F385987

General Info

Members Datasets Scaffolds Average Seq Length
284 146 568 264

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10192385|Ga0065715_101923851
Length 293
Sequence VSGFSRTWRVPEVAGLRFARMRSLIFWAVLVAIGVAVWVLSSSLYQPVVPAVTFPGGALVDLSHAYGSETIFWPTAAGGFMLHKDADGVTPAGYYYSANSFSTAEHGGTHIDAPVHFAQGHQSVDQIPLERFFGHAVVVDVRQQSEGSADYQVTVNDLAHAEAEQGAMTSDSIVLLRTGFSSRWPDAARYLGTAERGEAAVPKLHFPGLHPDAAKWLVAKGVRAVGIDTASIDYGQSTLFESHRILYAADLPAFENLTSLERLPLRGAFIVALPMKIAHGTGAPLRAVAILPK

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
102 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
103 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
104 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
105 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
106 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
107 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
108 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
124 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
127 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
128 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
129 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
130 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
131 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
132 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
133 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
134 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
137 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
138 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
142 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
143 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
144 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
145 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
146 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.76
Nodule 0
Rhizoplane 1.76
Rhizosphere 96.48
Stem 0
Stem Tuber 0
Unclassified 23.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10192385 3300005293 Unclassified 1407
2 Ga0065712_10239593 3300005290 Bacteria 988
3 Ga0065715_10001764 3300005293 Bacteria 6393
4 Ga0070676_10136300 3300005328 Bacteria 1558
5 Ga0070690_100083230 3300005330 Unclassified 2096
6 Ga0070670_100004671 3300005331 Bacteria 11491
7 Ga0070670_100033687 3300005331 Unclassified 4411
8 Ga0070670_100058023 3300005331 Bacteria 3323
9 Ga0070670_100059102 3300005331 Bacteria 3291
10 Ga0070677_10029656 3300005333 Unclassified 2077
11 Ga0070677_10075661 3300005333 Unclassified 1427
12 Ga0068869_100066778 3300005334 Unclassified 2651
13 Ga0068869_100365376 3300005334 Bacteria 1179
14 Ga0070689_100149765 3300005340 Bacteria 1881
15 Ga0070691_10016791 3300005341 Bacteria 3366
16 Ga0070687_100156844 3300005343 Bacteria 1342
17 Ga0070668_100074988 3300005347 Bacteria 2640
18 Ga0070668_100353155 3300005347 Unclassified 1245
19 Ga0070669_100006815 3300005353 Bacteria 8220
20 Ga0070669_100082723 3300005353 Unclassified 2393
21 Ga0070669_100145499 3300005353 Unclassified 1831
