F386384

General Info

Members Datasets Scaffolds Average Seq Length
284 76 568 309

Family's Representative Sequence

Representative Sequence 3300046542|Ga0495597_0002267|Ga0495597_0002267_5414_6412
Length 332
Sequence MKRLPIRLRSGGFTLVEAIITIAIIGIIGGIVAVFIRAPILSYRDTVDRAELSDQADLALRRMARDIRLALPNSVRIAATTDDQGEHPGAHLELLLTRSGARYLSADDGVAVDKTLSFDDAAKRDFLALAPPRTFDDVRVGDFVVVYNLGPGLAPADAYALEDTGEINGNVGRAGNKDACPSGAPVTAAGNIARICLLNAAATDADLNAPVRGITLARNPFALQQPTTMASPLQRFQVVSGPVSFYCAKNTDGRWALWRAWDYPIAATQAVPAGGKRALVATGLDSCDNIFAYGSAASQRTGLVRIALSLRGRTENPPVIRLVHQVHVDNTP

Samples

Sample ID Description Type Environment
1 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
2 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
3 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
4 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
5 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
6 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
7 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
8 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
9 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
10 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
11 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
12 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
13 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
14 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
15 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
16 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
17 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
18 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
19 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
20 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
21 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
22 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
23 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
24 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
25 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
26 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
27 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
28 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
29 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
30 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
31 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
32 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
33 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
34 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
35 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
36 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
37 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
38 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
39 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
40 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
41 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
42 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
43 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
44 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
45 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
46 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
47 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
