F386366
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 284 | 184 | 284 | 256 |
Family's Representative Sequence
| Representative Sequence | 3300046461|Ga0495641_0000004|Ga0495641_0000004_91048_91974 |
| Length | 308 |
| Sequence | LQTLYDDCRHRLATLLREPGRDRAKRTLSRHRSGLEGRIGPATLAKGRGLQLEIVQGAAKNRLGRSPAAFAAGFACVLAALIVAAWPGAADSAPLGVVVLGKTTTTPPASCPGKVVNNVEVVPCRVEGHVSGYQTKAGGVENPYEVPFDGKIVAWSITLAKPSHTDTKTTTNEIGFFNEFLGKPSEARIGVLRPVEESKPPKFTLVRQSPLELLNPYFGSTPIFTLEHPLSVLRGQIVALTVPTWAPMFAFNVSEEDTWRGSRLEDHCASKEDIQGGHPQQGVGKIKTYGCFYSNARLLYTATLVKKP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 29 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 30 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 31 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 32 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 33 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 34 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 35 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 37 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 38 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 39 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 59 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 95 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 96 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 97 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 98 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 99 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 100 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 101 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 102 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 103 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 104 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 105 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 143 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 144 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 145 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 146 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 147 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 148 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 149 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 150 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 152 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 153 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 154 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 155 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 156 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 157 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 158 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 159 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 160 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 161 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 162 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 163 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 164 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 165 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 166 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 183 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 184 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.65 |
| Metatranscriptomes | 0.35 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.06 |
| Nodule | 0 |
| Rhizoplane | 12.32 |
| Rhizosphere | 81.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25404J52841_10016745 | 3300003659 | Bacteria | 1590 |
| 2 | Ga0070658_10106284 | 3300005327 | Bacteria | 2322 |
| 3 | Ga0070683_100007793 | 3300005329 | Bacteria | 9067 |
| 4 | Ga0070683_100034067 | 3300005329 | Bacteria | 4650 |
| 5 | Ga0070683_100410294 | 3300005329 | Bacteria | 1292 |
| 6 | Ga0070677_10000028 | 3300005333 | Bacteria | 43011 |
| 7 | Ga0070680_100251209 | 3300005336 | Bacteria | 1495 |
| 8 | Ga0068868_100000351 | 3300005338 | Bacteria | 31294 |
| 9 | Ga0068868_100022098 | 3300005338 | Bacteria | 4798 |
| 10 | Ga0070689_100207001 | 3300005340 | Unclassified | 1604 |
| 11 | Ga0070691_10000004 | 3300005341 | Bacteria | 80156 |
| 12 | Ga0070661_100000004 | 3300005344 | Bacteria | 243876 |
| 13 | Ga0070668_100006626 | 3300005347 | Bacteria | 8582 |
| 14 | Ga0070668_100248749 | 3300005347 | Bacteria | 1475 |
| 15 | Ga0070675_100000050 | 3300005354 | Bacteria | 72016 |
| 16 | Ga0070673_100031206 | 3300005364 | Bacteria | 3997 |
| 17 | Ga0070688_100000161 | 3300005365 | Bacteria | 35812 |
| 18 | Ga0070667_100001110 | 3300005367 | Bacteria | 24556 |
| 19 | Ga0070667_100007482 | 3300005367 | Bacteria | 9063 |
| 20 | Ga0070667_100110409 | 3300005367 | Bacteria | 2384 |
| 21 | Ga0070714_100203502 | 3300005435 | Unclassified | 1812 |
| 22 | Ga0070713_100000503 | 3300005436 | Bacteria | 24991 |
| 23 | Ga0070713_100323581 | 3300005436 | Bacteria | 1424 |
| 24 | Ga0070711_100019038 | 3300005439 | Bacteria | 4396 |
| 25 | Ga0070700_100165846 | 3300005441 | Unclassified | 1525 |
| 26 | Ga0070663_100005786 | 3300005455 | Bacteria | 7380 |
| 27 | Ga0070663_100317520 | 3300005455 | Bacteria | 1252 |
| 28 | Ga0070663_100602848 | 3300005455 | Bacteria | 924 |
| 29 | Ga0070678_100197345 | 3300005456 | Bacteria | 1658 |
| 30 | Ga0070662_100000001 | 3300005457 | Bacteria | 317995 |
| 31 | Ga0070681_10013258 | 3300005458 | Bacteria | 8190 |
| 32 | Ga0070685_10000010 | 3300005466 | Bacteria | 146946 |
