475 |
| 106 | Ga0495643_0042311 | 3300046522 | Bacteria | 2482 |
| 107 | Ga0495644_0004078 | 3300046523 | Bacteria | 5748 |
| 108 | Ga0495644_0008832 | 3300046523 | Bacteria | 3874 |
| 109 | Ga0495644_0009163 | 3300046523 | Bacteria | 3813 |
| 110 | Ga0495644_0010222 | 3300046523 | Bacteria | 3616 |
| 111 | Ga0495644_0028744 | 3300046523 | Bacteria | 2103 |
| 112 | Ga0495644_0046813 | 3300046523 | Bacteria | 1625 |
| 113 | Ga0495648_0000411 | 3300046524 | Bacteria | 47243 |
| 114 | Ga0495648_0001558 | 3300046524 | Bacteria | 22405 |
| 115 | Ga0495648_0003362 | 3300046524 | Bacteria | 14090 |
| 116 | Ga0495648_0014326 | 3300046524 | Bacteria | 5811 |
| 117 | Ga0495648_0030260 | 3300046524 | Bacteria | 3582 |
| 118 | Ga0495648_0033559 | 3300046524 | Bacteria | 3350 |
| 119 | Ga0495648_0065158 | 3300046524 | Bacteria | 2143 |
| 120 | Ga0495648_0075403 | 3300046524 | Bacteria | 1940 |
| 121 | Ga0495648_0134161 | 3300046524 | Bacteria | 1312 |
| 122 | Ga0495666_0000729 | 3300046526 | Bacteria | 15049 |
| 123 | Ga0495642_0000083 | 3300046528 | Bacteria | 55163 |
| 124 | Ga0495642_0001236 | 3300046528 | Bacteria | 11719 |
| 125 | Ga0495642_0008970 | 3300046528 | Bacteria | 3828 |
| 126 | Ga0495642_0009405 | 3300046528 | Bacteria | 3742 |
| 127 | Ga0495642_0024810 | 3300046528 | Bacteria | 2373 |
| 128 | Ga0495642_0032461 | 3300046528 | Bacteria | 2095 |
| 129 | Ga0495642_0042685 | 3300046528 | Bacteria | 1848 |
| 130 | Ga0495654_0008547 | 3300046530 | Bacteria | 5646 |
| 131 | Ga0495654_0014688 | 3300046530 | Bacteria | 4165 |
| 132 | Ga0495665_0076340 | 3300046531 | Bacteria | 1763 |
| 133 | Ga0495640_0048623 | 3300046533 | Bacteria | 2930 |
| 134 | Ga0495586_0001925 | 3300046535 | Bacteria | 11314 |
| 135 | Ga0495609_0000981 | 3300046538 | Bacteria | 20439 |
| 136 | Ga0495609_0005116 | 3300046538 | Bacteria | 6987 |
| 137 | Ga0495609_0005840 | 3300046538 | Bacteria | 6385 |
| 138 | Ga0495609_0006928 | 3300046538 | Bacteria | 5721 |
| 139 | Ga0495609_0016634 | 3300046538 | Bacteria | 3425 |
| 140 | Ga0495609_0026501 | 3300046538 | Bacteria | 2654 |
| 141 | Ga0495609_0074967 | 3300046538 | Bacteria | 1483 |
| 142 | Ga0495597_0000009 | 3300046542 | Bacteria | 227319 |
| 143 | Ga0495597_0001070 | 3300046542 | Bacteria | 20894 |
| 144 | Ga0495597_0004727 | 3300046542 | Bacteria | 7381 |
| 145 | Ga0495597_0019458 | 3300046542 | Bacteria | 3177 |
| 146 | Ga0495597_0023546 | 3300046542 | Bacteria | 2848 |
| 147 | Ga0495633_0001136 | 3300046558 | Bacteria | 21388 |
| 148 | Ga0495633_0003325 | 3300046558 | Bacteria | 10800 |
| 149 | Ga0495633_0006341 | 3300046558 | Bacteria | 7035 |
| 150 | Ga0495633_0051238 | 3300046558 | Bacteria | 1945 |