48 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
49 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
50 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
51 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
52 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
53 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
54 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
55 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
56 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
57 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
58 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
59 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
60 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
61 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
62 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
63 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
64 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
65 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
66 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
67 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
68 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
69 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
70 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
71 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
72 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
73 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
74 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
75 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
76 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 3.17
Rhizosphere 96.48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495597_0002267 3300046542 Bacteria 12501
2 Ga0065165_1000243 3300005262 Bacteria 93455
3 Ga0395900_0080030 3300037418 Bacteria 3358
4 Ga0395898_0079997 3300037466 Bacteria 3152
5 Ga0395901_0100862 3300038443 Bacteria 3029
6 Ga0450904_000691 3300042139 Bacteria 5981
7 Ga0451577_0265498 3300042876 Bacteria 1554
8 Ga0451576_0012842 3300045051 Bacteria 9395
9 Ga0495617_000060 3300046452 Bacteria 97123
10 Ga0495627_000272 3300046453 Bacteria 52368
11 Ga0495627_002379 3300046453 Bacteria 9151
12 Ga0495627_025550 3300046453 Bacteria 1914
13 Ga0495603_0007930 3300046455 Bacteria 6407
14 Ga0495590_0000008 3300046457 Bacteria 330520
15 Ga0495590_0000562 3300046457 Bacteria 17639
16 Ga0495591_000051 3300046458 Bacteria 137457
17 Ga0495629_0012458 3300046459 Bacteria 6160
18 Ga0495638_0037794 3300046460 Bacteria 3071
19 Ga0495653_0026991 3300046463 Bacteria 4599
20 Ga0495650_0000229 3300046471 Bacteria 114086
21 Ga0495650_0037255 3300046471 Bacteria 2119
22 Ga0495605_0000049 3300046474 Bacteria 166669
23 Ga0495605_0009857 3300046474 Bacteria 5359
24 Ga0495605_0014261 3300046474 Bacteria 4357
25 Ga0495605_0018024 3300046474 Bacteria 3792
26 Ga0495605_0031638 3300046474 Bacteria 2701
27 Ga0495605_0056395 3300046474 Bacteria 1895
28 Ga0495605_0072259 3300046474 Bacteria 1627
29 Ga0495584_0000236 3300046491 Bacteria 39815
30 Ga0495584_0000830 3300046491 Bacteria 20251
31 Ga0495584_0001282 3300046491 Bacteria 15288
32 Ga0495584_0006567 3300046491 Bacteria 6079
33 Ga0495584_0010465 3300046491 Bacteria 4766
34 Ga0495584_0021450 3300046491 Bacteria 3281