22 Ga0070675_100095604 3300005354 Bacteria 2495
23 Ga0070675_100119725 3300005354 Bacteria 2236
24 Ga0070671_100170462 3300005355 Bacteria 1841
25 Ga0070671_100372417 3300005355 Bacteria 1220
26 Ga0070674_100380739 3300005356 Bacteria 1148
27 Ga0070673_100005508 3300005364 Bacteria 8109
28 Ga0070673_100142704 3300005364 Bacteria 2022
29 Ga0070673_100669076 3300005364 Unclassified 951
30 Ga0070688_100019047 3300005365 Unclassified 3973
31 Ga0070688_100032558 3300005365 Unclassified 3145
32 Ga0070688_100134073 3300005365 Bacteria 1674
33 Ga0070701_10071242 3300005438 Bacteria 1859
34 Ga0070701_10112909 3300005438 Bacteria 1521
35 Ga0070700_100024165 3300005441 Unclassified 3564
36 Ga0070662_100065605 3300005457 Bacteria 2661
37 Ga0068867_100011660 3300005459 Bacteria 6207
38 Ga0070685_10048679 3300005466 Bacteria 2442
39 Ga0070707_100244013 3300005468 Unclassified 1748
40 Ga0070698_100271658 3300005471 Bacteria 1627
41 Ga0070672_100009130 3300005543 Bacteria 6822
42 Ga0070672_100012280 3300005543 Bacteria 6005
43 Ga0070686_100084663 3300005544 Bacteria 2107
44 Ga0070696_100030188 3300005546 Bacteria 3710
45 Ga0070704_100011473 3300005549 Bacteria 5431
46 Ga0070704_100069544 3300005549 Unclassified 2551
47 Ga0070664_100088248 3300005564 Unclassified 2682
48 Ga0070664_100416498 3300005564 Unclassified 1230
49 Ga0068857_100263614 3300005577 Unclassified 1582
50 Ga0068854_100072631 3300005578 Bacteria 2519
51 Ga0070702_100260498 3300005615 Unclassified 1180
52 Ga0068859_100088365 3300005617 Unclassified 3148
53 Ga0068859_100156234 3300005617 Bacteria 2358
54 Ga0068859_100195480 3300005617 Unclassified 2107
55 Ga0068864_100033067 3300005618 Bacteria 4395
56 Ga0068864_100128436 3300005618 Unclassified 2274
57 Ga0068864_100168413 3300005618 Bacteria 1996
58 Ga0068861_100029182 3300005719 Bacteria 4033
59 Ga0068861_100035100 3300005719 Bacteria 3713
60 Ga0068870_10002189 3300005840 Bacteria 8097
61 Ga0068870_10033446 3300005840 Unclassified 2624
62 Ga0068862_100034215 3300005844 Bacteria 4298
63 Ga0068862_100108519 3300005844 Bacteria 2434
64 Ga0068862_100131962 3300005844 Bacteria 2210
65 Ga0068862_100243306 3300005844 Unclassified 1637
66 Ga0068862_100797719 3300005844 Bacteria 922
67 Ga0075364_10053453 3300006051 Bacteria 2640
68 Ga0075367_10193802 3300006178 Unclassified 1268
69 Ga0075366_10185849 3300006195 Bacteria 1263
70 Ga0097621_100209648 3300006237 Bacteria 1695
71 Ga0075428_100001464 3300006844 Bacteria 25254
72 Ga0075428_100040656 3300006844 Bacteria 5113
73 Ga0075428_100046182 3300006844 Bacteria 4785
74 Ga0075428_100109975 3300006844 Unclassified 3002
75 Ga0075430_100040224 3300006846 Bacteria 3958
76 Ga0075430_100180693 3300006846 Bacteria 1755
77 Ga0075431_100033694 3300006847 Bacteria 5278
78 Ga0075431_100037756 3300006847 Bacteria 4973
79 Ga0075433_10007679 3300006852 Bacteria 8565
80 Ga0075433_10136473 3300006852 Bacteria 2181
81 Ga0075433_10197811 3300006852 Bacteria 1787
82 Ga0075433_10331265 3300006852 Unclassified 1346