| 151 | Ga0495668_0000350 | 3300046616 | Bacteria | 61356 |
| 152 | Ga0495668_0000353 | 3300046616 | Bacteria | 61110 |
| 153 | Ga0495668_0001625 | 3300046616 | Bacteria | 20999 |
| 154 | Ga0495668_0001888 | 3300046616 | Bacteria | 18772 |
| 155 | Ga0495668_0003163 | 3300046616 | Bacteria | 12689 |
| 156 | Ga0495668_0006140 | 3300046616 | Bacteria | 7953 |
| 157 | Ga0495668_0007231 | 3300046616 | Bacteria | 7125 |
| 158 | Ga0495668_0011948 | 3300046616 | Bacteria | 5171 |
| 159 | Ga0495668_0016212 | 3300046616 | Bacteria | 4334 |
| 160 | Ga0495668_0024761 | 3300046616 | Bacteria | 3413 |
| 161 | Ga0495668_0026107 | 3300046616 | Bacteria | 3317 |
| 162 | Ga0495668_0031374 | 3300046616 | Bacteria | 2995 |
| 163 | Ga0495668_0129528 | 3300046616 | Bacteria | 1381 |
| 164 | Ga0495611_0000311 | 3300046648 | Bacteria | 32985 |
| 165 | Ga0495611_0000507 | 3300046648 | Bacteria | 23090 |
| 166 | Ga0495611_0005090 | 3300046648 | Bacteria | 5634 |
| 167 | Ga0495611_0027117 | 3300046648 | Bacteria | 2502 |
| 168 | Ga0495611_0029821 | 3300046648 | Bacteria | 2394 |
| 169 | Ga0495611_0047366 | 3300046648 | Bacteria | 1929 |
| 170 | Ga0495625_0009979 | 3300046660 | Bacteria | 7900 |
| 171 | Ga0495625_0019788 | 3300046660 | Bacteria | 5209 |
| 172 | Ga0495625_0163688 | 3300046660 | Bacteria | 1489 |
| 173 | Ga0495635_0004629 | 3300046663 | Bacteria | 9544 |
| 174 | Ga0495661_0002590 | 3300046665 | Bacteria | 13869 |
| 175 | Ga0495661_0003447 | 3300046665 | Bacteria | 11677 |
| 176 | Ga0495661_0005386 | 3300046665 | Bacteria | 9092 |
| 177 | Ga0495661_0005950 | 3300046665 | Bacteria | 8609 |
| 178 | Ga0495661_0008161 | 3300046665 | Bacteria | 7260 |
| 179 | Ga0495661_0012794 | 3300046665 | Bacteria | 5661 |
| 180 | Ga0495661_0013107 | 3300046665 | Bacteria | 5579 |
| 181 | Ga0495661_0016193 | 3300046665 | Bacteria | 4950 |
| 182 | Ga0495661_0021700 | 3300046665 | Bacteria | 4182 |
| 183 | Ga0495661_0083898 | 3300046665 | Bacteria | 1830 |
| 184 | Ga0495661_0116219 | 3300046665 | Bacteria | 1484 |
| 185 | Ga0495661_0194452 | 3300046665 | Bacteria | 1066 |
| 186 | Ga0495588_0002904 | 3300046674 | Bacteria | 7391 |
| 187 | Ga0495588_0006942 | 3300046674 | Bacteria | 5132 |
| 188 | Ga0495588_0015343 | 3300046674 | Bacteria | 3685 |
| 189 | Ga0495588_0018453 | 3300046674 | Bacteria | 3402 |
| 190 | Ga0495588_0044637 | 3300046674 | Bacteria | 2271 |
| 191 | Ga0495669_0003163 | 3300046684 | Bacteria | 6778 |
| 192 | Ga0495669_0003811 | 3300046684 | Bacteria | 6195 |
| 193 | Ga0495669_0008141 | 3300046684 | Bacteria | 4398 |
| 194 | Ga0495669_0009716 | 3300046684 | Bacteria | 4060 |
| 195 | Ga0495669_0038014 | 3300046684 | Bacteria | 2131 |
| 196 | Ga0495669_0050854 | 3300046684 | Bacteria | 1859 |