35 Ga0495584_0030027 3300046491 Bacteria 2755
36 Ga0495585_0000414 3300046492 Bacteria 41285
37 Ga0495585_0001906 3300046492 Bacteria 15684
38 Ga0495585_0002144 3300046492 Bacteria 14400
39 Ga0495585_0013042 3300046492 Bacteria 4876
40 Ga0495585_0019535 3300046492 Bacteria 3906
41 Ga0495585_0019906 3300046492 Bacteria 3863
42 Ga0495585_0032478 3300046492 Bacteria 2957
43 Ga0495585_0061296 3300046492 Bacteria 2069
44 Ga0495585_0103272 3300046492 Bacteria 1522
45 Ga0495585_0149444 3300046492 Bacteria 1219
46 Ga0495594_0006492 3300046499 Bacteria 6018
47 Ga0495594_0057299 3300046499 Bacteria 2151
48 Ga0495596_0001664 3300046500 Bacteria 12618
49 Ga0495596_0001992 3300046500 Bacteria 11243
50 Ga0495596_0004386 3300046500 Bacteria 6890
51 Ga0495596_0007264 3300046500 Bacteria 5011
52 Ga0495596_0012776 3300046500 Bacteria 3581
53 Ga0495596_0014635 3300046500 Bacteria 3302
54 Ga0495596_0014694 3300046500 Bacteria 3295
55 Ga0495596_0020158 3300046500 Bacteria 2731
56 Ga0495596_0119081 3300046500 Bacteria 1025
57 Ga0495607_0000473 3300046501 Bacteria 40325
58 Ga0495607_0001183 3300046501 Bacteria 23566
59 Ga0495607_0028113 3300046501 Bacteria 3472
60 Ga0495607_0051376 3300046501 Bacteria 2394
61 Ga0495607_0059590 3300046501 Bacteria 2177
62 Ga0495583_0000314 3300046506 Bacteria 76522
63 Ga0495583_0000408 3300046506 Bacteria 65197
64 Ga0495583_0000792 3300046506 Bacteria 39204
65 Ga0495583_0005334 3300046506 Bacteria 8773
66 Ga0495583_0005790 3300046506 Bacteria 8258
67 Ga0495583_0018569 3300046506 Bacteria 3657
68 Ga0495583_0019883 3300046506 Bacteria 3494
69 Ga0495583_0038889 3300046506 Bacteria 2245
70 Ga0495606_0002093 3300046507 Bacteria 24302
71 Ga0495606_0025064 3300046507 Bacteria 4281
72 Ga0495606_0038717 3300046507 Bacteria 3222
73 Ga0495606_0044512 3300046507 Bacteria 2951
74 Ga0495606_0069205 3300046507 Bacteria 2230
75 Ga0495606_0119338 3300046507 Bacteria 1580
76 Ga0495606_0124275 3300046507 Bacteria 1540
77 Ga0495606_0138963 3300046507 Bacteria 1436
78 Ga0495610_0000771 3300046512 Bacteria 30226
79 Ga0495610_0027301 3300046512 Bacteria 3036
80 Ga0495616_0000080 3300046513 Bacteria 81238
81 Ga0495616_0001149 3300046513 Bacteria 18706
82 Ga0495616_0002515 3300046513 Bacteria 12123
83 Ga0495616_0002583 3300046513 Bacteria 11921
84 Ga0495616_0005258 3300046513 Bacteria 7991
85 Ga0495616_0014500 3300046513 Bacteria 4410
86 Ga0495616_0015012 3300046513 Bacteria 4314
87 Ga0495616_0060722 3300046513 Bacteria 1856
88 Ga0495616_0100638 3300046513 Bacteria 1356
89 Ga0495631_0000527 3300046518 Bacteria 25718
90 Ga0495631_0006380 3300046518 Bacteria 6095
91 Ga0495631_0008144 3300046518 Bacteria 5290
92 Ga0495631_0008889 3300046518 Bacteria 5041
93 Ga0495631_0015639 3300046518 Bacteria 3630
94 Ga0495631_0017026 3300046518 Bacteria 3446
95 Ga0495631_0020369 3300046518 Bacteria 3099
96 Ga0495631_0023086 3300046518 Bacteria 2887
97 Ga0495631_0060522 3300046518 Bacteria 1643
98 Ga0495632_0000044 3300046519 Bacteria 141051
99 Ga0495632_0000066 3300046519 Bacteria 115170
100 Ga0495632_0000285 3300046519 Bacteria 49299
101 Ga0495632_0005387 3300046519 Bacteria 8466
102 Ga0495632_0017883 3300046519 Bacteria 3901
103 Ga0495637_0000009 3300046520 Bacteria 402028
104 Ga0495637_0016976 3300046520 Bacteria 3399
105 Ga0495637_0028848 3300046520 Bacteria 2475