83 Ga0075434_100026598 3300006871 Bacteria 5670
84 Ga0075429_100031310 3300006880 Bacteria 4623
85 Ga0068865_100335161 3300006881 Bacteria 1221
86 Ga0075436_100001685 3300006914 Bacteria 15101
87 Ga0097620_100088368 3300006931 Unclassified 3148
88 Ga0097620_100156233 3300006931 Bacteria 2358
89 Ga0097620_100195483 3300006931 Unclassified 2107
90 Ga0075435_100011692 3300007076 Bacteria 6471
91 Ga0111539_10006346 3300009094 Bacteria 15248
92 Ga0111539_10020362 3300009094 Bacteria 8170
93 Ga0111539_10021173 3300009094 Bacteria 8008
94 Ga0111539_10038929 3300009094 Bacteria 5734
95 Ga0111539_10068645 3300009094 Bacteria 4185
96 Ga0111539_10263379 3300009094 Bacteria 2007
97 Ga0111539_10338525 3300009094 Unclassified 1751
98 Ga0111539_10470791 3300009094 Bacteria 1463
99 Ga0111539_10607683 3300009094 Bacteria 1273
100 Ga0111539_10764874 3300009094 Bacteria 1124
101 Ga0114129_10002628 3300009147 Bacteria 25000
102 Ga0114129_10003829 3300009147 Bacteria 21200
103 Ga0114129_10032765 3300009147 Bacteria 7343
104 Ga0114129_10089039 3300009147 Bacteria 4279
105 Ga0114129_10093075 3300009147 Bacteria 4176
106 Ga0114129_10271005 3300009147 Unclassified 2271
107 Ga0114129_10377896 3300009147 Bacteria 1872
108 Ga0105248_10146786 3300009177 Bacteria 2662
109 Ga0105246_10354892 3300011119 Bacteria 1203
110 Ga0157374_10217894 3300013296 Bacteria 1872
111 Ga0163162_10145993 3300013306 Bacteria 2482
112 Ga0163162_10396261 3300013306 Bacteria 1513
113 Ga0157375_10762318 3300013308 Bacteria 1118
114 Ga0157375_10850602 3300013308 Unclassified 1059
115 Ga0157380_10006002 3300014326 Bacteria 8503
116 Ga0157380_10075075 3300014326 Bacteria 2746
117 Ga0157380_10078616 3300014326 Unclassified 2692
118 Ga0157380_10280029 3300014326 Unclassified 1525
119 Ga0157379_10136442 3300014968 Bacteria 2210
120 Ga0207682_10019851 3300025893 Unclassified 2634
121 Ga0207642_10222457 3300025899 Bacteria 1056
122 Ga0207688_10056169 3300025901 Bacteria 2211
123 Ga0207688_10143090 3300025901 Unclassified 1408
124 Ga0207645_10043667 3300025907 Unclassified 2869
125 Ga0207645_10073669 3300025907 Unclassified 2186
126 Ga0207643_10000586 3300025908 Bacteria 23097
127 Ga0207643_10003076 3300025908 Bacteria 8967
128 Ga0207662_10147844 3300025918 Unclassified 1492
129 Ga0207649_10039377 3300025920 Bacteria 2866
130 Ga0207649_10058764 3300025920 Unclassified 2410
131 Ga0207646_10370429 3300025922 Unclassified 1294
132 Ga0207681_10024121 3300025923 Bacteria 3900
133 Ga0207681_10059657 3300025923 Bacteria 2616
134 Ga0207650_10003768 3300025925 Bacteria 10370
135 Ga0207650_10042661 3300025925 Bacteria 3328
136 Ga0207650_10043500 3300025925 Bacteria 3297
137 Ga0207650_10148127 3300025925 Unclassified 1850
138 Ga0207659_10122586 3300025926 Unclassified 1994
139 Ga0207659_10145065 3300025926 Bacteria 1847
140 Ga0207644_10088476 3300025931 Unclassified 2304
141 Ga0207644_10134631 3300025931 Bacteria 1896
142 Ga0207690_10164663 3300025932 Bacteria 1656
143 Ga0207706_10091657 3300025933 Unclassified 2672
144 Ga0207706_10257479 3300025933 Unclassified 1524