| 197 | Ga0495670_0000319 | 3300046691 | Bacteria | 22936 |
| 198 | Ga0495670_0003697 | 3300046691 | Bacteria | 7518 |
| 199 | Ga0495670_0005980 | 3300046691 | Bacteria | 5961 |
| 200 | Ga0495670_0016228 | 3300046691 | Bacteria | 3660 |
| 201 | Ga0495670_0184936 | 3300046691 | Bacteria | 1101 |
| 202 | Ga0495671_0000469 | 3300046692 | Bacteria | 31566 |
| 203 | Ga0495671_0001768 | 3300046692 | Bacteria | 13985 |
| 204 | Ga0495671_0002294 | 3300046692 | Bacteria | 12151 |
| 205 | Ga0495671_0024162 | 3300046692 | Bacteria | 3169 |
| 206 | Ga0495671_0033891 | 3300046692 | Bacteria | 2599 |
| 207 | Ga0495671_0087384 | 3300046692 | Bacteria | 1527 |
| 208 | Ga0495649_0000546 | 3300046694 | Bacteria | 31916 |
| 209 | Ga0495649_0188309 | 3300046694 | Bacteria | 1075 |
| 210 | Ga0495589_0000581 | 3300046794 | Bacteria | 25212 |
| 211 | Ga0495589_0001114 | 3300046794 | Bacteria | 16022 |
| 212 | Ga0495589_0030105 | 3300046794 | Bacteria | 2735 |
| 213 | Ga0495589_0120725 | 3300046794 | Bacteria | 1262 |
| 214 | Ga0495660_0003932 | 3300046810 | Bacteria | 9083 |
| 215 | Ga0495660_0008642 | 3300046810 | Bacteria | 5958 |
| 216 | Ga0495660_0009653 | 3300046810 | Bacteria | 5625 |
| 217 | Ga0495660_0018983 | 3300046810 | Bacteria | 3948 |
| 218 | Ga0495660_0022705 | 3300046810 | Bacteria | 3580 |
| 219 | Ga0495660_0042481 | 3300046810 | Bacteria | 2512 |
| 220 | Ga0495660_0070731 | 3300046810 | Bacteria | 1851 |
| 221 | Ga0495660_0091119 | 3300046810 | Bacteria | 1584 |
| 222 | Ga0495660_0140094 | 3300046810 | Bacteria | 1204 |
| 223 | Ga0495672_0000131 | 3300047320 | Bacteria | 111562 |
| 224 | Ga0495672_0000290 | 3300047320 | Bacteria | 69104 |
| 225 | Ga0495672_0014279 | 3300047320 | Bacteria | 5445 |
| 226 | Ga0495672_0014375 | 3300047320 | Bacteria | 5423 |
| 227 | Ga0495672_0048652 | 3300047320 | Bacteria | 2513 |
| 228 | Ga0495676_0001530 | 3300047321 | Bacteria | 20020 |
| 229 | Ga0495680_0001842 | 3300047322 | Bacteria | 22357 |
| 230 | Ga0495683_0000160 | 3300047323 | Bacteria | 65995 |
| 231 | Ga0495683_0000378 | 3300047323 | Bacteria | 36355 |
| 232 | Ga0495683_0014094 | 3300047323 | Bacteria | 4165 |
| 233 | Ga0495687_000034 | 3300047443 | Bacteria | 257321 |
| 234 | Ga0495687_000048 | 3300047443 | Bacteria | 205967 |
| 235 | Ga0495687_004090 | 3300047443 | Bacteria | 10095 |
| 236 | Ga0495677_0000085 | 3300047445 | Bacteria | 48240 |
| 237 | Ga0495677_0000840 | 3300047445 | Bacteria | 12403 |
| 238 | Ga0495677_0001069 | 3300047445 | Bacteria | 10995 |
| 239 | Ga0495679_004026 | 3300047446 | Bacteria | 6907 |
| 240 | Ga0495679_007312 | 3300047446 | Bacteria | 4620 |
| 241 | Ga0495679_041267 | 3300047446 | Bacteria | 1430 |