| 33 | Ga0070685_10000061 | 3300005466 | Bacteria | 63408 |
| 34 | Ga0070685_10092378 | 3300005466 | Bacteria | 1834 |
| 35 | Ga0070685_10473992 | 3300005466 | Unclassified | 881 |
| 36 | Ga0070679_100000424 | 3300005530 | Bacteria | 35927 |
| 37 | Ga0070679_100000471 | 3300005530 | Bacteria | 34374 |
| 38 | Ga0070684_100199106 | 3300005535 | Bacteria | 1824 |
| 39 | Ga0070672_100000031 | 3300005543 | Bacteria | 62241 |
| 40 | Ga0070665_100026842 | 3300005548 | Bacteria | 5801 |
| 41 | Ga0068856_100000417 | 3300005614 | Bacteria | 46946 |
| 42 | Ga0068852_100000966 | 3300005616 | Bacteria | 18875 |
| 43 | Ga0068852_100030458 | 3300005616 | Bacteria | 4442 |
| 44 | Ga0068863_100000261 | 3300005841 | Bacteria | 55053 |
| 45 | Ga0068863_100007352 | 3300005841 | Bacteria | 10782 |
| 46 | Ga0068863_100082213 | 3300005841 | Bacteria | 3052 |
| 47 | Ga0068858_100065985 | 3300005842 | Bacteria | 3350 |
| 48 | Ga0068862_100002784 | 3300005844 | Bacteria | 15326 |
| 49 | Ga0081455_10004942 | 3300005937 | Bacteria | 14737 |
| 50 | Ga0081455_10016046 | 3300005937 | Bacteria | 7246 |
| 51 | Ga0081540_1000868 | 3300005983 | Bacteria | 27372 |
| 52 | Ga0070712_100000841 | 3300006175 | Bacteria | 18240 |
| 53 | Ga0068871_100153167 | 3300006358 | Bacteria | 1967 |
| 54 | Ga0075433_10005003 | 3300006852 | Bacteria | 10383 |
| 55 | Ga0068865_100000499 | 3300006881 | Bacteria | 22000 |
| 56 | Ga0105240_10128716 | 3300009093 | Bacteria | 3039 |
| 57 | Ga0105240_10547926 | 3300009093 | Bacteria | 1280 |
| 58 | Ga0105245_10000040 | 3300009098 | Bacteria | 144005 |
| 59 | Ga0105245_10000314 | 3300009098 | Bacteria | 46175 |
| 60 | Ga0105245_10000857 | 3300009098 | Bacteria | 27591 |
| 61 | Ga0105247_10106196 | 3300009101 | Bacteria | 1801 |
| 62 | Ga0105242_10000063 | 3300009176 | Bacteria | 74721 |
| 63 | Ga0105248_10000037 | 3300009177 | Bacteria | 180751 |
| 64 | Ga0105237_10420660 | 3300009545 | Unclassified | 1342 |
| 65 | Ga0105238_10000033 | 3300009551 | Bacteria | 172981 |
| 66 | Ga0105238_10089889 | 3300009551 | Bacteria | 3058 |
| 67 | Ga0105249_10002088 | 3300009553 | Bacteria | 17318 |
| 68 | Ga0105239_10140054 | 3300010375 | Bacteria | 2695 |
| 69 | Ga0105239_10735750 | 3300010375 | Unclassified | 1129 |
| 70 | Ga0105239_10745504 | 3300010375 | Bacteria | 1121 |
| 71 | Ga0157371_10004888 | 3300013102 | Bacteria | 11513 |
| 72 | Ga0157370_10083432 | 3300013104 | Bacteria | 3004 |
| 73 | Ga0157370_10289341 | 3300013104 | Bacteria | 1513 |
| 74 | Ga0157369_10001730 | 3300013105 | Bacteria | 26528 |
| 75 | Ga0157374_10001797 | 3300013296 | Bacteria | 18046 |
| 76 | Ga0157378_10005003 | 3300013297 | Bacteria | 11627 |
| 77 | Ga0157378_10074081 | 3300013297 | Bacteria | 3063 |
| 78 | Ga0163162_10195767 | 3300013306 | Unclassified | 2150 |
| 79 | Ga0163162_11032126 | 3300013306 | Unclassified | 930 |
| 80 | Ga0157375_10003564 | 3300013308 | Bacteria | 13514 |
| 81 | Ga0157375_10373809 | 3300013308 | Unclassified | 1592 |
| 82 | Ga0163163_10169818 | 3300014325 | Bacteria | 2228 |
| 83 | Ga0157380_10000007 | 3300014326 | Bacteria | 157634 |
| 84 | Ga0157380_11059905 | 3300014326 | Archaea | 847 |
| 85 | Ga0157379_10018096 | 3300014968 | Bacteria | 6209 |
| 86 | Ga0157379_10372521 | 3300014968 | Bacteria | 1309 |
| 87 | Ga0206356_11122065 | 3300020070 | Unclassified | 1545 |
| 88 | Ga0207680_10023503 | 3300025903 | Bacteria | 3368 |
| 89 | Ga0207680_10121156 | 3300025903 | Bacteria | 1711 |
| 90 | Ga0207680_10341017 | 3300025903 | Bacteria | 1051 |
| 91 | Ga0207643_10042790 | 3300025908 | Bacteria | 2554 |
| 92 | Ga0207705_10019730 | 3300025909 | Bacteria | 4820 |
| 93 | Ga0207707_10009995 | 3300025912 | Bacteria | 8232 |
| 94 | Ga0207693_10001350 | 3300025915 | Bacteria | 21696 |
| 95 | Ga0207663_10013276 | 3300025916 | Bacteria | 4474 |
| 96 | Ga0207657_10173758 | 3300025919 | Bacteria | 1744 |
| 97 | Ga0207649_10000003 | 3300025920 | Bacteria | 388908 |
| 98 | Ga0207652_10000232 | 3300025921 | Bacteria | 58473 |
| 99 | Ga0207652_10000412 | 3300025921 | Bacteria | 44366 |
| 100 | Ga0207694_10000012 | 3300025924 | Bacteria | 411218 |
| 101 | Ga0207659_10000055 | 3300025926 | Bacteria | 74252 |
| 102 | Ga0207687_10000040 | 3300025927 | Bacteria | 113598 |
| 103 | Ga0207700_10000003 | 3300025928 | Bacteria | 500797 |
| 104 | Ga0207664_10193710 | 3300025929 | Unclassified | 1751 |
| 105 | Ga0207706_10000003 | 3300025933 | Bacteria | 345011 |
| 106 | Ga0207686_10017669 | 3300025934 | Bacteria | 4022 |
| 107 | Ga0207670_10248437 | 3300025936 | Bacteria | 1374 |
| 108 | Ga0207704_10000104 | 3300025938 | Bacteria | 46614 |
| 109 | Ga0207691_10000178 | 3300025940 | Bacteria | 60110 |
| 110 | Ga0207711_10000011 | 3300025941 | Bacteria | 518817 |
| 111 | Ga0207711_10309780 | 3300025941 | Unclassified | 1458 |
| 112 | Ga0207661_10000858 | 3300025944 | Bacteria | 19953 |
| 113 | Ga0207661_10001136 | 3300025944 | Bacteria | 17743 |
| 114 | Ga0207661_10184311 | 3300025944 | Bacteria | 1826 |
| 115 | Ga0207651_10021679 | 3300025960 | Bacteria | 3910 |
| 116 | Ga0207712_10015646 | 3300025961 | Bacteria | 4897 |
| 117 | Ga0207668_10080153 | 3300025972 | Bacteria | 2364 |
| 118 | Ga0207658_10001811 | 3300025986 | Bacteria | 15995 |
| 119 | Ga0207658_10097473 | 3300025986 | Bacteria | 2295 |
| 120 | Ga0207677_10000304 | 3300026023 | Bacteria | 36147 |
| 121 | Ga0207703_10000042 | 3300026035 | Bacteria | 161459 |
| 122 | Ga0207703_10025893 | 3300026035 | Bacteria | 4616 |