145 Ga0207706_10710109 3300025933 Bacteria 858
146 Ga0207709_10504415 3300025935 Bacteria 945
147 Ga0207669_10021100 3300025937 Bacteria 3431
148 Ga0207691_10004177 3300025940 Bacteria 14030
149 Ga0207691_10006977 3300025940 Bacteria 10899
150 Ga0207691_10048539 3300025940 Unclassified 3892
151 Ga0207691_10249816 3300025940 Bacteria 1531
152 Ga0207711_10110631 3300025941 Bacteria 2443
153 Ga0207689_10318854 3300025942 Bacteria 1290
154 Ga0207689_10399101 3300025942 Unclassified 1146
155 Ga0207679_10018474 3300025945 Bacteria 4671
156 Ga0207679_10191227 3300025945 Bacteria 1702
157 Ga0207679_10259753 3300025945 Unclassified 1481
158 Ga0207651_10117674 3300025960 Unclassified 2008
159 Ga0207651_10481731 3300025960 Bacteria 1069
160 Ga0207668_10110978 3300025972 Bacteria 2058
161 Ga0207668_10146749 3300025972 Bacteria 1821
162 Ga0207658_10098118 3300025986 Unclassified 2289
163 Ga0207658_10297088 3300025986 Bacteria 1390
164 Ga0207678_10207154 3300026067 Bacteria 1677
165 Ga0207708_10056235 3300026075 Unclassified 3001
166 Ga0207708_10070547 3300026075 Unclassified 2675
167 Ga0207641_10050607 3300026088 Bacteria 3515
168 Ga0207648_10017352 3300026089 Bacteria 6554
169 Ga0207648_10137453 3300026089 Bacteria 2153
170 Ga0207648_10399151 3300026089 Bacteria 1246
171 Ga0207674_10042857 3300026116 Bacteria 4670
172 Ga0207674_10122677 3300026116 Unclassified 2564
173 Ga0207674_10474343 3300026116 Unclassified 1209
174 Ga0207675_100000848 3300026118 Bacteria 30423
175 Ga0207675_100045881 3300026118 Unclassified 4082
176 Ga0207675_100047834 3300026118 Bacteria 3993
177 Ga0207675_100048356 3300026118 Bacteria 3970
178 Ga0207683_10034828 3300026121 Bacteria 4378
179 Ga0207683_10048306 3300026121 Unclassified 3726
180 Ga0207683_10284506 3300026121 Bacteria 1511
181 Ga0207428_10004539 3300027907 Bacteria 13165
182 Ga0207428_10006512 3300027907 Bacteria 10776
183 Ga0207428_10027325 3300027907 Bacteria 4751
184 Ga0207428_10034881 3300027907 Bacteria 4117
185 Ga0268266_10172797 3300028379 Bacteria 1962
186 Ga0268266_10437533 3300028379 Bacteria 1242
187 Ga0268265_10263362 3300028380 Unclassified 1534
188 Ga0307408_100271594 3300031548 Bacteria 1408
189 Ga0307405_10013158 3300031731 Bacteria 4406
190 Ga0307405_10132041 3300031731 Bacteria 1727
191 Ga0307413_10096177 3300031824 Unclassified 1943
192 Ga0307407_10085154 3300031903 Unclassified 1922
193 Ga0307412_10006827 3300031911 Bacteria 6477
194 Ga0307412_10011168 3300031911 Bacteria 5196
195 Ga0307409_100128094 3300031995 Unclassified 2163
196 Ga0307409_100486845 3300031995 Bacteria 1198
197 Ga0307416_100447941 3300032002 Unclassified 1343
198 Ga0450920_003183 3300042122 Bacteria 2836
199 Ga0450894_008834 3300042131 Bacteria 1305
200 Ga0439446_0033817 3300042156 Bacteria 1486
201 Ga0450908_000940 3300042184 Bacteria 5613
202 Ga0495638_0027498 3300046460 Bacteria 3681
203 Ga0495643_0001343 3300046522 Bacteria 23190
204 Ga0495656_0197866 3300046615 Bacteria 996
205 Ga0496107_0130411 3300048910 Bacteria 1856