| 242 | Ga0495685_003196 | 3300047447 | Bacteria | 5203 |
| 243 | Ga0495685_018567 | 3300047447 | Bacteria | 2388 |
| 244 | Ga0495681_0000018 | 3300047470 | Bacteria | 177306 |
| 245 | Ga0495681_0001284 | 3300047470 | Bacteria | 19014 |
| 246 | Ga0495681_0004008 | 3300047470 | Bacteria | 10130 |
| 247 | Ga0495681_0018437 | 3300047470 | Bacteria | 3845 |
| 248 | Ga0495681_0023348 | 3300047470 | Bacteria | 3288 |
| 249 | Ga0495681_0034536 | 3300047470 | Bacteria | 2519 |
| 250 | Ga0495686_0003618 | 3300047472 | Bacteria | 13255 |
| 251 | Ga0495686_0030184 | 3300047472 | Bacteria | 3522 |
| 252 | Ga0495686_0040432 | 3300047472 | Bacteria | 2973 |
| 253 | Ga0495686_0077706 | 3300047472 | Bacteria | 2032 |
| 254 | Ga0495593_0014943 | 3300047673 | Bacteria | 4409 |
| 255 | Ga0495614_0000655 | 3300048089 | Bacteria | 14492 |
| 256 | Ga0495626_0003258 | 3300048091 | Bacteria | 10501 |
| 257 | Ga0495626_0005364 | 3300048091 | Bacteria | 7535 |
| 258 | Ga0495626_0007727 | 3300048091 | Bacteria | 5960 |
| 259 | Ga0495626_0012397 | 3300048091 | Bacteria | 4470 |
| 260 | Ga0495626_0012812 | 3300048091 | Bacteria | 4378 |
| 261 | Ga0495626_0013075 | 3300048091 | Bacteria | 4326 |
| 262 | Ga0495626_0014166 | 3300048091 | Bacteria | 4121 |
| 263 | Ga0495626_0019289 | 3300048091 | Bacteria | 3412 |
| 264 | Ga0495626_0021456 | 3300048091 | Bacteria | 3205 |
| 265 | Ga0495626_0036437 | 3300048091 | Bacteria | 2343 |
| 266 | Ga0495626_0046000 | 3300048091 | Bacteria | 2035 |
| 267 | Ga0496102_0000437 | 3300048905 | Bacteria | 47555 |
| 268 | Ga0496102_0128056 | 3300048905 | Bacteria | 2374 |
| 269 | Ga0496103_0025720 | 3300048906 | Bacteria | 3559 |
| 270 | Ga0496107_0071227 | 3300048910 | Bacteria | 2525 |
| 271 | Ga0496108_0073911 | 3300048911 | Bacteria | 2878 |
| 272 | Ga0496109_0443553 | 3300048912 | Bacteria | 1226 |
| 273 | Ga0496110_0000042 | 3300048913 | Bacteria | 62522 |
| 274 | Ga0496111_0062903 | 3300048914 | Bacteria | 2691 |
| 275 | Ga0496115_0066434 | 3300048918 | Bacteria | 2915 |
| 276 | Ga0495678_000092 | 3300049459 | Bacteria | 114501 |
| 277 | Ga0495678_000100 | 3300049459 | Bacteria | 106118 |
| 278 | Ga0495678_000562 | 3300049459 | Bacteria | 35639 |
| 279 | Ga0495678_000574 | 3300049459 | Bacteria | 34979 |
| 280 | Ga0495682_0000809 | 3300049460 | Bacteria | 19750 |
| 281 | Ga0495682_0003016 | 3300049460 | Bacteria | 7664 |
| 282 | Ga0495682_0005072 | 3300049460 | Bacteria | 5525 |
| 283 | Ga0495682_0006951 | 3300049460 | Bacteria | 4539 |
| 284 | Ga0495682_0046034 | 3300049460 | Bacteria | 1593 |
| 285 | Ga0495597_0002267 | |||
| 286 | Ga0065165_1000243 | |||
| 287 | Ga0395900_0080030 | |||
| 288 | Ga0395898_0079997 | |||
| 289 | Ga0395901_0100862 | |||