| 123 | Ga0207678_10255964 | 3300026067 | Unclassified | 1500 |
| 124 | Ga0207708_10175343 | 3300026075 | Unclassified | 1700 |
| 125 | Ga0207702_10000105 | 3300026078 | Bacteria | 97835 |
| 126 | Ga0207702_10016153 | 3300026078 | Bacteria | 6180 |
| 127 | Ga0207641_10000062 | 3300026088 | Bacteria | 159982 |
| 128 | Ga0207641_10009398 | 3300026088 | Bacteria | 8058 |
| 129 | Ga0207641_10060082 | 3300026088 | Bacteria | 3239 |
| 130 | Ga0207683_10158196 | 3300026121 | Bacteria | 2047 |
| 131 | Ga0207698_10000015 | 3300026142 | Bacteria | 207368 |
| 132 | Ga0268266_10000526 | 3300028379 | Bacteria | 53404 |
| 133 | Ga0268266_10000990 | 3300028379 | Bacteria | 35791 |
| 134 | Ga0268266_10048218 | 3300028379 | Bacteria | 3651 |
| 135 | Ga0268266_10423273 | 3300028379 | Bacteria | 1262 |
| 136 | Ga0268265_10001768 | 3300028380 | Bacteria | 17341 |
| 137 | Ga0265319_1000010 | 3300028563 | Bacteria | 188773 |
| 138 | Ga0265338_10000287 | 3300028800 | Bacteria | 90818 |
| 139 | Ga0265324_10073761 | 3300029957 | Unclassified | 1162 |
| 140 | Ga0265325_10055681 | 3300031241 | Bacteria | 2021 |
| 141 | Ga0451833_0564927 | 3300041491 | Unclassified | 1537 |
| 142 | Ga0451853_0857924 | 3300041512 | Bacteria | 1177 |
| 143 | Ga0439459_0022040 | 3300042438 | Bacteria | 1229 |
| 144 | Ga0466963_0000141 | 3300044694 | Bacteria | 28151 |
| 145 | Ga0466963_0008048 | 3300044694 | Bacteria | 6311 |
| 146 | Ga0466963_0069678 | 3300044694 | Bacteria | 2364 |
| 147 | Ga0466957_0001268 | 3300044842 | Bacteria | 13149 |
| 148 | Ga0466960_0099545 | 3300044901 | Bacteria | 1495 |
| 149 | Ga0466958_0057059 | 3300045836 | Bacteria | 2373 |
| 150 | Ga0495603_0004342 | 3300046455 | Bacteria | 8457 |
| 151 | Ga0495603_0040037 | 3300046455 | Bacteria | 2806 |
| 152 | Ga0495629_0001042 | 3300046459 | Bacteria | 22205 |
| 153 | Ga0495629_0007304 | 3300046459 | Bacteria | 8139 |
| 154 | Ga0495629_0034537 | 3300046459 | Bacteria | 3575 |
| 155 | Ga0495638_0012940 | 3300046460 | Bacteria | 5697 |
| 156 | Ga0495641_0000004 | 3300046461 | Bacteria | 210501 |
| 157 | Ga0495641_0011142 | 3300046461 | Bacteria | 5149 |
| 158 | Ga0495641_0049328 | 3300046461 | Bacteria | 1928 |
| 159 | Ga0495641_0088351 | 3300046461 | Bacteria | 1386 |
| 160 | Ga0495653_0043003 | 3300046463 | Bacteria | 3515 |
| 161 | Ga0495653_0221132 | 3300046463 | Unclassified | 1273 |
| 162 | Ga0495582_0000003 | 3300046473 | Bacteria | 168880 |
| 163 | Ga0495662_0005283 | 3300046476 | Bacteria | 6470 |
| 164 | Ga0495594_0000009 | 3300046499 | Bacteria | 122139 |
| 165 | Ga0495606_0000017 | 3300046507 | Bacteria | 284549 |
| 166 | Ga0495608_0000013 | 3300046511 | Bacteria | 228481 |
| 167 | Ga0495608_0025985 | 3300046511 | Bacteria | 3996 |
| 168 | Ga0495608_0181455 | 3300046511 | Bacteria | 1331 |
| 169 | Ga0495628_0004134 | 3300046516 | Bacteria | 12910 |
| 170 | Ga0495628_0129994 | 3300046516 | Unclassified | 1927 |
| 171 | Ga0495630_0000032 | 3300046517 | Bacteria | 134425 |
| 172 | Ga0495640_0037707 | 3300046533 | Bacteria | 3407 |
| 173 | Ga0495640_0300306 | 3300046533 | Bacteria | 997 |
| 174 | Ga0495586_0000588 | 3300046535 | Bacteria | 21115 |
| 175 | Ga0495587_0017028 | 3300046536 | Bacteria | 4519 |
| 176 | Ga0495587_0131836 | 3300046536 | Bacteria | 1428 |
| 177 | Ga0495645_0160835 | 3300046543 | Bacteria | 1553 |
| 178 | Ga0495622_0000097 | 3300046557 | Bacteria | 76953 |
| 179 | Ga0495667_0144219 | 3300046559 | Bacteria | 1534 |
| 180 | Ga0495634_0043009 | 3300046642 | Bacteria | 3062 |
| 181 | Ga0495625_0000243 | 3300046660 | Bacteria | 85589 |
| 182 | Ga0495635_0000005 | 3300046663 | Bacteria | 302178 |
| 183 | Ga0495657_0000003 | 3300046675 | Bacteria | 279680 |
| 184 | Ga0495657_0193515 | 3300046675 | Unclassified | 1242 |
| 185 | Ga0495599_0006190 | 3300046678 | Bacteria | 7215 |
| 186 | Ga0495647_0000005 | 3300046681 | Bacteria | 125996 |
| 187 | Ga0495647_0000585 | 3300046681 | Bacteria | 10787 |
| 188 | Ga0495658_0000001 | 3300046683 | Bacteria | 385362 |
| 189 | Ga0495658_0000947 | 3300046683 | Bacteria | 15486 |
| 190 | Ga0495669_0023053 | 3300046684 | Unclassified | 2707 |
| 191 | Ga0495613_0001632 | 3300046689 | Bacteria | 17071 |
| 192 | Ga0495613_0245736 | 3300046689 | Bacteria | 1250 |
| 193 | Ga0495613_0348013 | 3300046689 | Bacteria | 1018 |
| 194 | Ga0495624_0000400 | 3300046690 | Bacteria | 34373 |
| 195 | Ga0495649_0007318 | 3300046694 | Bacteria | 6747 |
| 196 | Ga0495604_0011043 | 3300047317 | Bacteria | 7167 |
| 197 | Ga0495674_0000039 | 3300047319 | Bacteria | 97645 |
| 198 | Ga0495676_0000499 | 3300047321 | Bacteria | 32193 |
| 199 | Ga0495676_0009604 | 3300047321 | Bacteria | 8807 |
| 200 | Ga0495676_0027699 | 3300047321 | Bacteria | 4856 |
| 201 | Ga0495676_0319018 | 3300047321 | Bacteria | 1044 |
| 202 | Ga0495680_0001001 | 3300047322 | Bacteria | 31451 |
| 203 | Ga0495680_0007824 | 3300047322 | Bacteria | 9762 |
| 204 | Ga0495680_0014672 | 3300047322 | Bacteria | 6777 |
| 205 | Ga0495680_0157522 | 3300047322 | Unclassified | 1651 |
| 206 | Ga0495675_0000002 | 3300047444 | Bacteria | 216469 |
| 207 | Ga0495686_0204312 | 3300047472 | Bacteria | 1132 |
| 208 | Ga0495602_0004130 | 3300048088 | Bacteria | 15127 |
| 209 | Ga0495614_0115789 | 3300048089 | Bacteria | 1179 |
| 210 | Ga0496100_0000001 | 3300048903 | Bacteria | 530179 |
| 211 | Ga0496100_0000024 | 3300048903 | Bacteria | 116138 |
| 212 | Ga0496101_0000028 | 3300048904 | Bacteria | 198664 |