206 Ga0496109_0157560 3300048912 Bacteria 2127
207 Ga0496110_0271231 3300048913 Bacteria 1545
208 Ga0496112_0043229 3300048915 Bacteria 4411
209 Ga0496112_0671852 3300048915 Bacteria 965
210 Ga0501031_0075842 3300049568 Bacteria 2189
211 Ga0501033_0057690 3300049570 Bacteria 2869
212 Ga0501033_0210405 3300049570 Bacteria 1387
213 Ga0501036_0006124 3300049572 Bacteria 9761
214 Ga0501036_0092456 3300049572 Bacteria 2555
215 Ga0501038_0036000 3300049574 Bacteria 4344
216 Ga0501038_0098871 3300049574 Bacteria 2433
217 Ga0501039_0014008 3300049575 Bacteria 6135
218 Ga0501039_0031176 3300049575 Bacteria 4110
219 Ga0501039_0095461 3300049575 Bacteria 2318
220 Ga0501039_0635245 3300049575 Bacteria 836
221 Ga0501040_0004268 3300049576 Bacteria 9303
222 Ga0501040_0143694 3300049576 Bacteria 1681
223 Ga0501041_0001811 3300049577 Bacteria 11981
224 Ga0501041_0037002 3300049577 Bacteria 2957
225 Ga0501042_0004509 3300049578 Bacteria 8888
226 Ga0501042_0012774 3300049578 Bacteria 5700
227 Ga0501042_0337312 3300049578 Bacteria 1090
228 Ga0501042_0490365 3300049578 Bacteria 892
229 Ga0501043_0315215 3300049579 Bacteria 1193
230 Ga0501046_0003447 3300049580 Bacteria 14512
231 Ga0501048_0332561 3300049582 Bacteria 1082
232 Ga0501068_0015315 3300049584 Bacteria 4401
233 Ga0501071_0005231 3300049587 Bacteria 8317
234 Ga0501071_0220653 3300049587 Bacteria 1427
235 Ga0501072_0044784 3300049588 Bacteria 3479
236 Ga0501072_0146231 3300049588 Bacteria 1884
237 Ga0501074_0310077 3300049590 Bacteria 1121
238 Ga0501074_0358041 3300049590 Bacteria 1035
239 Ga0501075_0001704 3300049591 Bacteria 14453
240 Ga0501076_0002285 3300049592 Bacteria 13113
241 Ga0501076_0101265 3300049592 Bacteria 2322
242 Ga0501077_0217423 3300049593 Bacteria 1214
243 Ga0501077_0267565 3300049593 Bacteria 1087
244 Ga0501079_0000844 3300049741 Bacteria 20890
245 Ga0501079_0028014 3300049741 Bacteria 4322
246 Ga0501079_0474762 3300049741 Bacteria 983
247 Ga0501080_0095468 3300049742 Bacteria 2761
248 Ga0501081_0236800 3300049743 Bacteria 1331
249 Ga0501045_0036494 3300049824 Bacteria 3569
250 Ga0501045_0054221 3300049824 Bacteria 2931
251 nmdc:mga00v17_377635_c1 3300050491 Bacteria 921
252 nmdc:mga05p37_1902_c1 3300050507 Bacteria 24340
253 nmdc:mga05p37_34163_c1 3300050507 Bacteria 6228
254 nmdc:mga05p37_375232_c1 3300050507 Bacteria 1668
255 nmdc:mga05p37_68601_c2 3300050507 Bacteria 2357
256 nmdc:mga05p37_94043_c1 3300050507 Bacteria 3693
257 nmdc:mga05p37_97316_c1 3300050507 Bacteria 3625
258 nmdc:mga09592_16615_c1 3300050508 Bacteria 6022
259 nmdc:mga09592_53479_c1 3300050508 Bacteria 3409
260 nmdc:mga0qj67_10191_c1 3300050509 Bacteria 7017
261 nmdc:mga0qj67_71148_c1 3300050509 Unclassified 2776
262 nmdc:mga0qj67_84621_c1 3300050509 Bacteria 2543
263 nmdc:mga06r32_350774_c1 3300050510 Bacteria 1460
264 nmdc:mga06r32_3880_c1 3300050510 Bacteria 13389
265 nmdc:mga08y16_126828_c1 3300050511 Bacteria 2654
266 nmdc:mga08y16_183_c1 3300050511 Bacteria 55505
267 nmdc:mga08y16_185862_c1 3300050511 Bacteria 2157