106 Ga0495643_0042311 3300046522 Bacteria 2482
107 Ga0495644_0004078 3300046523 Bacteria 5748
108 Ga0495644_0008832 3300046523 Bacteria 3874
109 Ga0495644_0009163 3300046523 Bacteria 3813
110 Ga0495644_0010222 3300046523 Bacteria 3616
111 Ga0495644_0028744 3300046523 Bacteria 2103
112 Ga0495644_0046813 3300046523 Bacteria 1625
113 Ga0495648_0000411 3300046524 Bacteria 47243
114 Ga0495648_0001558 3300046524 Bacteria 22405
115 Ga0495648_0003362 3300046524 Bacteria 14090
116 Ga0495648_0014326 3300046524 Bacteria 5811
117 Ga0495648_0030260 3300046524 Bacteria 3582
118 Ga0495648_0033559 3300046524 Bacteria 3350
119 Ga0495648_0065158 3300046524 Bacteria 2143
120 Ga0495648_0075403 3300046524 Bacteria 1940
121 Ga0495648_0134161 3300046524 Bacteria 1312
122 Ga0495666_0000729 3300046526 Bacteria 15049
123 Ga0495642_0000083 3300046528 Bacteria 55163
124 Ga0495642_0001236 3300046528 Bacteria 11719
125 Ga0495642_0008970 3300046528 Bacteria 3828
126 Ga0495642_0009405 3300046528 Bacteria 3742
127 Ga0495642_0024810 3300046528 Bacteria 2373
128 Ga0495642_0032461 3300046528 Bacteria 2095
129 Ga0495642_0042685 3300046528 Bacteria 1848
130 Ga0495654_0008547 3300046530 Bacteria 5646
131 Ga0495654_0014688 3300046530 Bacteria 4165
132 Ga0495665_0076340 3300046531 Bacteria 1763
133 Ga0495640_0048623 3300046533 Bacteria 2930
134 Ga0495586_0001925 3300046535 Bacteria 11314
135 Ga0495609_0000981 3300046538 Bacteria 20439
136 Ga0495609_0005116 3300046538 Bacteria 6987
137 Ga0495609_0005840 3300046538 Bacteria 6385
138 Ga0495609_0006928 3300046538 Bacteria 5721
139 Ga0495609_0016634 3300046538 Bacteria 3425
140 Ga0495609_0026501 3300046538 Bacteria 2654
141 Ga0495609_0074967 3300046538 Bacteria 1483
142 Ga0495597_0000009 3300046542 Bacteria 227319
143 Ga0495597_0001070 3300046542 Bacteria 20894
144 Ga0495597_0004727 3300046542 Bacteria 7381
145 Ga0495597_0019458 3300046542 Bacteria 3177
146 Ga0495597_0023546 3300046542 Bacteria 2848
147 Ga0495633_0001136 3300046558 Bacteria 21388
148 Ga0495633_0003325 3300046558 Bacteria 10800
149 Ga0495633_0006341 3300046558 Bacteria 7035
150 Ga0495633_0051238 3300046558 Bacteria 1945
151 Ga0495668_0000350 3300046616 Bacteria 61356
152 Ga0495668_0000353 3300046616 Bacteria 61110
153 Ga0495668_0001625 3300046616 Bacteria 20999
154 Ga0495668_0001888 3300046616 Bacteria 18772
155 Ga0495668_0003163 3300046616 Bacteria 12689
156 Ga0495668_0006140 3300046616 Bacteria 7953
157 Ga0495668_0007231 3300046616 Bacteria 7125
158 Ga0495668_0011948 3300046616 Bacteria 5171
159 Ga0495668_0016212 3300046616 Bacteria 4334
160 Ga0495668_0024761 3300046616 Bacteria 3413
161 Ga0495668_0026107 3300046616 Bacteria 3317
162 Ga0495668_0031374 3300046616 Bacteria 2995
163 Ga0495668_0129528 3300046616 Bacteria 1381
164 Ga0495611_0000311 3300046648 Bacteria 32985
165 Ga0495611_0000507 3300046648 Bacteria 23090
166 Ga0495611_0005090 3300046648 Bacteria 5634
167 Ga0495611_0027117 3300046648 Bacteria 2502
168 Ga0495611_0029821 3300046648 Bacteria 2394
169 Ga0495611_0047366 3300046648 Bacteria 1929
170 Ga0495625_0009979 3300046660 Bacteria 7900
171 Ga0495625_0019788 3300046660 Bacteria 5209
172 Ga0495625_0163688 3300046660 Bacteria 1489
173 Ga0495635_0004629 3300046663 Bacteria 9544
174 Ga0495661_0002590 3300046665 Bacteria 13869
175 Ga0495661_0003447 3300046665 Bacteria 11677
176 Ga0495661_0005386 3300046665 Bacteria 9092
177 Ga0495661_0005950 3300046665 Bacteria 8609
178 Ga0495661_0008161 3300046665 Bacteria 7260
179 Ga0495661_0012794 3300046665 Bacteria 5661
180 Ga0495661_0013107 3300046665 Bacteria 5579
181 Ga0495661_0016193 3300046665 Bacteria 4950
182 Ga0495661_0021700 3300046665 Bacteria 4182
183 Ga0495661_0083898 3300046665 Bacteria 1830
184 Ga0495661_0116219 3300046665 Bacteria 1484
185 Ga0495661_0194452 3300046665 Bacteria 1066
186 Ga0495588_0002904 3300046674 Bacteria 7391
187 Ga0495588_0006942 3300046674 Bacteria 5132
188 Ga0495588_0015343 3300046674 Bacteria 3685
189 Ga0495588_0018453 3300046674 Bacteria 3402
190 Ga0495588_0044637 3300046674 Bacteria 2271
191 Ga0495669_0003163 3300046684 Bacteria 6778
192 Ga0495669_0003811 3300046684 Bacteria 6195
193 Ga0495669_0008141 3300046684 Bacteria 4398
194 Ga0495669_0009716 3300046684 Bacteria 4060
195 Ga0495669_0038014 3300046684 Bacteria 2131
196 Ga0495669_0050854 3300046684 Bacteria 1859
197 Ga0495670_0000319 3300046691 Bacteria 22936
198 Ga0495670_0003697 3300046691 Bacteria 7518
199 Ga0495670_0005980 3300046691 Bacteria 5961
200 Ga0495670_0016228 3300046691 Bacteria 3660
201 Ga0495670_0184936 3300046691 Bacteria 1101
202 Ga0495671_0000469 3300046692 Bacteria 31566
203 Ga0495671_0001768 3300046692 Bacteria 13985
204 Ga0495671_0002294 3300046692 Bacteria 12151
205 Ga0495671_0024162 3300046692 Bacteria 3169
206 Ga0495671_0033891 3300046692 Bacteria 2599
207 Ga0495671_0087384 3300046692 Bacteria 1527
208 Ga0495649_0000546 3300046694 Bacteria 31916
209 Ga0495649_0188309 3300046694 Bacteria 1075
210 Ga0495589_0000581 3300046794 Bacteria 25212
211 Ga0495589_0001114 3300046794 Bacteria 16022
212 Ga0495589_0030105 3300046794 Bacteria 2735
213 Ga0495589_0120725 3300046794 Bacteria 1262
214 Ga0495660_0003932 3300046810 Bacteria 9083
215 Ga0495660_0008642 3300046810 Bacteria 5958
216 Ga0495660_0009653 3300046810 Bacteria 5625
217 Ga0495660_0018983 3300046810 Bacteria 3948
218 Ga0495660_0022705 3300046810 Bacteria 3580
219 Ga0495660_0042481 3300046810 Bacteria 2512
220 Ga0495660_0070731 3300046810 Bacteria 1851
221 Ga0495660_0091119 3300046810 Bacteria 1584
222 Ga0495660_0140094 3300046810 Bacteria 1204
223 Ga0495672_0000131 3300047320 Bacteria 111562
224 Ga0495672_0000290 3300047320 Bacteria 69104
225 Ga0495672_0014279 3300047320 Bacteria 5445
226 Ga0495672_0014375 3300047320 Bacteria 5423
227 Ga0495672_0048652 3300047320 Bacteria 2513
228 Ga0495676_0001530 3300047321 Bacteria 20020
229 Ga0495680_0001842 3300047322 Bacteria 22357
230 Ga0495683_0000160 3300047323 Bacteria 65995
231 Ga0495683_0000378 3300047323 Bacteria 36355
232 Ga0495683_0014094 3300047323 Bacteria 4165
233 Ga0495687_000034 3300047443 Bacteria 257321
234 Ga0495687_000048 3300047443 Bacteria 205967
235 Ga0495687_004090 3300047443 Bacteria 10095
236 Ga0495677_0000085 3300047445 Bacteria 48240
237 Ga0495677_0000840 3300047445 Bacteria 12403
238 Ga0495677_0001069 3300047445 Bacteria 10995
239 Ga0495679_004026 3300047446 Bacteria 6907
240 Ga0495679_007312 3300047446 Bacteria 4620
241 Ga0495679_041267 3300047446 Bacteria 1430
242 Ga0495685_003196 3300047447 Bacteria 5203
243 Ga0495685_018567 3300047447 Bacteria 2388
244 Ga0495681_0000018 3300047470 Bacteria 177306