| 213 | Ga0496101_0000072 | 3300048904 | Bacteria | 116138 |
| 214 | Ga0496102_0000129 | 3300048905 | Bacteria | 104478 |
| 215 | Ga0496103_0000087 | 3300048906 | Bacteria | 104566 |
| 216 | Ga0496103_0019977 | 3300048906 | Bacteria | 4023 |
| 217 | Ga0496104_0000010 | 3300048907 | Bacteria | 475255 |
| 218 | Ga0496105_0000003 | 3300048908 | Bacteria | 713251 |
| 219 | Ga0496105_0000005 | 3300048908 | Bacteria | 475797 |
| 220 | Ga0496105_0000051 | 3300048908 | Bacteria | 90365 |
| 221 | Ga0496106_0000040 | 3300048909 | Bacteria | 108754 |
| 222 | Ga0496106_0000218 | 3300048909 | Bacteria | 40075 |
| 223 | Ga0496107_0000002 | 3300048910 | Bacteria | 320871 |
| 224 | Ga0496107_0000025 | 3300048910 | Bacteria | 116138 |
| 225 | Ga0496107_0339004 | 3300048910 | Bacteria | 1119 |
| 226 | Ga0496108_0000004 | 3300048911 | Bacteria | 545055 |
| 227 | Ga0496108_0091732 | 3300048911 | Bacteria | 2582 |
| 228 | Ga0496109_0000002 | 3300048912 | Bacteria | 443393 |
| 229 | Ga0496109_0000013 | 3300048912 | Bacteria | 227469 |
| 230 | Ga0496109_0000221 | 3300048912 | Bacteria | 56054 |
| 231 | Ga0496109_0183280 | 3300048912 | Bacteria | 1967 |
| 232 | Ga0496109_0429519 | 3300048912 | Bacteria | 1248 |
| 233 | Ga0496110_0000052 | 3300048913 | Bacteria | 58549 |
| 234 | Ga0496110_0324130 | 3300048913 | Archaea | 1403 |
| 235 | Ga0496111_0000209 | 3300048914 | Bacteria | 27572 |
| 236 | Ga0496111_0053225 | 3300048914 | Bacteria | 2924 |
| 237 | Ga0496112_0001298 | 3300048915 | Bacteria | 18986 |
| 238 | Ga0496113_0000005 | 3300048916 | Bacteria | 105956 |
| 239 | Ga0496113_0020317 | 3300048916 | Bacteria | 4667 |
| 240 | Ga0496113_0041537 | 3300048916 | Bacteria | 3394 |
| 241 | Ga0496114_0000003 | 3300048917 | Bacteria | 630981 |
| 242 | Ga0496114_0252513 | 3300048917 | Unclassified | 1552 |
| 243 | Ga0496114_0263236 | 3300048917 | Unclassified | 1519 |
| 244 | Ga0496115_0000827 | 3300048918 | Bacteria | 22678 |
| 245 | Ga0496116_0001008 | 3300048919 | Bacteria | 34374 |
| 246 | Ga0496117_0005005 | 3300048920 | Bacteria | 14213 |
| 247 | Ga0496118_0001859 | 3300048921 | Bacteria | 30197 |
| 248 | Ga0496118_0124550 | 3300048921 | Bacteria | 1671 |
| 249 | Ga0496119_0016268 | 3300048922 | Bacteria | 5671 |
| 250 | Ga0496119_0042709 | 3300048922 | Bacteria | 2872 |
| 251 | Ga0496121_0034660 | 3300048924 | Bacteria | 4540 |
| 252 | Ga0496124_0072100 | 3300048927 | Bacteria | 2861 |
| 253 | Ga0496125_0034478 | 3300048928 | Bacteria | 4461 |
| 254 | Ga0496126_0049280 | 3300048929 | Bacteria | 3846 |
| 255 | Ga0496126_0059005 | 3300048929 | Bacteria | 3457 |
| 256 | Ga0496126_0534768 | 3300048929 | Unclassified | 932 |
| 257 | Ga0501042_0083910 | 3300049578 | Bacteria | 2284 |
| 258 | Ga0501047_0028630 | 3300049581 | Bacteria | 5372 |
| 259 | Ga0501047_0080012 | 3300049581 | Bacteria | 3141 |
| 260 | Ga0501070_0011670 | 3300049586 | Bacteria | 7419 |
| 261 | Ga0501070_0119252 | 3300049586 | Bacteria | 2180 |
| 262 | Ga0501071_0039163 | 3300049587 | Bacteria | 3390 |
| 263 | Ga0501072_0135569 | 3300049588 | Bacteria | 1963 |
| 264 | Ga0501074_0053349 | 3300049590 | Bacteria | 2916 |
| 265 | Ga0501079_0172713 | 3300049741 | Bacteria | 1685 |
| 266 | Ga0501080_0144474 | 3300049742 | Bacteria | 2199 |
| 267 | Ga0501083_0023359 | 3300049744 | Bacteria | 4288 |
| 268 | Ga0501044_0047186 | 3300049823 | Bacteria | 4456 |
| 269 | Ga0501044_0327166 | 3300049823 | Bacteria | 1456 |
| 270 | Ga0501045_0470319 | 3300049824 | Unclassified | 934 |
| 271 | Ga0495601_0011184 | 3300053077 | Bacteria | 5360 |
| 272 | Ga0495601_0021771 | 3300053077 | Bacteria | 3928 |
| 273 | Ga0495601_0369403 | 3300053077 | Bacteria | 932 |
| 274 | Ga0495612_0005622 | 3300053078 | Bacteria | 5180 |
| 275 | Ga0495655_0000910 | 3300053083 | Bacteria | 4599 |
| 276 | Ga0495595_0000007 | 3300053084 | Bacteria | 228504 |
| 277 | Ga0495619_0000001 | 3300053085 | Bacteria | 586054 |
| 278 | Ga0495619_0000026 | 3300053085 | Bacteria | 167387 |
| 279 | Ga0495619_0000506 | 3300053085 | Bacteria | 25971 |
| 280 | Ga0495619_0005677 | 3300053085 | Bacteria | 7913 |
| 281 | Ga0495619_0009392 | 3300053085 | Bacteria | 6171 |
| 282 | Ga0500566_0016672 | 3300053094 | Bacteria | 4311 |
| 283 | Ga0500641_0020522 | 3300053096 | Bacteria | 2509 |
| 284 | Ga0500614_000156 | 3300053123 | Bacteria | 17306 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053085 | Ga0495619_0009392 | Ga0495619_0009392_3609_4418 | 233 |
| 2 | 3300046473 | Ga0495582_0000003 | Ga0495582_0000003_16218_17048 | 234 |
| 3 | 3300046683 | Ga0495658_0000001 | Ga0495658_0000001_155363_156193 | 234 |
| 4 | 3300013104 | Ga0157370_10083432 | Ga0157370_100834323 | 236 |
| 5 | 3300010375 | Ga0105239_10735750 | Ga0105239_107357501 | 239 |
| 6 | 3300046678 | Ga0495599_0006190 | Ga0495599_0006190_1246_2025 | 242 |
| 7 | 3300046536 | Ga0495587_0131836 | Ga0495587_0131836_483_1292 | 243 |
| 8 | 3300009098 | Ga0105245_10000857 | Ga0105245_100008576 | 245 |
| 9 | 3300044694 | Ga0466963_0000141 | Ga0466963_0000141_124_906 | 245 |
| 10 | 3300005336 | Ga0070680_100251209 | Ga0070680_1002512092 | 246 |
| 11 | 3300005458 | Ga0070681_10013258 | Ga0070681_100132583 | 246 |
| 12 | 3300005530 | Ga0070679_100000424 | Ga0070679_1000004243 | 246 |
| 13 | 3300009093 | Ga0105240_10547926 | Ga0105240_105479262 | 246 |
| 14 | 3300013104 | Ga0157370_10289341 | Ga0157370_102893412 | 246 |
| 15 | 3300025912 | Ga0207707_10009995 | Ga0207707_100099957 | 246 |