268 nmdc:mga08y16_524580_c1 3300050511 Bacteria 1201
269 nmdc:mga08y16_54161_c1 3300050511 Bacteria 4192
270 nmdc:mga08y16_8275_c1 3300050511 Bacteria 10887
271 nmdc:mga08y16_836029_c1 3300050511 Unclassified 911
272 nmdc:mga08y16_9511_c1 3300050511 Bacteria 10201
273 nmdc:mga0n895_73465_c1 3300050512 Unclassified 3395
274 nmdc:mga0rr50_64453_c1 3300050513 Unclassified 2772
275 nmdc:mga0a205_101242_c1 3300050515 Bacteria 2780
276 nmdc:mga0a205_229622_c1 3300050515 Bacteria 1739
277 nmdc:mga0a205_83743_c1 3300050515 Bacteria 3080
278 Ga0500568_0002642 3300053139 Bacteria 10406
279 Ga0501084_0023657 3300054114 Bacteria 5123
280 Ga0501084_0136953 3300054114 Bacteria 2061
281 Ga0501082_0587354 3300060353 Bacteria 974
282 Ga0530510_0002721 3300061734 Bacteria 12172
283 Ga0530510_0012672 3300061734 Bacteria 5927
284 Ga0530510_0120857 3300061734 Bacteria 1923
285 Ga0065715_10192385
286 Ga0065712_10239593
287 Ga0065715_10001764
288 Ga0070676_10136300
289 Ga0070690_100083230
290 Ga0070670_100004671
291 Ga0070670_100033687
292 Ga0070670_100058023
293 Ga0070670_100059102
294 Ga0070677_10029656
295 Ga0070677_10075661
296 Ga0068869_100066778
297 Ga0068869_100365376
298 Ga0070689_100149765
299 Ga0070691_10016791
300 Ga0070687_100156844
301 Ga0070668_100074988
302 Ga0070668_100353155
303 Ga0070669_100006815
304 Ga0070669_100082723
305 Ga0070669_100145499
306 Ga0070675_100095604
307 Ga0070675_100119725
308 Ga0070671_100170462
309 Ga0070671_100372417
310 Ga0070674_100380739
311 Ga0070673_100005508
312 Ga0070673_100142704
313 Ga0070673_100669076
314 Ga0070688_100019047
315 Ga0070688_100032558
316 Ga0070688_100134073
317 Ga0070701_10071242
318 Ga0070701_10112909
319 Ga0070700_100024165
320 Ga0070662_100065605
321 Ga0068867_100011660
322 Ga0070685_10048679
323 Ga0070707_100244013
324 Ga0070698_100271658
325 Ga0070672_100009130
326 Ga0070672_100012280
327 Ga0070686_100084663
328 Ga0070696_100030188
329 Ga0070704_100011473
330 Ga0070704_100069544
331 Ga0070664_100088248
332 Ga0070664_100416498
333 Ga0068857_100263614
334 Ga0068854_100072631
335 Ga0070702_100260498
336 Ga0068859_100088365
337 Ga0068859_100156234
338 Ga0068859_100195480
339 Ga0068864_100033067
340 Ga0068864_100128436
341 Ga0068864_100168413
342 Ga0068861_100029182
343 Ga0068861_100035100
344 Ga0068870_10002189
345 Ga0068870_10033446
346 Ga0068862_100034215
347 Ga0068862_100108519
348 Ga0068862_100131962
349 Ga0068862_100243306
350 Ga0068862_100797719
351 Ga0075364_10053453
352 Ga0075367_10193802
353 Ga0075366_10185849
354 Ga0097621_100209648
355 Ga0075428_100001464
356 Ga0075428_100040656
357 Ga0075428_100046182
358 Ga0075428_100109975
359 Ga0075430_100040224
360 Ga0075430_100180693
361 Ga0075431_100033694
362 Ga0075431_100037756
363 Ga0075433_10007679
364 Ga0075433_10136473
365 Ga0075433_10197811
366 Ga0075433_10331265
367 Ga0075434_100026598
368 Ga0075429_100031310
369 Ga0068865_100335161
370 Ga0075436_100001685
371 Ga0097620_100088368
372 Ga0097620_100156233
373 Ga0097620_100195483
374 Ga0075435_100011692
375 Ga0111539_10006346
376 Ga0111539_10020362
377 Ga0111539_10021173
378 Ga0111539_10038929
379 Ga0111539_10068645
380 Ga0111539_10263379
381 Ga0111539_10338525
382 Ga0111539_10470791
383 Ga0111539_10607683
384 Ga0111539_10764874
385 Ga0114129_10002628
386 Ga0114129_10003829
387 Ga0114129_10032765
388 Ga0114129_10089039
389 Ga0114129_10093075
390 Ga0114129_10271005
391 Ga0114129_10377896
392 Ga0105248_10146786
393 Ga0105246_10354892
394 Ga0157374_10217894
395 Ga0163162_10145993
396 Ga0163162_10396261
397 Ga0157375_10762318
398 Ga0157375_10850602
399 Ga0157380_10006002
400 Ga0157380_10075075
401 Ga0157380_10078616
402 Ga0157380_10280029
403 Ga0157379_10136442
404 Ga0207682_10019851
405 Ga0207642_10222457
406 Ga0207688_10056169
407 Ga0207688_10143090
408 Ga0207645_10043667
409 Ga0207645_10073669
410 Ga0207643_10000586
411 Ga0207643_10003076
412 Ga0207662_10147844
413 Ga0207649_10039377
414 Ga0207649_10058764
415 Ga0207646_10370429
416 Ga0207681_10024121
417 Ga0207681_10059657
418 Ga0207650_10003768
419 Ga0207650_10042661
420 Ga0207650_10043500
421 Ga0207650_10148127
422 Ga0207659_10122586
423 Ga0207659_10145065
424 Ga0207644_10088476
425 Ga0207644_10134631
426 Ga0207690_10164663
427 Ga0207706_10091657
428 Ga0207706_10257479
429 Ga0207706_10710109
430 Ga0207709_10504415
431 Ga0207669_10021100
432 Ga0207691_10004177
433 Ga0207691_10006977
434 Ga0207691_10048539
435 Ga0207691_10249816
436 Ga0207711_10110631
437 Ga0207689_10318854
438 Ga0207689_10399101
439 Ga0207679_10018474
440 Ga0207679_10191227
441 Ga0207679_10259753
442 Ga0207651_10117674
443 Ga0207651_10481731
444 Ga0207668_10110978
445 Ga0207668_10146749
446 Ga0207658_10098118
447 Ga0207658_10297088
448 Ga0207678_10207154
449 Ga0207708_10056235
450 Ga0207708_10070547
451 Ga0207641_10050607
452 Ga0207648_10017352
453 Ga0207648_10137453
454 Ga0207648_10399151
455 Ga0207674_10042857
456 Ga0207674_10122677
457 Ga0207674_10474343
458 Ga0207675_100000848
459 Ga0207675_100045881
460 Ga0207675_100047834
461 Ga0207675_100048356
462 Ga0207683_10034828
463 Ga0207683_10048306
464 Ga0207683_10284506
465 Ga0207428_10004539
466 Ga0207428_10006512
467 Ga0207428_10027325
468 Ga0207428_10034881
469 Ga0268266_10172797
470 Ga0268266_10437533
471 Ga0268265_10263362
472 Ga0307408_100271594
473 Ga0307405_10013158
474 Ga0307405_10132041
475 Ga0307413_10096177
476 Ga0307407_10085154
477 Ga0307412_10006827
478 Ga0307412_10011168
479 Ga0307409_100128094
480 Ga0307409_100486845
481 Ga0307416_100447941
482 Ga0450920_003183
483 Ga0450894_008834
484 Ga0439446_0033817
485 Ga0450908_000940
486 Ga0495638_0027498
487 Ga0495643_0001343
488 Ga0495656_0197866
489 Ga0496107_0130411
490 Ga0496109_0157560
491 Ga0496110_0271231
492 Ga0496112_0043229
493 Ga0496112_0671852
494 Ga0501031_0075842
495 Ga0501033_0057690
496 Ga0501033_0210405
497 Ga0501036_0006124
498 Ga0501036_0092456
499 Ga0501038_0036000
500 Ga0501038_0098871
501 Ga0501039_0014008
502 Ga0501039_0031176
503 Ga0501039_0095461
504 Ga0501039_0635245
505 Ga0501040_0004268
506 Ga0501040_0143694
507 Ga0501041_0001811
508 Ga0501041_0037002
509 Ga0501042_0004509
510 Ga0501042_0012774
511 Ga0501042_0337312
512 Ga0501042_0490365
513 Ga0501043_0315215
514 Ga0501046_0003447
515 Ga0501048_0332561
516 Ga0501068_0015315
517 Ga0501071_0005231
518 Ga0501071_0220653
519 Ga0501072_0044784
520 Ga0501072_0146231
521 Ga0501074_0310077
522 Ga0501074_0358041
523 Ga0501075_0001704
524 Ga0501076_0002285
525 Ga0501076_0101265
526 Ga0501077_0217423
527 Ga0501077_0267565
528 Ga0501079_0000844
529 Ga0501079_0028014
530 Ga0501079_0474762
531 Ga0501080_0095468
532 Ga0501081_0236800
533 Ga0501045_0036494
534 Ga0501045_0054221
535 nmdc:mga00v17_377635_c1
536 nmdc:mga05p37_1902_c1
537 nmdc:mga05p37_34163_c1
538 nmdc:mga05p37_375232_c1
539 nmdc:mga05p37_68601_c2
540 nmdc:mga05p37_94043_c1
541 nmdc:mga05p37_97316_c1
542 nmdc:mga09592_16615_c1
543 nmdc:mga09592_53479_c1
544 nmdc:mga0qj67_10191_c1
545 nmdc:mga0qj67_71148_c1
546 nmdc:mga0qj67_84621_c1
547 nmdc:mga06r32_350774_c1
548 nmdc:mga06r32_3880_c1
549 nmdc:mga08y16_126828_c1
550 nmdc:mga08y16_183_c1
551 nmdc:mga08y16_185862_c1
552 nmdc:mga08y16_524580_c1
553 nmdc:mga08y16_54161_c1
554 nmdc:mga08y16_8275_c1
555 nmdc:mga08y16_836029_c1
556 nmdc:mga08y16_9511_c1
557 nmdc:mga0n895_73465_c1
558 nmdc:mga0rr50_64453_c1
559 nmdc:mga0a205_101242_c1
560 nmdc:mga0a205_229622_c1
561 nmdc:mga0a205_83743_c1
562 Ga0500568_0002642
563 Ga0501084_0023657
564 Ga0501084_0136953
565 Ga0501082_0587354
566 Ga0530510_0002721
567 Ga0530510_0012672
568 Ga0530510_0120857

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04199

Cyclase

Putative cyclase

60

234

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
8f9x-assembly2.cif.gz_D cyclase-phosphotriesterase from ruegeria pomeroyi dss-3 0.907 15 211
5nnb-assembly2.cif.gz_D isatin hydrolase a (iha) from labrenzia aggregata with isatinate bound 0.8538 15 211
4co9-assembly2.cif.gz_A crystal structure of kynurenine formamidase from bacillus anthracis 0.8493 28 213
4cob-assembly1.cif.gz_B crystal structure kynurenine formamidase from pseudomonas aeruginosa 0.8489 28 214
5nmp-assembly3.cif.gz_F isatin hydrolase a (iha) from ralstonia solanacearum 0.8314 9 211
ID Description Score Start End Superfamily
af_Q2G123_4_245_3.50.30.50 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.8745 14 210 3.50.30.50
4co9B00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.8587 28 211 3.50.30.50
4cobB00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.8489 28 214 3.50.30.50
5nmpC00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.8331 9 211 3.50.30.50
3krvB00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.8295 19 209 3.50.30.50
ID Description Score Start End GO Terms
AF-A0A1Q7B2G1-F1-model_v4 Cyclase 0.9863 67 212 GO:0004061
GO:0019441
AF-A0A842PZ16-F1-model_v4 deleted 0.9857 53 213
AF-A0A351KRJ8-F1-model_v4 Cyclase 0.985 64 214 GO:0004061
GO:0019441
AF-A0A6P4ZDM9-F1-model_v4 Uncharacterized protein LOC109475693 0.9831 28 211 GO:0004061
GO:0019441
AF-A0A2V8CGG3-F1-model_v4 Cyclase 0.9801 96 214 GO:0004061
GO:0019441

Map