245 Ga0495681_0001284 3300047470 Bacteria 19014
246 Ga0495681_0004008 3300047470 Bacteria 10130
247 Ga0495681_0018437 3300047470 Bacteria 3845
248 Ga0495681_0023348 3300047470 Bacteria 3288
249 Ga0495681_0034536 3300047470 Bacteria 2519
250 Ga0495686_0003618 3300047472 Bacteria 13255
251 Ga0495686_0030184 3300047472 Bacteria 3522
252 Ga0495686_0040432 3300047472 Bacteria 2973
253 Ga0495686_0077706 3300047472 Bacteria 2032
254 Ga0495593_0014943 3300047673 Bacteria 4409
255 Ga0495614_0000655 3300048089 Bacteria 14492
256 Ga0495626_0003258 3300048091 Bacteria 10501
257 Ga0495626_0005364 3300048091 Bacteria 7535
258 Ga0495626_0007727 3300048091 Bacteria 5960
259 Ga0495626_0012397 3300048091 Bacteria 4470
260 Ga0495626_0012812 3300048091 Bacteria 4378
261 Ga0495626_0013075 3300048091 Bacteria 4326
262 Ga0495626_0014166 3300048091 Bacteria 4121
263 Ga0495626_0019289 3300048091 Bacteria 3412
264 Ga0495626_0021456 3300048091 Bacteria 3205
265 Ga0495626_0036437 3300048091 Bacteria 2343
266 Ga0495626_0046000 3300048091 Bacteria 2035
267 Ga0496102_0000437 3300048905 Bacteria 47555
268 Ga0496102_0128056 3300048905 Bacteria 2374
269 Ga0496103_0025720 3300048906 Bacteria 3559
270 Ga0496107_0071227 3300048910 Bacteria 2525
271 Ga0496108_0073911 3300048911 Bacteria 2878
272 Ga0496109_0443553 3300048912 Bacteria 1226
273 Ga0496110_0000042 3300048913 Bacteria 62522
274 Ga0496111_0062903 3300048914 Bacteria 2691
275 Ga0496115_0066434 3300048918 Bacteria 2915
276 Ga0495678_000092 3300049459 Bacteria 114501
277 Ga0495678_000100 3300049459 Bacteria 106118
278 Ga0495678_000562 3300049459 Bacteria 35639
279 Ga0495678_000574 3300049459 Bacteria 34979
280 Ga0495682_0000809 3300049460 Bacteria 19750
281 Ga0495682_0003016 3300049460 Bacteria 7664
282 Ga0495682_0005072 3300049460 Bacteria 5525
283 Ga0495682_0006951 3300049460 Bacteria 4539
284 Ga0495682_0046034 3300049460 Bacteria 1593
285 Ga0495597_0002267
286 Ga0065165_1000243
287 Ga0395900_0080030
288 Ga0395898_0079997
289 Ga0395901_0100862
290 Ga0450904_000691
291 Ga0451577_0265498
292 Ga0451576_0012842
293 Ga0495617_000060
294 Ga0495627_000272
295 Ga0495627_002379
296 Ga0495627_025550
297 Ga0495603_0007930
298 Ga0495590_0000008
299 Ga0495590_0000562
300 Ga0495591_000051
301 Ga0495629_0012458
302 Ga0495638_0037794
303 Ga0495653_0026991
304 Ga0495650_0000229
305 Ga0495650_0037255
306 Ga0495605_0000049
307 Ga0495605_0009857
308 Ga0495605_0014261
309 Ga0495605_0018024
310 Ga0495605_0031638
311 Ga0495605_0056395
312 Ga0495605_0072259
313 Ga0495584_0000236
314 Ga0495584_0000830
315 Ga0495584_0001282
316 Ga0495584_0006567
317 Ga0495584_0010465
318 Ga0495584_0021450
319 Ga0495584_0030027
320 Ga0495585_0000414
321 Ga0495585_0001906
322 Ga0495585_0002144
323 Ga0495585_0013042
324 Ga0495585_0019535
325 Ga0495585_0019906
326 Ga0495585_0032478
327 Ga0495585_0061296
328 Ga0495585_0103272
329 Ga0495585_0149444
330 Ga0495594_0006492
331 Ga0495594_0057299
332 Ga0495596_0001664
333 Ga0495596_0001992
334 Ga0495596_0004386
335 Ga0495596_0007264
336 Ga0495596_0012776
337 Ga0495596_0014635
338 Ga0495596_0014694
339 Ga0495596_0020158
340 Ga0495596_0119081
341 Ga0495607_0000473
342 Ga0495607_0001183
343 Ga0495607_0028113
344 Ga0495607_0051376
345 Ga0495607_0059590
346 Ga0495583_0000314
347 Ga0495583_0000408
348 Ga0495583_0000792
349 Ga0495583_0005334
350 Ga0495583_0005790
351 Ga0495583_0018569
352 Ga0495583_0019883
353 Ga0495583_0038889
354 Ga0495606_0002093
355 Ga0495606_0025064
356 Ga0495606_0038717
357 Ga0495606_0044512
358 Ga0495606_0069205
359 Ga0495606_0119338
360 Ga0495606_0124275
361 Ga0495606_0138963
362 Ga0495610_0000771
363 Ga0495610_0027301
364 Ga0495616_0000080
365 Ga0495616_0001149
366 Ga0495616_0002515
367 Ga0495616_0002583
368 Ga0495616_0005258
369 Ga0495616_0014500
370 Ga0495616_0015012
371 Ga0495616_0060722
372 Ga0495616_0100638
373 Ga0495631_0000527
374 Ga0495631_0006380
375 Ga0495631_0008144
376 Ga0495631_0008889
377 Ga0495631_0015639
378 Ga0495631_0017026
379 Ga0495631_0020369
380 Ga0495631_0023086
381 Ga0495631_0060522
382 Ga0495632_0000044
383 Ga0495632_0000066
384 Ga0495632_0000285
385 Ga0495632_0005387
386 Ga0495632_0017883
387 Ga0495637_0000009
388 Ga0495637_0016976
389 Ga0495637_0028848
390 Ga0495643_0042311
391 Ga0495644_0004078
392 Ga0495644_0008832
393 Ga0495644_0009163
394 Ga0495644_0010222
395 Ga0495644_0028744
396 Ga0495644_0046813
397 Ga0495648_0000411
398 Ga0495648_0001558
399 Ga0495648_0003362
400 Ga0495648_0014326
401 Ga0495648_0030260
402 Ga0495648_0033559
403 Ga0495648_0065158
404 Ga0495648_0075403
405 Ga0495648_0134161
406 Ga0495666_0000729
407 Ga0495642_0000083
408 Ga0495642_0001236
409 Ga0495642_0008970
410 Ga0495642_0009405
411 Ga0495642_0024810
412 Ga0495642_0032461
413 Ga0495642_0042685
414 Ga0495654_0008547
415 Ga0495654_0014688
416 Ga0495665_0076340
417 Ga0495640_0048623
418 Ga0495586_0001925
419 Ga0495609_0000981
420 Ga0495609_0005116
421 Ga0495609_0005840
422 Ga0495609_0006928
423 Ga0495609_0016634
424 Ga0495609_0026501
425 Ga0495609_0074967
426 Ga0495597_0000009
427 Ga0495597_0001070
428 Ga0495597_0004727
429 Ga0495597_0019458
430 Ga0495597_0023546
431 Ga0495633_0001136
432 Ga0495633_0003325
433 Ga0495633_0006341
434 Ga0495633_0051238
435 Ga0495668_0000350
436 Ga0495668_0000353
437 Ga0495668_0001625
438 Ga0495668_0001888
439 Ga0495668_0003163
440 Ga0495668_0006140
441 Ga0495668_0007231
442 Ga0495668_0011948
443 Ga0495668_0016212
444 Ga0495668_0024761
445 Ga0495668_0026107
446 Ga0495668_0031374
447 Ga0495668_0129528
448 Ga0495611_0000311
449 Ga0495611_0000507
450 Ga0495611_0005090
451 Ga0495611_0027117
452 Ga0495611_0029821
453 Ga0495611_0047366
454 Ga0495625_0009979
455 Ga0495625_0019788
456 Ga0495625_0163688
457 Ga0495635_0004629
458 Ga0495661_0002590
459 Ga0495661_0003447
460 Ga0495661_0005386
461 Ga0495661_0005950
462 Ga0495661_0008161
463 Ga0495661_0012794
464 Ga0495661_0013107
465 Ga0495661_0016193
466 Ga0495661_0021700
467 Ga0495661_0083898
468 Ga0495661_0116219
469 Ga0495661_0194452
470 Ga0495588_0002904
471 Ga0495588_0006942
472 Ga0495588_0015343
473 Ga0495588_0018453
474 Ga0495588_0044637
475 Ga0495669_0003163
476 Ga0495669_0003811
477 Ga0495669_0008141
478 Ga0495669_0009716
479 Ga0495669_0038014
480 Ga0495669_0050854
481 Ga0495670_0000319
482 Ga0495670_0003697
483 Ga0495670_0005980
484 Ga0495670_0016228
485 Ga0495670_0184936
486 Ga0495671_0000469
487 Ga0495671_0001768
488 Ga0495671_0002294
489 Ga0495671_0024162
490 Ga0495671_0033891
491 Ga0495671_0087384
492 Ga0495649_0000546
493 Ga0495649_0188309
494 Ga0495589_0000581
495 Ga0495589_0001114
496 Ga0495589_0030105
497 Ga0495589_0120725
498 Ga0495660_0003932
499 Ga0495660_0008642
500 Ga0495660_0009653
501 Ga0495660_0018983
502 Ga0495660_0022705
503 Ga0495660_0042481
504 Ga0495660_0070731
505 Ga0495660_0091119
506 Ga0495660_0140094
507 Ga0495672_0000131
508 Ga0495672_0000290
509 Ga0495672_0014279
510 Ga0495672_0014375
511 Ga0495672_0048652
512 Ga0495676_0001530
513 Ga0495680_0001842
514 Ga0495683_0000160
515 Ga0495683_0000378
516 Ga0495683_0014094
517 Ga0495687_000034
518 Ga0495687_000048
519 Ga0495687_004090
520 Ga0495677_0000085
521 Ga0495677_0000840
522 Ga0495677_0001069
523 Ga0495679_004026
524 Ga0495679_007312
525 Ga0495679_041267
526 Ga0495685_003196
527 Ga0495685_018567
528 Ga0495681_0000018
529 Ga0495681_0001284
530 Ga0495681_0004008
531 Ga0495681_0018437
532 Ga0495681_0023348
533 Ga0495681_0034536
534 Ga0495686_0003618
535 Ga0495686_0030184
536 Ga0495686_0040432
537 Ga0495686_0077706
538 Ga0495593_0014943
539 Ga0495614_0000655
540 Ga0495626_0003258
541 Ga0495626_0005364
542 Ga0495626_0007727
543 Ga0495626_0012397
544 Ga0495626_0012812
545 Ga0495626_0013075
546 Ga0495626_0014166
547 Ga0495626_0019289
548 Ga0495626_0021456
549 Ga0495626_0036437
550 Ga0495626_0046000
551 Ga0496102_0000437
552 Ga0496102_0128056
553 Ga0496103_0025720
554 Ga0496107_0071227
555 Ga0496108_0073911
556 Ga0496109_0443553
557 Ga0496110_0000042
558 Ga0496111_0062903
559 Ga0496115_0066434
560 Ga0495678_000092
561 Ga0495678_000100
562 Ga0495678_000562
563 Ga0495678_000574
564 Ga0495682_0000809
565 Ga0495682_0003016
566 Ga0495682_0005072
567 Ga0495682_0006951
568 Ga0495682_0046034

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07963

N_methyl

Prokaryotic N-terminal methylation motif

7

33

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ixm-assembly1.cif.gz_B the lps transporter lptde from yersinia pestis, core complex 0.7092 285 326
7nw1-assembly1.cif.gz_AAA crystal structure of ufc1 in complex with uba5 0.6981 282 323
3afp-assembly1.cif.gz_A-2 crystal structure of the single-stranded dna binding protein from mycobacterium leprae (form i) 0.6944 285 322
4m5t-assembly3.cif.gz_E disulfide trapped human alphab crystallin core domain in complex with c-terminal peptide 0.6534 285 323
7nvj-assembly1.cif.gz_AAA crystal structure of ufc1 y110a & f121a 0.635 282 323
ID Description Score Start End Superfamily
af_Q99210_13_226_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.8201 294 324 3.90.950.10
3q2wA04 Mainly Beta;Sandwich;Immunoglobulin-like;Cadherins 0.7956 297 326 2.60.40.60
af_E7F9B5_678_780_2.60.40.60 Mainly Beta;Sandwich;Immunoglobulin-like;Cadherins 0.7874 297 323 2.60.40.60
af_A4I9D5_205_471_3.40.850.10 Alpha Beta;3-Layer(aba) Sandwich;Kinesin;Kinesin motor domain 0.7807 295 322 3.40.850.10
af_Q4D315_1583_2097_3.40.850.10 Alpha Beta;3-Layer(aba) Sandwich;Kinesin;Kinesin motor domain 0.7367 295 323 3.40.850.10
ID Description Score Start End GO Terms
AF-R0I7K7-F1-model_v4 Protein DETOXIFICATION (Multidrug and toxic compound extrusion protein) 0.8962 284 326 GO:0015297
GO:0016020
GO:0042910
GO:1990961
AF-A0A086WDI4-F1-model_v4 N-terminal cleavage protein 0.8847 5 326 GO:0016020
AF-A0A086WDI4-F1-model_v4 N-terminal cleavage protein 0.8818 5 326 GO:0016020
AF-A0A0L0F8T4-F1-model_v4 Uncharacterized protein 0.8762 285 326
AF-A0A2K3KK18-F1-model_v4 Uncharacterized protein 0.8655 285 326

Map