| 16 | 3300025921 | Ga0207652_10000232 | Ga0207652_1000023221 | 246 |
| 17 | 3300041512 | Ga0451853_0857924 | Ga0451853_0857924_26_805 | 246 |
| 18 | 3300046694 | Ga0495649_0007318 | Ga0495649_0007318_4592_5371 | 246 |
| 19 | 3300006881 | Ga0068865_100000499 | Ga0068865_10000049919 | 249 |
| 20 | 3300025938 | Ga0207704_10000104 | Ga0207704_100001047 | 249 |
| 21 | 3300005616 | Ga0068852_100030458 | Ga0068852_1000304585 | 251 |
| 22 | 3300046461 | Ga0495641_0088351 | Ga0495641_0088351_565_1338 | 251 |
| 23 | 3300048916 | Ga0496113_0041537 | Ga0496113_0041537_240_1004 | 251 |
| 24 | 3300005329 | Ga0070683_100007793 | Ga0070683_1000077938 | 252 |
| 25 | 3300005338 | Ga0068868_100000351 | Ga0068868_10000035127 | 252 |
| 26 | 3300005354 | Ga0070675_100000050 | Ga0070675_10000005048 | 252 |
| 27 | 3300005367 | Ga0070667_100007482 | Ga0070667_1000074829 | 252 |
| 28 | 3300005455 | Ga0070663_100005786 | Ga0070663_1000057867 | 252 |
| 29 | 3300005457 | Ga0070662_100000001 | Ga0070662_10000000196 | 252 |
| 30 | 3300005530 | Ga0070679_100000471 | Ga0070679_1000004712 | 252 |
| 31 | 3300005937 | Ga0081455_10016046 | Ga0081455_100160466 | 252 |
| 32 | 3300009093 | Ga0105240_10128716 | Ga0105240_101287163 | 252 |
| 33 | 3300009101 | Ga0105247_10106196 | Ga0105247_101061963 | 252 |
| 34 | 3300009545 | Ga0105237_10420660 | Ga0105237_104206601 | 252 |
| 35 | 3300009551 | Ga0105238_10089889 | Ga0105238_100898892 | 252 |
| 36 | 3300010375 | Ga0105239_10140054 | Ga0105239_101400542 | 252 |
| 37 | 3300013297 | Ga0157378_10005003 | Ga0157378_100050033 | 252 |
| 38 | 3300014325 | Ga0163163_10169818 | Ga0163163_101698182 | 252 |
| 39 | 3300020070 | Ga0206356_11122065 | Ga0206356_111220651 | 252 |
| 40 | 3300025903 | Ga0207680_10121156 | Ga0207680_101211563 | 252 |
| 41 | 3300025903 | Ga0207680_10341017 | Ga0207680_103410171 | 252 |
| 42 | 3300025921 | Ga0207652_10000412 | Ga0207652_1000041243 | 252 |
| 43 | 3300025926 | Ga0207659_10000055 | Ga0207659_1000005550 | 252 |
| 44 | 3300025933 | Ga0207706_10000003 | Ga0207706_10000003232 | 252 |
| 45 | 3300025941 | Ga0207711_10309780 | Ga0207711_103097803 | 252 |
| 46 | 3300025944 | Ga0207661_10000858 | Ga0207661_1000085817 | 252 |
| 47 | 3300025986 | Ga0207658_10097473 | Ga0207658_100974732 | 252 |
| 48 | 3300026023 | Ga0207677_10000304 | Ga0207677_1000030434 | 252 |
| 49 | 3300026067 | Ga0207678_10255964 | Ga0207678_102559641 | 252 |
| 50 | 3300028379 | Ga0268266_10000990 | Ga0268266_1000099010 | 252 |
| 51 | 3300028379 | Ga0268266_10048218 | Ga0268266_100482184 | 252 |
| 52 | 3300042438 | Ga0439459_0022040 | Ga0439459_0022040_85_852 | 252 |
| 53 | 3300046507 | Ga0495606_0000017 | Ga0495606_0000017_45920_46678 | 252 |
| 54 | 3300046660 | Ga0495625_0000243 | Ga0495625_0000243_65058_65816 | 252 |
| 55 | 3300047472 | Ga0495686_0204312 | Ga0495686_0204312_49_831 | 252 |
| 56 | 3300048917 | Ga0496114_0252513 | Ga0496114_0252513_206_1003 | 252 |
| 57 | 3300048919 | Ga0496116_0001008 | Ga0496116_0001008_10359_11138 | 252 |
| 58 | 3300048920 | Ga0496117_0005005 | Ga0496117_0005005_13349_14113 | 252 |
| 59 | 3300048921 | Ga0496118_0001859 | Ga0496118_0001859_12576_13340 | 252 |
| 60 | 3300048921 | Ga0496118_0124550 | Ga0496118_0124550_58_840 | 252 |
| 61 | 3300048922 | Ga0496119_0042709 | Ga0496119_0042709_1066_1842 | 252 |
| 62 | 3300048924 | Ga0496121_0034660 | Ga0496121_0034660_2569_3345 | 252 |
| 63 | 3300048927 | Ga0496124_0072100 | Ga0496124_0072100_1435_2217 | 252 |
| 64 | 3300048928 | Ga0496125_0034478 | Ga0496125_0034478_3192_3950 | 252 |
| 65 | 3300048929 | Ga0496126_0049280 | Ga0496126_0049280_1011_1793 | 252 |
| 66 | 3300048929 | Ga0496126_0059005 | Ga0496126_0059005_1194_2000 | 252 |
| 67 | 3300048929 | Ga0496126_0534768 | Ga0496126_0534768_103_885 | 252 |
| 68 | 3300049581 | Ga0501047_0028630 | Ga0501047_0028630_1011_1781 | 252 |
| 69 | 3300049581 | Ga0501047_0080012 | Ga0501047_0080012_1501_2271 | 252 |
| 70 | 3300049586 | Ga0501070_0011670 | Ga0501070_0011670_4344_5108 | 252 |
| 71 | 3300049586 | Ga0501070_0119252 | Ga0501070_0119252_718_1488 | 252 |
| 72 | 3300049587 | Ga0501071_0039163 | Ga0501071_0039163_1307_2077 | 252 |
| 73 | 3300049590 | Ga0501074_0053349 | Ga0501074_0053349_568_1338 | 252 |
| 74 | 3300049741 | Ga0501079_0172713 | Ga0501079_0172713_797_1567 | 252 |
| 75 | 3300049742 | Ga0501080_0144474 | Ga0501080_0144474_1368_2138 | 252 |
| 76 | 3300049744 | Ga0501083_0023359 | Ga0501083_0023359_2840_3607 | 252 |
| 77 | 3300049823 | Ga0501044_0047186 | Ga0501044_0047186_1169_1939 | 252 |
| 78 | 3300049823 | Ga0501044_0327166 | Ga0501044_0327166_300_1085 | 252 |
| 79 | 3300005327 | Ga0070658_10106284 | Ga0070658_101062844 | 253 |
| 80 | 3300005329 | Ga0070683_100034067 | Ga0070683_1000340673 | 253 |
| 81 | 3300005329 | Ga0070683_100410294 | Ga0070683_1004102941 | 253 |
| 82 | 3300005333 | Ga0070677_10000028 | Ga0070677_1000002846 | 253 |
| 83 | 3300005338 | Ga0068868_100022098 | Ga0068868_1000220984 | 253 |
| 84 | 3300005341 | Ga0070691_10000004 | Ga0070691_1000000434 | 253 |
| 85 | 3300005344 | Ga0070661_100000004 | Ga0070661_100000004245 | 253 |
| 86 | 3300005347 | Ga0070668_100006626 | Ga0070668_1000066263 | 253 |
| 87 | 3300005347 | Ga0070668_100248749 | Ga0070668_1002487492 | 253 |
| 88 | 3300005364 | Ga0070673_100031206 | Ga0070673_1000312067 | 253 |
| 89 | 3300005367 | Ga0070667_100001110 | Ga0070667_10000111010 | 253 |
| 90 | 3300005367 | Ga0070667_100110409 | Ga0070667_1001104093 | 253 |