| 290 | Ga0450904_000691 | |||
| 291 | Ga0451577_0265498 | |||
| 292 | Ga0451576_0012842 | |||
| 293 | Ga0495617_000060 | |||
| 294 | Ga0495627_000272 | |||
| 295 | Ga0495627_002379 | |||
| 296 | Ga0495627_025550 | |||
| 297 | Ga0495603_0007930 | |||
| 298 | Ga0495590_0000008 | |||
| 299 | Ga0495590_0000562 | |||
| 300 | Ga0495591_000051 | |||
| 301 | Ga0495629_0012458 | |||
| 302 | Ga0495638_0037794 | |||
| 303 | Ga0495653_0026991 | |||
| 304 | Ga0495650_0000229 | |||
| 305 | Ga0495650_0037255 | |||
| 306 | Ga0495605_0000049 | |||
| 307 | Ga0495605_0009857 | |||
| 308 | Ga0495605_0014261 | |||
| 309 | Ga0495605_0018024 | |||
| 310 | Ga0495605_0031638 | |||
| 311 | Ga0495605_0056395 | |||
| 312 | Ga0495605_0072259 | |||
| 313 | Ga0495584_0000236 | |||
| 314 | Ga0495584_0000830 | |||
| 315 | Ga0495584_0001282 | |||
| 316 | Ga0495584_0006567 | |||
| 317 | Ga0495584_0010465 | |||
| 318 | Ga0495584_0021450 | |||
| 319 | Ga0495584_0030027 | |||
| 320 | Ga0495585_0000414 | |||
| 321 | Ga0495585_0001906 | |||
| 322 | Ga0495585_0002144 | |||
| 323 | Ga0495585_0013042 | |||
| 324 | Ga0495585_0019535 | |||
| 325 | Ga0495585_0019906 | |||
| 326 | Ga0495585_0032478 | |||
| 327 | Ga0495585_0061296 | |||
| 328 | Ga0495585_0103272 | |||
| 329 | Ga0495585_0149444 | |||
| 330 | Ga0495594_0006492 | |||
| 331 | Ga0495594_0057299 | |||
| 332 | Ga0495596_0001664 | |||
| 333 | Ga0495596_0001992 | |||
| 334 | Ga0495596_0004386 | |||
| 335 | Ga0495596_0007264 | |||
| 336 | Ga0495596_0012776 | |||
| 337 | Ga0495596_0014635 | |||
| 338 | Ga0495596_0014694 | |||
| 339 | Ga0495596_0020158 | |||
| 340 | Ga0495596_0119081 | |||
| 341 | Ga0495607_0000473 | |||
| 342 | Ga0495607_0001183 | |||
| 343 | Ga0495607_0028113 | |||
| 344 | Ga0495607_0051376 | |||
| 345 | Ga0495607_0059590 | |||
| 346 | Ga0495583_0000314 | |||
| 347 | Ga0495583_0000408 | |||
| 348 | Ga0495583_0000792 | |||
| 349 | Ga0495583_0005334 | |||
| 350 | Ga0495583_0005790 | |||
| 351 | Ga0495583_0018569 | |||
| 352 | Ga0495583_0019883 | |||
| 353 | Ga0495583_0038889 | |||
| 354 | Ga0495606_0002093 | |||
| 355 | Ga0495606_0025064 | |||
| 356 | Ga0495606_0038717 | |||
| 357 | Ga0495606_0044512 | |||
| 358 | Ga0495606_0069205 | |||
| 359 | Ga0495606_0119338 | |||
| 360 | Ga0495606_0124275 | |||
| 361 | Ga0495606_0138963 | |||
| 362 | Ga0495610_0000771 | |||
| 363 | Ga0495610_0027301 | |||
| 364 | Ga0495616_0000080 | |||
| 365 | Ga0495616_0001149 | |||
| 366 | Ga0495616_0002515 | |||
| 367 | Ga0495616_0002583 | |||
| 368 | Ga0495616_0005258 | |||
| 369 | Ga0495616_0014500 | |||
| 370 | Ga0495616_0015012 | |||
| 371 | Ga0495616_0060722 | |||
| 372 | Ga0495616_0100638 | |||
| 373 | Ga0495631_0000527 | |||
| 374 | Ga0495631_0006380 | |||
| 375 | Ga0495631_0008144 | |||
| 376 | Ga0495631_0008889 | |||
| 377 | Ga0495631_0015639 | |||
| 378 | Ga0495631_0017026 | |||
| 379 | Ga0495631_0020369 | |||
| 380 | Ga0495631_0023086 | |||
| 381 | Ga0495631_0060522 | |||
| 382 | Ga0495632_0000044 | |||
| 383 | Ga0495632_0000066 | |||
| 384 | Ga0495632_0000285 | |||
| 385 | Ga0495632_0005387 | |||
| 386 | Ga0495632_0017883 | |||
| 387 | Ga0495637_0000009 | |||
| 388 | Ga0495637_0016976 | |||
| 389 | Ga0495637_0028848 | |||
| 390 | Ga0495643_0042311 | |||
| 391 | Ga0495644_0004078 | |||
| 392 | Ga0495644_0008832 | |||
| 393 | Ga0495644_0009163 | |||
| 394 | Ga0495644_0010222 | |||
| 395 | Ga0495644_0028744 | |||
| 396 | Ga0495644_0046813 | |||
| 397 | Ga0495648_0000411 | |||
| 398 | Ga0495648_0001558 | |||
| 399 | Ga0495648_0003362 | |||
| 400 | Ga0495648_0014326 | |||
| 401 | Ga0495648_0030260 | |||
| 402 | Ga0495648_0033559 | |||
| 403 | Ga0495648_0065158 | |||
| 404 | Ga0495648_0075403 | |||
| 405 | Ga0495648_0134161 | |||
| 406 | Ga0495666_0000729 | |||
| 407 | Ga0495642_0000083 | |||
| 408 | Ga0495642_0001236 | |||
| 409 | Ga0495642_0008970 | |||
| 410 | Ga0495642_0009405 | |||
| 411 | Ga0495642_0024810 | |||
| 412 | Ga0495642_0032461 | |||
| 413 | Ga0495642_0042685 | |||
| 414 | Ga0495654_0008547 | |||
| 415 | Ga0495654_0014688 | |||
| 416 | Ga0495665_0076340 | |||
| 417 | Ga0495640_0048623 | |||
| 418 | Ga0495586_0001925 | |||
| 419 | Ga0495609_0000981 | |||
| 420 | Ga0495609_0005116 | |||
| 421 | Ga0495609_0005840 | |||
| 422 | Ga0495609_0006928 | |||
| 423 | Ga0495609_0016634 | |||
| 424 | Ga0495609_0026501 | |||
| 425 | Ga0495609_0074967 | |||
| 426 | Ga0495597_0000009 | |||
| 427 | Ga0495597_0001070 | |||
| 428 | Ga0495597_0004727 | |||
| 429 | Ga0495597_0019458 | |||
| 430 | Ga0495597_0023546 | |||
| 431 | Ga0495633_0001136 | |||
| 432 | Ga0495633_0003325 | |||
| 433 | Ga0495633_0006341 | |||
| 434 | Ga0495633_0051238 | |||
| 435 | Ga0495668_0000350 | |||
| 436 | Ga0495668_0000353 | |||
| 437 | Ga0495668_0001625 | |||
| 438 | Ga0495668_0001888 | |||
| 439 | Ga0495668_0003163 | |||
| 440 | Ga0495668_0006140 | |||
| 441 | Ga0495668_0007231 | |||
| 442 | Ga0495668_0011948 | |||
| 443 | Ga0495668_0016212 | |||
| 444 | Ga0495668_0024761 | |||
| 445 | Ga0495668_0026107 | |||
| 446 | Ga0495668_0031374 | |||
| 447 | Ga0495668_0129528 | |||
| 448 | Ga0495611_0000311 | |||
| 449 | Ga0495611_0000507 | |||
| 450 | Ga0495611_0005090 | |||
| 451 | Ga0495611_0027117 | |||
| 452 | Ga0495611_0029821 | |||
| 453 | Ga0495611_0047366 | |||
| 454 | Ga0495625_0009979 | |||
| 455 | Ga0495625_0019788 | |||
| 456 | Ga0495625_0163688 | |||
| 457 | Ga0495635_0004629 | |||
| 458 | Ga0495661_0002590 | |||
| 459 | Ga0495661_0003447 | |||
| 460 | Ga0495661_0005386 | |||
| 461 | Ga0495661_0005950 | |||
| 462 | Ga0495661_0008161 | |||
| 463 | Ga0495661_0012794 | |||
| 464 | Ga0495661_0013107 | |||
| 465 | Ga0495661_0016193 | |||
| 466 | Ga0495661_0021700 | |||
| 467 | Ga0495661_0083898 | |||
| 468 | Ga0495661_0116219 | |||
| 469 | Ga0495661_0194452 | |||
| 470 | Ga0495588_0002904 | |||
| 471 | Ga0495588_0006942 | |||
| 472 | Ga0495588_0015343 | |||
| 473 | Ga0495588_0018453 | |||
| 474 | Ga0495588_0044637 | |||
| 475 | Ga0495669_0003163 | |||
| 476 | Ga0495669_0003811 | |||
| 477 | Ga0495669_0008141 | |||
| 478 | Ga0495669_0009716 | |||
| 479 | Ga0495669_0038014 | |||
| 480 | Ga0495669_0050854 | |||
| 481 | Ga0495670_0000319 | |||
| 482 | Ga0495670_0003697 | |||
| 483 | Ga0495670_0005980 | |||
| 484 | Ga0495670_0016228 | |||
| 485 | Ga0495670_0184936 | |||
| 486 | Ga0495671_0000469 | |||
| 487 | Ga0495671_0001768 | |||
| 488 | Ga0495671_0002294 | |||
| 489 | Ga0495671_0024162 | |||
| 490 | Ga0495671_0033891 | |||
| 491 | Ga0495671_0087384 | |||
| 492 | Ga0495649_0000546 | |||
| 493 | Ga0495649_0188309 | |||
| 494 | Ga0495589_0000581 | |||
| 495 | Ga0495589_0001114 | |||
| 496 | Ga0495589_0030105 | |||
| 497 | Ga0495589_0120725 | |||
| 498 | Ga0495660_0003932 | |||
| 499 | Ga0495660_0008642 | |||
| 500 | Ga0495660_0009653 | |||
| 501 | Ga0495660_0018983 | |||
| 502 | Ga0495660_0022705 | |||
| 503 | Ga0495660_0042481 | |||
| 504 | Ga0495660_0070731 | |||
| 505 | Ga0495660_0091119 | |||
| 506 | Ga0495660_0140094 | |||
| 507 | Ga0495672_0000131 | |||
| 508 | Ga0495672_0000290 | |||
| 509 | Ga0495672_0014279 | |||
| 510 | Ga0495672_0014375 | |||
| 511 | Ga0495672_0048652 | |||
| 512 | Ga0495676_0001530 | |||
| 513 | Ga0495680_0001842 | |||
| 514 | Ga0495683_0000160 | |||
| 515 | Ga0495683_0000378 | |||
| 516 | Ga0495683_0014094 | |||
| 517 | Ga0495687_000034 | |||
| 518 | Ga0495687_000048 | |||
| 519 | Ga0495687_004090 | |||
| 520 | Ga0495677_0000085 | |||
| 521 | Ga0495677_0000840 | |||
| 522 | Ga0495677_0001069 | |||
| 523 | Ga0495679_004026 | |||
| 524 | Ga0495679_007312 | |||
| 525 | Ga0495679_041267 | |||
| 526 | Ga0495685_003196 | |||
| 527 | Ga0495685_018567 | |||
| 528 | Ga0495681_0000018 | |||
| 529 | Ga0495681_0001284 | |||
| 530 | Ga0495681_0004008 | |||
| 531 | Ga0495681_0018437 | |||
| 532 | Ga0495681_0023348 | |||
| 533 | Ga0495681_0034536 | |||
| 534 | Ga0495686_0003618 | |||
| 535 | Ga0495686_0030184 | |||
| 536 | Ga0495686_0040432 | |||
| 537 | Ga0495686_0077706 | |||
| 538 | Ga0495593_0014943 | |||
| 539 | Ga0495614_0000655 | |||
| 540 | Ga0495626_0003258 | |||
| 541 | Ga0495626_0005364 | |||
| 542 | Ga0495626_0007727 | |||
| 543 | Ga0495626_0012397 | |||
| 544 | Ga0495626_0012812 | |||
| 545 | Ga0495626_0013075 | |||
| 546 | Ga0495626_0014166 | |||
| 547 | Ga0495626_0019289 | |||
| 548 | Ga0495626_0021456 | |||
| 549 | Ga0495626_0036437 | |||
| 550 | Ga0495626_0046000 | |||
| 551 | Ga0496102_0000437 | |||
| 552 | Ga0496102_0128056 | |||
| 553 | Ga0496103_0025720 | |||
| 554 | Ga0496107_0071227 | |||
| 555 | Ga0496108_0073911 | |||
| 556 | Ga0496109_0443553 | |||
| 557 | Ga0496110_0000042 | |||
| 558 | Ga0496111_0062903 | |||
| 559 | Ga0496115_0066434 | |||
| 560 | Ga0495678_000092 | |||
| 561 | Ga0495678_000100 | |||
| 562 | Ga0495678_000562 | |||
| 563 | Ga0495678_000574 | |||
| 564 | Ga0495682_0000809 | |||
| 565 | Ga0495682_0003016 | |||
| 566 | Ga0495682_0005072 | |||
| 567 | Ga0495682_0006951 | |||
| 568 | Ga0495682_0046034 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ixm-assembly1.cif.gz_B | the lps transporter lptde from yersinia pestis, core complex | 0.7092 | 285 | 326 |
| 7nw1-assembly1.cif.gz_AAA | crystal structure of ufc1 in complex with uba5 | 0.6981 | 282 | 323 |
| 3afp-assembly1.cif.gz_A-2 | crystal structure of the single-stranded dna binding protein from mycobacterium leprae (form i) | 0.6944 | 285 | 322 |
| 4m5t-assembly3.cif.gz_E | disulfide trapped human alphab crystallin core domain in complex with c-terminal peptide | 0.6534 | 285 | 323 |
| 7nvj-assembly1.cif.gz_AAA | crystal structure of ufc1 y110a & f121a | 0.635 | 282 | 323 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q99210_13_226_3.90.950.10 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.8201 | 294 | 324 | 3.90.950.10 |
| 3q2wA04 | Mainly Beta;Sandwich;Immunoglobulin-like;Cadherins | 0.7956 | 297 | 326 | 2.60.40.60 |
| af_E7F9B5_678_780_2.60.40.60 | Mainly Beta;Sandwich;Immunoglobulin-like;Cadherins | 0.7874 | 297 | 323 | 2.60.40.60 |
| af_A4I9D5_205_471_3.40.850.10 | Alpha Beta;3-Layer(aba) Sandwich;Kinesin;Kinesin motor domain | 0.7807 | 295 | 322 | 3.40.850.10 |
| af_Q4D315_1583_2097_3.40.850.10 | Alpha Beta;3-Layer(aba) Sandwich;Kinesin;Kinesin motor domain | 0.7367 | 295 | 323 | 3.40.850.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-R0I7K7-F1-model_v4 | Protein DETOXIFICATION (Multidrug and toxic compound extrusion protein) | 0.8962 | 284 | 326 |
GO:0015297
GO:0016020 GO:0042910 GO:1990961 |
| AF-A0A086WDI4-F1-model_v4 | N-terminal cleavage protein | 0.8847 | 5 | 326 |
GO:0016020
|
| AF-A0A086WDI4-F1-model_v4 | N-terminal cleavage protein | 0.8818 | 5 | 326 |
GO:0016020
|
| AF-A0A0L0F8T4-F1-model_v4 | Uncharacterized protein | 0.8762 | 285 | 326 |
|
| AF-A0A2K3KK18-F1-model_v4 | Uncharacterized protein | 0.8655 | 285 | 326 |
|