| 91 | 3300005435 | Ga0070714_100203502 | Ga0070714_1002035022 | 253 |
| 92 | 3300005436 | Ga0070713_100000503 | Ga0070713_10000050324 | 253 |
| 93 | 3300005439 | Ga0070711_100019038 | Ga0070711_1000190384 | 253 |
| 94 | 3300005441 | Ga0070700_100165846 | Ga0070700_1001658462 | 253 |
| 95 | 3300005455 | Ga0070663_100317520 | Ga0070663_1003175201 | 253 |
| 96 | 3300005455 | Ga0070663_100602848 | Ga0070663_1006028481 | 253 |
| 97 | 3300005456 | Ga0070678_100197345 | Ga0070678_1001973453 | 253 |
| 98 | 3300005466 | Ga0070685_10000010 | Ga0070685_10000010126 | 253 |
| 99 | 3300005535 | Ga0070684_100199106 | Ga0070684_1001991061 | 253 |
| 100 | 3300005543 | Ga0070672_100000031 | Ga0070672_10000003173 | 253 |
| 101 | 3300005548 | Ga0070665_100026842 | Ga0070665_1000268425 | 253 |
| 102 | 3300005841 | Ga0068863_100000261 | Ga0068863_10000026128 | 253 |
| 103 | 3300005841 | Ga0068863_100007352 | Ga0068863_1000073524 | 253 |
| 104 | 3300005844 | Ga0068862_100002784 | Ga0068862_10000278410 | 253 |
| 105 | 3300005937 | Ga0081455_10004942 | Ga0081455_1000494216 | 253 |
| 106 | 3300006175 | Ga0070712_100000841 | Ga0070712_1000008419 | 253 |
| 107 | 3300006852 | Ga0075433_10005003 | Ga0075433_100050037 | 253 |
| 108 | 3300009098 | Ga0105245_10000040 | Ga0105245_1000004026 | 253 |
| 109 | 3300009176 | Ga0105242_10000063 | Ga0105242_1000006335 | 253 |
| 110 | 3300009551 | Ga0105238_10000033 | Ga0105238_10000033139 | 253 |
| 111 | 3300009553 | Ga0105249_10002088 | Ga0105249_100020883 | 253 |
| 112 | 3300013102 | Ga0157371_10004888 | Ga0157371_1000488815 | 253 |
| 113 | 3300013296 | Ga0157374_10001797 | Ga0157374_100017975 | 253 |
| 114 | 3300013297 | Ga0157378_10074081 | Ga0157378_100740811 | 253 |
| 115 | 3300013306 | Ga0163162_10195767 | Ga0163162_101957671 | 253 |
| 116 | 3300013306 | Ga0163162_11032126 | Ga0163162_110321262 | 253 |
| 117 | 3300013308 | Ga0157375_10373809 | Ga0157375_103738092 | 253 |
| 118 | 3300014326 | Ga0157380_10000007 | Ga0157380_1000000721 | 253 |
| 119 | 3300014326 | Ga0157380_11059905 | Ga0157380_110599051 | 253 |
| 120 | 3300014968 | Ga0157379_10018096 | Ga0157379_100180965 | 253 |
| 121 | 3300025903 | Ga0207680_10023503 | Ga0207680_100235033 | 253 |
| 122 | 3300025908 | Ga0207643_10042790 | Ga0207643_100427903 | 253 |
| 123 | 3300025909 | Ga0207705_10019730 | Ga0207705_100197306 | 253 |
| 124 | 3300025915 | Ga0207693_10001350 | Ga0207693_1000135017 | 253 |
| 125 | 3300025916 | Ga0207663_10013276 | Ga0207663_100132764 | 253 |
| 126 | 3300025919 | Ga0207657_10173758 | Ga0207657_101737583 | 253 |
| 127 | 3300025920 | Ga0207649_10000003 | Ga0207649_1000000314 | 253 |
| 128 | 3300025924 | Ga0207694_10000012 | Ga0207694_10000012140 | 253 |
| 129 | 3300025928 | Ga0207700_10000003 | Ga0207700_10000003166 | 253 |
| 130 | 3300025929 | Ga0207664_10193710 | Ga0207664_101937102 | 253 |
| 131 | 3300025934 | Ga0207686_10017669 | Ga0207686_100176693 | 253 |
| 132 | 3300025940 | Ga0207691_10000178 | Ga0207691_1000017812 | 253 |
| 133 | 3300025944 | Ga0207661_10001136 | Ga0207661_1000113614 | 253 |
| 134 | 3300025944 | Ga0207661_10184311 | Ga0207661_101843113 | 253 |
| 135 | 3300025960 | Ga0207651_10021679 | Ga0207651_100216792 | 253 |
| 136 | 3300025961 | Ga0207712_10015646 | Ga0207712_100156464 | 253 |
| 137 | 3300025972 | Ga0207668_10080153 | Ga0207668_100801533 | 253 |
| 138 | 3300025986 | Ga0207658_10001811 | Ga0207658_1000181118 | 253 |
| 139 | 3300026035 | Ga0207703_10000042 | Ga0207703_1000004227 | 253 |
| 140 | 3300026075 | Ga0207708_10175343 | Ga0207708_101753433 | 253 |
| 141 | 3300026088 | Ga0207641_10000062 | Ga0207641_10000062146 | 253 |
| 142 | 3300026088 | Ga0207641_10009398 | Ga0207641_100093986 | 253 |
| 143 | 3300026121 | Ga0207683_10158196 | Ga0207683_101581963 | 253 |
| 144 | 3300028379 | Ga0268266_10000526 | Ga0268266_1000052646 | 253 |
| 145 | 3300028380 | Ga0268265_10001768 | Ga0268265_1000176815 | 253 |
| 146 | 3300028563 | Ga0265319_1000010 | Ga0265319_100001059 | 253 |
| 147 | 3300028800 | Ga0265338_10000287 | Ga0265338_1000028750 | 253 |
| 148 | 3300029957 | Ga0265324_10073761 | Ga0265324_100737611 | 253 |
| 149 | 3300031241 | Ga0265325_10055681 | Ga0265325_100556813 | 253 |
| 150 | 3300041491 | Ga0451833_0564927 | Ga0451833_0564927_186_947 | 253 |
| 151 | 3300044842 | Ga0466957_0001268 | Ga0466957_0001268_10201_10962 | 253 |
| 152 | 3300044901 | Ga0466960_0099545 | Ga0466960_0099545_272_1036 | 253 |
| 153 | 3300046455 | Ga0495603_0004342 | Ga0495603_0004342_7241_8017 | 253 |
| 154 | 3300046455 | Ga0495603_0040037 | Ga0495603_0040037_1497_2276 | 253 |
| 155 | 3300046459 | Ga0495629_0001042 | Ga0495629_0001042_66_827 | 253 |
| 156 | 3300046460 | Ga0495638_0012940 | Ga0495638_0012940_725_1486 | 253 |
| 157 | 3300046461 | Ga0495641_0000004 | Ga0495641_0000004_91048_91974 | 253 |
| 158 | 3300046461 | Ga0495641_0011142 | Ga0495641_0011142_4225_4986 | 253 |
| 159 | 3300046461 | Ga0495641_0049328 | Ga0495641_0049328_255_1016 | 253 |
| 160 | 3300046463 | Ga0495653_0043003 | Ga0495653_0043003_96_857 | 253 |
| 161 | 3300046463 | Ga0495653_0221132 | Ga0495653_0221132_187_966 | 253 |
| 162 | 3300046476 | Ga0495662_0005283 | Ga0495662_0005283_5589_6350 | 253 |
| 163 | 3300046499 | Ga0495594_0000009 | Ga0495594_0000009_24421_25182 | 253 |
| 164 | 3300046511 | Ga0495608_0025985 | Ga0495608_0025985_412_1191 | 253 |
| 165 | 3300046511 | Ga0495608_0181455 | Ga0495608_0181455_112_891 | 253 |
| 166 | 3300046516 | Ga0495628_0129994 | Ga0495628_0129994_424_1188 | 253 |
| 167 | 3300046517 | Ga0495630_0000032 | Ga0495630_0000032_64058_64819 | 253 |
| 168 | 3300046533 | Ga0495640_0037707 | Ga0495640_0037707_249_1028 | 253 |
| 169 | 3300046535 | Ga0495586_0000588 | Ga0495586_0000588_93_902 | 253 |
| 170 | 3300046536 | Ga0495587_0017028 | Ga0495587_0017028_669_1430 | 253 |
| 171 | 3300046543 | Ga0495645_0160835 | Ga0495645_0160835_73_852 | 253 |
| 172 | 3300046557 | Ga0495622_0000097 | Ga0495622_0000097_75737_76498 | 253 |
| 173 | 3300046559 | Ga0495667_0144219 | Ga0495667_0144219_519_1283 | 253 |
| 174 | 3300046642 | Ga0495634_0043009 | Ga0495634_0043009_556_1320 | 253 |
| 175 | 3300046663 | Ga0495635_0000005 | Ga0495635_0000005_14394_15173 | 253 |
| 176 | 3300046675 | Ga0495657_0193515 | Ga0495657_0193515_345_1124 | 253 |
| 177 | 3300046681 | Ga0495647_0000005 | Ga0495647_0000005_83191_84000 | 253 |
| 178 | 3300046681 | Ga0495647_0000585 | Ga0495647_0000585_6230_6991 | 253 |
| 179 | 3300046684 | Ga0495669_0023053 | Ga0495669_0023053_1281_2045 | 253 |
| 180 | 3300046689 | Ga0495613_0001632 | Ga0495613_0001632_5748_6527 | 253 |
| 181 | 3300046689 | Ga0495613_0245736 | Ga0495613_0245736_55_819 | 253 |
| 182 | 3300046690 | Ga0495624_0000400 | Ga0495624_0000400_32612_33373 | 253 |
| 183 | 3300047321 | Ga0495676_0000499 | Ga0495676_0000499_1652_2431 | 253 |
| 184 | 3300047321 | Ga0495676_0027699 | Ga0495676_0027699_1930_2691 | 253 |
| 185 | 3300047321 | Ga0495676_0319018 | Ga0495676_0319018_252_1013 | 253 |
| 186 | 3300047322 | Ga0495680_0001001 | Ga0495680_0001001_7203_7970 | 253 |
| 187 | 3300047322 | Ga0495680_0007824 | Ga0495680_0007824_8222_9001 | 253 |
| 188 | 3300047322 | Ga0495680_0157522 | Ga0495680_0157522_268_1047 | 253 |
| 189 | 3300048089 | Ga0495614_0115789 | Ga0495614_0115789_322_1101 | 253 |
| 190 | 3300048903 | Ga0496100_0000024 | Ga0496100_0000024_90171_90935 | 253 |
| 191 | 3300048904 | Ga0496101_0000072 | Ga0496101_0000072_25204_25968 | 253 |
| 192 | 3300048905 | Ga0496102_0000129 | Ga0496102_0000129_103703_104464 | 253 |
| 193 | 3300048906 | Ga0496103_0000087 | Ga0496103_0000087_103701_104462 | 253 |
| 194 | 3300048908 | Ga0496105_0000003 | Ga0496105_0000003_136537_137301 | 253 |
| 195 | 3300048908 | Ga0496105_0000051 | Ga0496105_0000051_52164_52925 | 253 |
| 196 | 3300048909 | Ga0496106_0000040 | Ga0496106_0000040_82787_83551 | 253 |
| 197 | 3300048910 | Ga0496107_0000025 | Ga0496107_0000025_90171_90935 | 253 |
| 198 | 3300048910 | Ga0496107_0339004 | Ga0496107_0339004_66_920 | 253 |
| 199 | 3300048911 | Ga0496108_0000004 | Ga0496108_0000004_458225_458989 | 253 |
| 200 | 3300048911 | Ga0496108_0091732 | Ga0496108_0091732_1452_2213 | 253 |
| 201 | 3300048912 | Ga0496109_0000002 | Ga0496109_0000002_91548_92309 | 253 |
| 202 | 3300048912 | Ga0496109_0000013 | Ga0496109_0000013_140666_141430 | 253 |
| 203 | 3300048912 | Ga0496109_0000221 | Ga0496109_0000221_36770_37531 | 253 |
| 204 | 3300048912 | Ga0496109_0183280 | Ga0496109_0183280_1123_1887 | 253 |
| 205 | 3300048912 | Ga0496109_0429519 | Ga0496109_0429519_68_832 | 253 |
| 206 | 3300048913 | Ga0496110_0324130 | Ga0496110_0324130_123_902 | 253 |
| 207 | 3300048914 | Ga0496111_0053225 | Ga0496111_0053225_1048_1809 | 253 |
| 208 | 3300048916 | Ga0496113_0020317 | Ga0496113_0020317_2514_3278 | 253 |
| 209 | 3300048917 | Ga0496114_0263236 | Ga0496114_0263236_464_1225 | 253 |
| 210 | 3300049588 | Ga0501072_0135569 | Ga0501072_0135569_189_959 | 253 |
| 211 | 3300049824 | Ga0501045_0470319 | Ga0501045_0470319_92_856 | 253 |
| 212 | 3300053077 | Ga0495601_0011184 | Ga0495601_0011184_359_1138 | 253 |
| 213 | 3300053077 | Ga0495601_0021771 | Ga0495601_0021771_1642_2451 | 253 |
| 214 | 3300053077 | Ga0495601_0369403 | Ga0495601_0369403_97_876 | 253 |
| 215 | 3300053078 | Ga0495612_0005622 | Ga0495612_0005622_3358_4119 | 253 |
| 216 | 3300053083 | Ga0495655_0000910 | Ga0495655_0000910_1544_2305 | 253 |
| 217 | 3300053085 | Ga0495619_0000001 | Ga0495619_0000001_430713_431492 | 253 |
| 218 | 3300053085 | Ga0495619_0000506 | Ga0495619_0000506_1802_2581 | 253 |
| 219 | 3300053085 | Ga0495619_0005677 | Ga0495619_0005677_3384_4163 | 253 |
| 220 | 3300053096 | Ga0500641_0020522 | Ga0500641_0020522_120_881 | 253 |
| 221 | 3300053123 | Ga0500614_000156 | Ga0500614_000156_85_1011 | 253 |
| 222 | 3300003659 | JGI25404J52841_10016745 | JGI25404J52841_100167452 | 254 |
| 223 | 3300005340 | Ga0070689_100207001 | Ga0070689_1002070012 | 254 |
| 224 | 3300005365 | Ga0070688_100000161 | Ga0070688_10000016135 | 254 |
| 225 | 3300005436 | Ga0070713_100323581 | Ga0070713_1003235812 | 254 |
| 226 | 3300005466 | Ga0070685_10000061 | Ga0070685_1000006164 | 254 |
| 227 | 3300005466 | Ga0070685_10092378 | Ga0070685_100923783 | 254 |
| 228 | 3300005466 | Ga0070685_10473992 | Ga0070685_104739921 | 254 |
| 229 | 3300005614 | Ga0068856_100000417 | Ga0068856_10000041740 | 254 |
| 230 | 3300005616 | Ga0068852_100000966 | Ga0068852_10000096611 | 254 |
| 231 | 3300005841 | Ga0068863_100082213 | Ga0068863_1000822132 | 254 |
| 232 | 3300005842 | Ga0068858_100065985 | Ga0068858_1000659854 | 254 |
| 233 | 3300005983 | Ga0081540_1000868 | Ga0081540_10008684 | 254 |
| 234 | 3300006358 | Ga0068871_100153167 | Ga0068871_1001531672 | 254 |
| 235 | 3300009098 | Ga0105245_10000314 | Ga0105245_100003145 | 254 |
| 236 | 3300009177 | Ga0105248_10000037 | Ga0105248_10000037168 | 254 |
| 237 | 3300010375 | Ga0105239_10745504 | Ga0105239_107455041 | 254 |
| 238 | 3300013105 | Ga0157369_10001730 | Ga0157369_1000173012 | 254 |
| 239 | 3300013308 | Ga0157375_10003564 | Ga0157375_100035643 | 254 |
| 240 | 3300014968 | Ga0157379_10372521 | Ga0157379_103725211 | 254 |
| 241 | 3300025927 | Ga0207687_10000040 | Ga0207687_100000405 | 254 |
| 242 | 3300025936 | Ga0207670_10248437 | Ga0207670_102484372 | 254 |
| 243 | 3300025941 | Ga0207711_10000011 | Ga0207711_10000011375 | 254 |
| 244 | 3300026035 | Ga0207703_10025893 | Ga0207703_100258933 | 254 |
| 245 | 3300026078 | Ga0207702_10000105 | Ga0207702_1000010581 | 254 |
| 246 | 3300026078 | Ga0207702_10016153 | Ga0207702_100161535 | 254 |
| 247 | 3300026088 | Ga0207641_10060082 | Ga0207641_100600822 | 254 |
| 248 | 3300026142 | Ga0207698_10000015 | Ga0207698_10000015113 | 254 |
| 249 | 3300028379 | Ga0268266_10423273 | Ga0268266_104232732 | 254 |
| 250 | 3300044694 | Ga0466963_0008048 | Ga0466963_0008048_1725_2492 | 254 |
| 251 | 3300044694 | Ga0466963_0069678 | Ga0466963_0069678_930_1694 | 254 |
| 252 | 3300045836 | Ga0466958_0057059 | Ga0466958_0057059_548_1324 | 254 |
| 253 | 3300046459 | Ga0495629_0007304 | Ga0495629_0007304_350_1114 | 254 |
| 254 | 3300046459 | Ga0495629_0034537 | Ga0495629_0034537_430_1194 | 254 |
| 255 | 3300046511 | Ga0495608_0000013 | Ga0495608_0000013_103838_104602 | 254 |
| 256 | 3300046516 | Ga0495628_0004134 | Ga0495628_0004134_8650_9414 | 254 |
| 257 | 3300046533 | Ga0495640_0300306 | Ga0495640_0300306_33_797 | 254 |
| 258 | 3300046675 | Ga0495657_0000003 | Ga0495657_0000003_155037_155801 | 254 |
| 259 | 3300046683 | Ga0495658_0000947 | Ga0495658_0000947_8568_9332 | 254 |
| 260 | 3300046689 | Ga0495613_0348013 | Ga0495613_0348013_227_991 | 254 |
| 261 | 3300047317 | Ga0495604_0011043 | Ga0495604_0011043_5630_6394 | 254 |
| 262 | 3300047319 | Ga0495674_0000039 | Ga0495674_0000039_75005_75769 | 254 |
| 263 | 3300047321 | Ga0495676_0009604 | Ga0495676_0009604_286_1050 | 254 |
| 264 | 3300047322 | Ga0495680_0014672 | Ga0495680_0014672_656_1420 | 254 |
| 265 | 3300047444 | Ga0495675_0000002 | Ga0495675_0000002_155037_155801 | 254 |
| 266 | 3300048088 | Ga0495602_0004130 | Ga0495602_0004130_14305_15069 | 254 |
| 267 | 3300048903 | Ga0496100_0000001 | Ga0496100_0000001_69661_70425 | 254 |
| 268 | 3300048904 | Ga0496101_0000028 | Ga0496101_0000028_69650_70414 | 254 |
| 269 | 3300048906 | Ga0496103_0019977 | Ga0496103_0019977_160_924 | 254 |
| 270 | 3300048907 | Ga0496104_0000010 | Ga0496104_0000010_229445_230209 | 254 |
| 271 | 3300048908 | Ga0496105_0000005 | Ga0496105_0000005_229445_230209 | 254 |
| 272 | 3300048909 | Ga0496106_0000218 | Ga0496106_0000218_2664_3428 | 254 |
| 273 | 3300048910 | Ga0496107_0000002 | Ga0496107_0000002_178063_178827 | 254 |
| 274 | 3300048913 | Ga0496110_0000052 | Ga0496110_0000052_30559_31323 | 254 |
| 275 | 3300048914 | Ga0496111_0000209 | Ga0496111_0000209_6580_7344 | 254 |
| 276 | 3300048915 | Ga0496112_0001298 | Ga0496112_0001298_13639_14403 | 254 |
| 277 | 3300048916 | Ga0496113_0000005 | Ga0496113_0000005_99664_100428 | 254 |
| 278 | 3300048917 | Ga0496114_0000003 | Ga0496114_0000003_479358_480122 | 254 |
| 279 | 3300048918 | Ga0496115_0000827 | Ga0496115_0000827_16448_17212 | 254 |
| 280 | 3300048922 | Ga0496119_0016268 | Ga0496119_0016268_755_1519 | 254 |
| 281 | 3300049578 | Ga0501042_0083910 | Ga0501042_0083910_441_1205 | 254 |
| 282 | 3300053084 | Ga0495595_0000007 | Ga0495595_0000007_103861_104625 | 254 |
| 283 | 3300053085 | Ga0495619_0000026 | Ga0495619_0000026_67939_68703 | 254 |
| 284 | 3300053094 | Ga0500566_0016672 | Ga0500566_0016672_1164_1928 | 254 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5wja-assembly1.cif.gz_A | crystal structure of h107a peptidylglycine alpha-hydroxylating monooxygenase (phm) in complex with citrate | 0.5758 | 90 | 186 |
| 7m22-assembly1.cif.gz_N | cryo-em structure of the hcmv pentamer bound by human neuropilin 2 | 0.5732 | 91 | 186 |
| 3mll-assembly1.cif.gz_A | reduced (cu+) peptidylglycine alpha-hydroxylating monooxygenase (phm) with bound azide | 0.5712 | 90 | 186 |
| 6amp-assembly1.cif.gz_A | crystal structure of h172a phm (cuh absent, cum present) | 0.5508 | 90 | 186 |
| 4e4z-assembly1.cif.gz_A | oxidized (cu2+) peptidylglycine alpha-hydroxylating monooxygenase (phm) in complex with hydrogen peroxide (1.98 a) | 0.5403 | 90 | 186 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A6NHM9_346_491_2.60.120.230 | Mainly Beta;Sandwich;Jelly Rolls; | 0.6177 | 95 | 186 | 2.60.120.230 |
| af_Q9XTQ6_414_569_2.60.120.230 | Mainly Beta;Sandwich;Jelly Rolls; | 0.6093 | 90 | 186 | 2.60.120.230 |
| af_Q965Y9_1049_1206_2.60.120.820 | Mainly Beta;Sandwich;Jelly Rolls;PHR domain | 0.6017 | 90 | 186 | 2.60.120.820 |
| af_P09172_367_524_2.60.120.230 | Mainly Beta;Sandwich;Jelly Rolls; | 0.5834 | 90 | 186 | 2.60.120.230 |
| af_P83388_171_319_2.60.120.230 | Mainly Beta;Sandwich;Jelly Rolls; | 0.539 | 90 | 186 | 2.60.120.230 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X8XEF6-F1-model_v4 | Uncharacterized protein | 0.8115 | 91 | 186 |
|
| AF-A0A1M3BF56-F1-model_v4 | Uncharacterized protein | 0.7918 | 33 | 254 |
|
| AF-A0A7W0RDC9-F1-model_v4 | DUF4384 domain-containing protein | 0.7835 | 36 | 254 |
|
| AF-A0A7V9GUX4-F1-model_v4 | DUF4384 domain-containing protein | 0.7821 | 36 | 254 |
|
| AF-A0A7W1RS13-F1-model_v4 | Uncharacterized protein | 0.7792 | 36 | 252 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar