F385754

General Info

Members Datasets Scaffolds Average Seq Length
283 112 558 193

Family's Representative Sequence

Representative Sequence 3300044706|Ga0466964_0055342|Ga0466964_0055342_899_1594
Length 231
Sequence MTVRAEMPTVTTPFIWSRDSFSDLELISGLQMEKENKAMKFKAYVVMLIVSLLCAASWAGDIEGKVSGMKGKSVVYVDAVAGKTFPAPKDHPLMDQKGLMFSPHILAVQQGTTVEFLNSDTVQHNVFWTAVSGDKKAGHNLGTWPKGEKRSFTFDKPGVVPVLCNVHPEMAGYVIVSPTPYFAETDDSGSYKIKDVPDGSYTVTVWHEGAKNQSKPVTVAGSGKADFTLNK

Samples

Sample ID Description Type Environment
1 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
2 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
17 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
18 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
19 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
20 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
27 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
30 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
31 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
32 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
47 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
48 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
49 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
50 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
51 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
52 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
53 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
54 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
55 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
56 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
57 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
58 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
59 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
60 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
61 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
62 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
63 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
64 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
65 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
66 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
67 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
68 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
69 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
70 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
71 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
72 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
73 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
74 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
75 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
76 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
77 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
78 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
79 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
80 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
81 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
82 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
83 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
84 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
87 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
88 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
89 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
90 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
91 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
94 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
95 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
96 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
97 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
98 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
99 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
100 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
101 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
102 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
103 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
104 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
105 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
106 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
107 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
108 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
109 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
110 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
111 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
112 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.06
Rhizosphere 98.59
Stem 0
Stem Tuber 0
Unclassified 28.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466964_0055342 3300044706 Bacteria 1638
2 Ga0070709_10081782 3300005434 Bacteria 2109
3 Ga0070709_10229336 3300005434 Unclassified 1328
4 Ga0070709_10431238 3300005434 Bacteria 990
5 Ga0070714_100000089 3300005435 Bacteria 77114
6 Ga0070714_100003004 3300005435 Bacteria 12510
7 Ga0070714_100112082 3300005435 Unclassified 2417
8 Ga0070714_100204803 3300005435 Bacteria 1806
9 Ga0070714_100273021 3300005435 Unclassified 1568
10 Ga0070714_100407514 3300005435 Bacteria 1286
11 Ga0070713_100000832 3300005436 Bacteria 19710
12 Ga0070713_100003932 3300005436 Bacteria 9866
13 Ga0070713_100009118 3300005436 Bacteria 7077
14 Ga0070713_100011047 3300005436 Bacteria 6556
15 Ga0070713_100054311 3300005436 Bacteria 3323
16 Ga0070713_100076851 3300005436 Bacteria 2837
17 Ga0070713_100088373 3300005436 Bacteria 2659
18 Ga0070713_100254825 3300005436 Unclassified 1602
19 Ga0070713_100479459 3300005436 Bacteria 1171
20 Ga0070713_100851385 3300005436 Unclassified 875
21 Ga0070710_10023995 3300005437 Bacteria 3212
22 Ga0070710_10026133 3300005437 Bacteria 3098
23 Ga0070710_10044389 3300005437 Bacteria 2466
24 Ga0070710_10444902 3300005437 Bacteria 877
25 Ga0070711_100007847 3300005439 Bacteria 6506
26 Ga0070711_100011182 3300005439 Bacteria 5566
27 Ga0070711_100015801 3300005439 Bacteria 4781
28 Ga0070711_100062062 3300005439 Unclassified 2604
29 Ga0070711_100116641 3300005439 Unclassified 1968
30 Ga0070711_100119848 3300005439 Bacteria 1944
31 Ga0070711_100130301 3300005439 Bacteria 1872
32 Ga0070708_100005394 3300005445 Bacteria 10144
33 Ga0070708_100037518 3300005445 Bacteria 4229
34 Ga0070708_100204256 3300005445 Bacteria 1850
35 Ga0070708_100484674 3300005445 Bacteria 1166
36 Ga0070708_100745488 3300005445 Bacteria 921
37 Ga0070706_100035048 3300005467 Bacteria 4634
38 Ga0070706_100041068 3300005467 Bacteria 4271
39 Ga0070706_100089600 3300005467 Unclassified 2852
40 Ga0070707_100031591 3300005468 Bacteria 5045
41 Ga0070707_100309714 3300005468 Bacteria 1535
42 Ga0070707_100455699 3300005468 Unclassified 1240
43 Ga0070698_100006713 3300005471 Bacteria 12484
44 Ga0070698_100271283 3300005471 Bacteria 1628
45 Ga0070699_100100690 3300005518 Bacteria 2532
46 Ga0070684_100649324 3300005535 Unclassified 982
47 Ga0070697_100000326 3300005536 Bacteria 37671
48 Ga0070697_100026482 3300005536 Bacteria 4633
49 Ga0070697_100794447 3300005536 Unclassified 837
50 Ga0068855_100437964 3300005563 Bacteria 1428
51 Ga0068856_100006842 3300005614 Bacteria 11151
52 Ga0068856_100603627 3300005614 Unclassified 1118
53 Ga0070717_10001702 3300006028 Bacteria 15322
54 Ga0070717_10015771 3300006028 Bacteria 5841
55 Ga0070717_10041557 3300006028 Bacteria 3748
56 Ga0070717_10099958 3300006028 Unclassified 2462
57 Ga0070717_10195108 3300006028 Unclassified 1771
58 Ga0070717_10245014 3300006028 Unclassified 1582
59 Ga0070717_10347293 3300006028 Bacteria 1326
60 Ga0070717_10495131 3300006028 Bacteria 1104
61 Ga0070717_10624123 3300006028 Unclassified 978
62 Ga0070717_10833263 3300006028 Bacteria 839
63 Ga0070717_10991418 3300006028 Bacteria 765
64 Ga0070715_10091713 3300006163 Unclassified 1399
65 Ga0070716_100002619 3300006173 Bacteria 8315
66 Ga0070716_100002989 3300006173 Bacteria 7886
67 Ga0070716_100037520 3300006173 Bacteria 2678
68 Ga0070716_100097900 3300006173 Bacteria 1791
69 Ga0070716_100377560 3300006173 Bacteria 1012
70 Ga0070712_100000660 3300006175 Bacteria 20368
71 Ga0070712_100022089 3300006175 Unclassified 4187
72 Ga0070712_100028147 3300006175 Unclassified 3757
73 Ga0070712_100073496 3300006175 Bacteria 2453
74 Ga0070712_100264151 3300006175 Bacteria 1380
75 Ga0097621_100634300 3300006237 Unclassified 979
76 Ga0068871_100192593 3300006358 Unclassified 1757
77 Ga0105240_10123425 3300009093 Unclassified 3116
78 Ga0105240_10385360 3300009093 Unclassified 1582
79 Ga0105241_10206312 3300009174 Bacteria 1644
80 Ga0105237_10378451 3300009545 Bacteria 1420
81 Ga0105238_10826237 3300009551 Unclassified 943
82 Ga0157373_10096957 3300013100 Unclassified 2076
83 Ga0157374_10170825 3300013296 Bacteria 2121
84 Ga0157372_10726589 3300013307 Bacteria 1155
85 Ga0157372_11462423 3300013307 Unclassified 787
86 Ga0163163_10285303 3300014325 Unclassified 1703
87 Ga0157376_10045251 3300014969 Bacteria 3622
88 Ga0228598_1004023 3300024227 Bacteria 3125
89 Ga0207692_10012390 3300025898 Bacteria 3661
90 Ga0207692_10050671 3300025898 Bacteria 2101
91 Ga0207685_10038198 3300025905 Bacteria 1773
92 Ga0207685_10113650 3300025905 Unclassified 1177
93 Ga0207699_10001244 3300025906 Bacteria 12110
94 Ga0207699_10001522 3300025906 Bacteria 11001
95 Ga0207699_10089192 3300025906 Unclassified 1932
96 Ga0207699_10247672 3300025906 Unclassified 1227
97 Ga0207699_10284692 3300025906 Unclassified 1149
98 Ga0207699_10337088 3300025906 Unclassified 1061
99 Ga0207684_10000618 3300025910 Bacteria 42285
100 Ga0207695_10208482 3300025913 Bacteria 1866
101 Ga0207693_10001543 3300025915 Bacteria 20348
102 Ga0207693_10002156 3300025915 Bacteria 17162
103 Ga0207693_10039672 3300025915 Unclassified 3707
104 Ga0207693_10085011 3300025915 Bacteria 2479
105 Ga0207693_10133217 3300025915 Bacteria 1953
106 Ga0207693_10140115 3300025915 Bacteria 1902
107 Ga0207693_10223890 3300025915 Unclassified 1478
108 Ga0207663_10005115 3300025916 Bacteria 6590
109 Ga0207663_10043173 3300025916 Bacteria 2759
110 Ga0207663_10047116 3300025916 Bacteria 2660
111 Ga0207663_10297719 3300025916 Bacteria 1204
112 Ga0207646_10000224 3300025922 Bacteria 77511
113 Ga0207646_10183621 3300025922 Bacteria 1889
114 Ga0207646_10308321 3300025922 Unclassified 1430
115 Ga0207646_10422693 3300025922 Unclassified 1203
116 Ga0207687_10003937 3300025927 Bacteria 9940
117 Ga0207700_10000475 3300025928 Bacteria 23588
118 Ga0207700_10001569 3300025928 Bacteria 12965
119 Ga0207700_10033857 3300025928 Bacteria 3661
120 Ga0207700_10071493 3300025928 Bacteria 2672
121 Ga0207700_10129071 3300025928 Unclassified 2061
122 Ga0207700_10131673 3300025928 Bacteria 2043
123 Ga0207700_10225376 3300025928 Bacteria 1591
124 Ga0207700_10326730 3300025928 Bacteria 1330
125 Ga0207700_10394250 3300025928 Bacteria 1212
126 Ga0207700_10661833 3300025928 Bacteria 931
127 Ga0207664_10000280 3300025929 Bacteria 38721
128 Ga0207664_10027169 3300025929 Unclassified 4335
129 Ga0207664_10075760 3300025929 Unclassified 2721
130 Ga0207664_10155559 3300025929 Bacteria 1946
131 Ga0207664_10260245 3300025929 Unclassified 1517
132 Ga0207664_10336004 3300025929 Bacteria 1335
133 Ga0207664_10377559 3300025929 Bacteria 1258
134 Ga0207664_10428391 3300025929 Bacteria 1179
135 Ga0207664_11094826 3300025929 Bacteria 712
136 Ga0207665_10010350 3300025939 Bacteria 6126
137 Ga0207665_10053466 3300025939 Bacteria 2722
138 Ga0207665_10104107 3300025939 Bacteria 1986
139 Ga0207665_10291802 3300025939 Bacteria 1217
140 Ga0207665_10695463 3300025939 Bacteria 799
141 Ga0207665_10734311 3300025939 Bacteria 778
142 Ga0207667_11002439 3300025949 Unclassified 822
143 Ga0207678_10736844 3300026067 Bacteria 868
144 Ga0265356_1011654 3300028017 Unclassified 971
145 Ga0265337_1017058 3300028556 Bacteria 2335
146 Ga0265326_10004304 3300028558 Unclassified 4572
147 Ga0265326_10150229 3300028558 Unclassified 665
148 Ga0265319_1002027 3300028563 Bacteria 11392
149 Ga0265318_10011727 3300028577 Unclassified 3758
150 Ga0265323_10000226 3300028653 Bacteria 33118
151 Ga0265322_10000584 3300028654 Bacteria 13809
152 Ga0265338_10001967 3300028800 Bacteria 32000
153 Ga0265338_10006824 3300028800 Bacteria 14384
154 Ga0265338_10008614 3300028800 Bacteria 12338
155 Ga0265338_10047493 3300028800 Unclassified 3919
156 Ga0265338_10053756 3300028800 Unclassified 3599
157 Ga0265338_10060449 3300028800 Unclassified 3329
158 Ga0265338_10063011 3300028800 Bacteria 3237
159 Ga0265338_10365745 3300028800 Bacteria 1034
160 Ga0265324_10001608 3300029957 Bacteria 12575
161 Ga0265324_10001706 3300029957 Bacteria 12088
162 Ga0265760_10012276 3300031090 Bacteria 2448
163 Ga0265330_10001665 3300031235 Bacteria 12611
164 Ga0265330_10003992 3300031235 Bacteria 7572
165 Ga0265332_10002968 3300031238 Bacteria 8322
166 Ga0265332_10162872 3300031238 Bacteria 931
167 Ga0265328_10001509 3300031239 Bacteria 10761
168 Ga0265328_10129989 3300031239 Unclassified 942
169 Ga0265328_10175541 3300031239 Unclassified 810
170 Ga0265320_10001841 3300031240 Bacteria 15045
171 Ga0265320_10098626 3300031240 Bacteria 1347
172 Ga0265325_10009603 3300031241 Bacteria 5648
173 Ga0265325_10018628 3300031241 Bacteria 3850
174 Ga0265325_10021518 3300031241 Bacteria 3541
175 Ga0265325_10202828 3300031241 Bacteria 914
176 Ga0265329_10000959 3300031242 Bacteria 14494
177 Ga0265340_10002296 3300031247 Bacteria 10934
178 Ga0265340_10002716 3300031247 Bacteria 10073
179 Ga0265340_10017668 3300031247 Bacteria 3689
180 Ga0265340_10060480 3300031247 Bacteria 1814
181 Ga0265339_10001733 3300031249 Bacteria 16073
182 Ga0265339_10009875 3300031249 Bacteria 5961
183 Ga0265339_10042454 3300031249 Bacteria 2518
184 Ga0265339_10227905 3300031249 Bacteria 909
185 Ga0265331_10017492 3300031250 Unclassified 3736
186 Ga0265331_10028951 3300031250 Bacteria 2767
187 Ga0265327_10070072 3300031251 Unclassified 1758
188 Ga0265316_10007911 3300031344 Bacteria 9946
189 Ga0265316_10046196 3300031344 Bacteria 3452
190 Ga0265316_10208822 3300031344 Bacteria 1445
191 Ga0265316_10230474 3300031344 Bacteria 1364
192 Ga0265313_10007815 3300031595 Bacteria 7224
193 Ga0265314_10007635 3300031711 Bacteria 9362
194 Ga0265314_10012921 3300031711 Bacteria 6781
195 Ga0265314_10115549 3300031711 Viruses 1698
196 Ga0265314_10228598 3300031711 Bacteria 1081
197 Ga0265314_10246589 3300031711 Unclassified 1028
198 Ga0265342_10000830 3300031712 Bacteria 30970
199 Ga0265342_10067583 3300031712 Bacteria 2091
200 Ga0265342_10074604 3300031712 Unclassified 1971
201 Ga0265342_10253395 3300031712 Unclassified 939
202 Ga0373926_0053520 3300035083 Unclassified 1461
203 Ga0373934_0053965 3300035086 Bacteria 1595
204 Ga0373923_0014095 3300035111 Unclassified 2996
205 Ga0373923_0097277 3300035111 Archaea 1294
206 Ga0373936_0020384 3300035113 Archaea 2575
207 Ga0373936_0027431 3300035113 Bacteria 2233
208 Ga0373954_0013041 3300035118 Bacteria 3699
209 Ga0373957_0013273 3300035120 Bacteria 2792
210 Ga0373943_0000056 3300035170 Bacteria 38613
211 Ga0373943_0120021 3300035170 Bacteria 1396
212 Ga0373943_0223871 3300035170 Bacteria 1049
213 Ga0373946_0009816 3300035171 Bacteria 3535
214 Ga0373955_0048205 3300035172 Bacteria 2309
215 Ga0373924_0009440 3300035410 Unclassified 3574
216 Ga0373924_0181830 3300035410 Unclassified 925
217 Ga0373935_0006561 3300035692 Bacteria 6950
218 Ga0373935_0126861 3300035692 Archaea 1710
219 Ga0373927_0000174 3300035695 Bacteria 50641
220 Ga0373927_0136185 3300035695 Unclassified 1605
221 Ga0373927_0455737 3300035695 Unclassified 845
222 Ga0373933_0020518 3300035724 Bacteria 3746
223 Ga0373933_0184664 3300035724 Unclassified 1331
224 Ga0373947_0000108 3300035725 Bacteria 41075
225 Ga0373947_0241393 3300035725 Unclassified 1192
226 Ga0373937_0017670 3300036401 Bacteria 6363
227 Ga0373937_0053753 3300036401 Bacteria 3694
228 Ga0373937_0073914 3300036401 Unclassified 3145
229 Ga0373937_0160596 3300036401 Bacteria 2107
230 Ga0373937_0812781 3300036401 Bacteria 883
231 Ga0373937_1144577 3300036401 Unclassified 727
232 Ga0373925_0010824 3300037068 Bacteria 6614
233 Ga0373925_0143158 3300037068 Bacteria 1872
234 Ga0373925_0167016 3300037068 Unclassified 1736
235 Ga0373925_0313100 3300037068 Bacteria 1269
236 Ga0436360_0790400 3300039438 Unclassified 3222
237 Ga0436363_0743166 3300039450 Unclassified 1871
238 Ga0451577_0021829 3300042876 Bacteria 5854
239 Ga0451577_0027549 3300042876 Bacteria 5143
240 Ga0453683_0186514 3300044673 Bacteria 1316
241 Ga0453684_0014825 3300044712 Bacteria 12408
242 Ga0453684_0063763 3300044712 Unclassified 4710
243 Ga0466959_0748049 3300045049 Unclassified 654
244 Ga0451576_0001836 3300045051 Bacteria 34471
245 Ga0495629_0029693 3300046459 Unclassified 3877
246 Ga0495653_0099752 3300046463 Bacteria 2107
247 Ga0495580_0010461 3300046472 Bacteria 7230
248 Ga0495580_0017897 3300046472 Bacteria 5285
249 Ga0495580_0017914 3300046472 Bacteria 5282
250 Ga0495580_0040361 3300046472 Bacteria 3334
251 Ga0495580_0077760 3300046472 Unclassified 2314
252 Ga0495580_0078319 3300046472 Bacteria 2305
253 Ga0495580_0131644 3300046472 Archaea 1735
254 Ga0495580_0247886 3300046472 Bacteria 1220
255 Ga0495582_0006361 3300046473 Bacteria 6567
256 Ga0495630_0055457 3300046517 Bacteria 2970
257 Ga0495630_0075900 3300046517 Bacteria 2532
258 Ga0495630_0174259 3300046517 Bacteria 1640
259 Ga0495652_0781480 3300046529 Archaea 637
260 Ga0495646_0086274 3300046680 Archaea 1821
261 Ga0495647_0074149 3300046681 Unclassified 1368
262 Ga0495658_0259747 3300046683 Unclassified 1093
263 Ga0495624_0067442 3300046690 Bacteria 2232
264 Ga0495604_0548136 3300047317 Archaea 746
265 Ga0495674_0109703 3300047319 Archaea 2340
266 Ga0495674_0123340 3300047319 Unclassified 2188
267 Ga0495675_0482970 3300047444 Unclassified 713
268 Ga0495684_0085662 3300047471 Unclassified 2389
269 Ga0495684_0093378 3300047471 Unclassified 2279
270 Ga0495684_0184526 3300047471 Unclassified 1545
271 Ga0495684_0286816 3300047471 Bacteria 1186
272 Ga0495602_0116908 3300048088 Bacteria 2154
273 Ga0495614_0064105 3300048089 Unclassified 1580
274 Ga0496104_0361847 3300048907 Unclassified 1363
275 Ga0496115_0068506 3300048918 Bacteria 2873
276 Ga0496115_0088880 3300048918 Bacteria 2523
277 nmdc:mga08x19_215114_c1 3300050514 Unclassified 1319
278 Ga0495601_0012137 3300053077 Bacteria 5165
279 Ga0495601_0109405 3300053077 Bacteria 1789
280 Ga0466964_0055342
281 Ga0070709_10081782
282 Ga0070709_10229336
283 Ga0070709_10431238
284 Ga0070714_100000089
285 Ga0070714_100003004
286 Ga0070714_100112082
287 Ga0070714_100204803
288 Ga0070714_100273021
289 Ga0070714_100407514
290 Ga0070713_100000832
291 Ga0070713_100003932
292 Ga0070713_100009118
293 Ga0070713_100011047
294 Ga0070713_100054311
295 Ga0070713_100076851
296 Ga0070713_100088373
297 Ga0070713_100254825
298 Ga0070713_100479459
299 Ga0070713_100851385
300 Ga0070710_10023995
301 Ga0070710_10026133
302 Ga0070710_10044389
303 Ga0070710_10444902
304 Ga0070711_100007847
305 Ga0070711_100011182
306 Ga0070711_100015801
307 Ga0070711_100062062
308 Ga0070711_100116641
309 Ga0070711_100119848
310 Ga0070711_100130301
311 Ga0070708_100005394
312 Ga0070708_100037518
313 Ga0070708_100204256
314 Ga0070708_100484674
315 Ga0070708_100745488
316 Ga0070706_100035048
317 Ga0070706_100041068
318 Ga0070706_100089600
319 Ga0070707_100031591
320 Ga0070707_100309714
321 Ga0070707_100455699
322 Ga0070698_100006713
323 Ga0070698_100271283
324 Ga0070699_100100690
325 Ga0070684_100649324
326 Ga0070697_100000326
327 Ga0070697_100026482
328 Ga0070697_100794447
329 Ga0068855_100437964
330 Ga0068856_100006842
331 Ga0068856_100603627
332 Ga0070717_10001702
333 Ga0070717_10015771
334 Ga0070717_10041557
335 Ga0070717_10099958
336 Ga0070717_10195108
337 Ga0070717_10245014
338 Ga0070717_10347293
339 Ga0070717_10495131
340 Ga0070717_10624123
341 Ga0070717_10833263
342 Ga0070717_10991418
343 Ga0070715_10091713
344 Ga0070716_100002619
345 Ga0070716_100002989
346 Ga0070716_100037520
347 Ga0070716_100097900
348 Ga0070716_100377560
349 Ga0070712_100000660
350 Ga0070712_100022089
351 Ga0070712_100028147
352 Ga0070712_100073496
353 Ga0070712_100264151
354 Ga0097621_100634300
355 Ga0068871_100192593
356 Ga0105240_10123425
357 Ga0105240_10385360
358 Ga0105241_10206312
359 Ga0105237_10378451
360 Ga0105238_10826237
361 Ga0157373_10096957
362 Ga0157374_10170825
363 Ga0157372_10726589
364 Ga0157372_11462423
365 Ga0163163_10285303
366 Ga0157376_10045251
367 Ga0228598_1004023
368 Ga0207692_10012390
369 Ga0207692_10050671
370 Ga0207685_10038198
371 Ga0207685_10113650
372 Ga0207699_10001244
373 Ga0207699_10001522
374 Ga0207699_10089192
375 Ga0207699_10247672
376 Ga0207699_10284692
377 Ga0207699_10337088
378 Ga0207684_10000618
379 Ga0207695_10208482
380 Ga0207693_10001543
381 Ga0207693_10002156
382 Ga0207693_10039672
383 Ga0207693_10085011
384 Ga0207693_10133217
385 Ga0207693_10140115
386 Ga0207693_10223890
387 Ga0207663_10005115
388 Ga0207663_10043173
389 Ga0207663_10047116
390 Ga0207663_10297719
391 Ga0207646_10000224
392 Ga0207646_10183621
393 Ga0207646_10308321
394 Ga0207646_10422693
395 Ga0207687_10003937
396 Ga0207700_10000475
397 Ga0207700_10001569
398 Ga0207700_10033857
399 Ga0207700_10071493
400 Ga0207700_10129071
401 Ga0207700_10131673
402 Ga0207700_10225376
403 Ga0207700_10326730
404 Ga0207700_10394250
405 Ga0207700_10661833
406 Ga0207664_10000280
407 Ga0207664_10027169
408 Ga0207664_10075760
409 Ga0207664_10155559
410 Ga0207664_10260245
411 Ga0207664_10336004
412 Ga0207664_10377559
413 Ga0207664_10428391
414 Ga0207664_11094826
415 Ga0207665_10010350
416 Ga0207665_10053466
417 Ga0207665_10104107
418 Ga0207665_10291802
419 Ga0207665_10695463
420 Ga0207665_10734311
421 Ga0207667_11002439
422 Ga0207678_10736844
423 Ga0265356_1011654
424 Ga0265337_1017058
425 Ga0265326_10004304
426 Ga0265326_10150229
427 Ga0265319_1002027
428 Ga0265318_10011727
429 Ga0265323_10000226
430 Ga0265322_10000584
431 Ga0265338_10001967
432 Ga0265338_10006824
433 Ga0265338_10008614
434 Ga0265338_10047493
435 Ga0265338_10053756
436 Ga0265338_10060449
437 Ga0265338_10063011
438 Ga0265338_10365745
439 Ga0265324_10001608
440 Ga0265324_10001706
441 Ga0265760_10012276
442 Ga0265330_10001665
443 Ga0265330_10003992
444 Ga0265332_10002968
445 Ga0265332_10162872
446 Ga0265328_10001509
447 Ga0265328_10129989
448 Ga0265328_10175541
449 Ga0265320_10001841
450 Ga0265320_10098626
451 Ga0265325_10009603
452 Ga0265325_10018628
453 Ga0265325_10021518
454 Ga0265325_10202828
455 Ga0265329_10000959
456 Ga0265340_10002296
457 Ga0265340_10002716
458 Ga0265340_10017668
459 Ga0265340_10060480
460 Ga0265339_10001733
461 Ga0265339_10009875
462 Ga0265339_10042454
463 Ga0265339_10227905
464 Ga0265331_10017492
465 Ga0265331_10028951
466 Ga0265327_10070072
467 Ga0265316_10007911
468 Ga0265316_10046196
469 Ga0265316_10208822
470 Ga0265316_10230474
471 Ga0265313_10007815
472 Ga0265314_10007635
473 Ga0265314_10012921
474 Ga0265314_10115549
475 Ga0265314_10228598
476 Ga0265314_10246589
477 Ga0265342_10000830
478 Ga0265342_10067583
479 Ga0265342_10074604
480 Ga0265342_10253395
481 Ga0373926_0053520
482 Ga0373934_0053965
483 Ga0373923_0014095
484 Ga0373923_0097277
485 Ga0373936_0020384
486 Ga0373936_0027431
487 Ga0373954_0013041
488 Ga0373957_0013273
489 Ga0373943_0000056
490 Ga0373943_0120021
491 Ga0373943_0223871
492 Ga0373946_0009816
493 Ga0373955_0048205
494 Ga0373924_0009440
495 Ga0373924_0181830
496 Ga0373935_0006561
497 Ga0373935_0126861
498 Ga0373927_0000174
499 Ga0373927_0136185
500 Ga0373927_0455737
501 Ga0373933_0020518
502 Ga0373933_0184664
503 Ga0373947_0000108
504 Ga0373947_0241393
505 Ga0373937_0017670
506 Ga0373937_0053753
507 Ga0373937_0073914
508 Ga0373937_0160596
509 Ga0373937_0812781
510 Ga0373937_1144577
511 Ga0373925_0010824
512 Ga0373925_0143158
513 Ga0373925_0167016
514 Ga0373925_0313100
515 Ga0436360_0790400
516 Ga0436363_0743166
517 Ga0451577_0021829
518 Ga0451577_0027549
519 Ga0453683_0186514
520 Ga0453684_0014825
521 Ga0453684_0063763
522 Ga0466959_0748049
523 Ga0451576_0001836
524 Ga0495629_0029693
525 Ga0495653_0099752
526 Ga0495580_0010461
527 Ga0495580_0017897
528 Ga0495580_0017914
529 Ga0495580_0040361
530 Ga0495580_0077760
531 Ga0495580_0078319
532 Ga0495580_0131644
533 Ga0495580_0247886
534 Ga0495582_0006361
535 Ga0495630_0055457
536 Ga0495630_0075900
537 Ga0495630_0174259
538 Ga0495652_0781480
539 Ga0495646_0086274
540 Ga0495647_0074149
541 Ga0495658_0259747
542 Ga0495624_0067442
543 Ga0495604_0548136
544 Ga0495674_0109703
545 Ga0495674_0123340
546 Ga0495675_0482970
547 Ga0495684_0085662
548 Ga0495684_0093378
549 Ga0495684_0184526
550 Ga0495684_0286816
551 Ga0495602_0116908
552 Ga0495614_0064105
553 Ga0496104_0361847
554 Ga0496115_0068506
555 Ga0496115_0088880
556 nmdc:mga08x19_215114_c1
557 Ga0495601_0012137
558 Ga0495601_0109405

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14686

fn3_3

Polysaccharide lyase family 4, domain II

177

227

0.91

PF00127

Copper-bind

Copper binding proteins, plastocyanin/azurin family

91

177

0.85

PF13620

CarboxypepD_reg

Carboxypeptidase regulatory-like domain

171

230

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u3s-assembly1.cif.gz_B crystal structure of coh3scab-xdoc_m1scaa complex: a n-terminal interface mutant of type ii cohesin-x-dockerin complex from acetivibrio cellulolyticus 0.9081 141 191
1sf5-assembly1.cif.gz_A structure of oxidized state of the p94a mutant of amicyanin 0.9037 53 139
2ids-assembly1.cif.gz_A structure of m98a mutant of amicyanin, cu(i) 0.9033 53 139
2idu-assembly1.cif.gz_A structure of m98q mutant of amicyanin, cu(i) 0.9013 55 139
1mg3-assembly1.cif.gz_C mutation of alpha phe55 of methylamine dehydrogenase alters the reorganization energy and electronic coupling for its electron transfer reaction with amicyanin 0.898 53 139
ID Description Score Start End Superfamily
5m0yB01 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8919 141 192 2.60.40.1120
af_P15087_375_469_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8741 141 193 2.60.40.1120
af_Q22825_357_435_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8689 144 193 2.60.40.1120
af_Q9JHW1_1212_1304_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.862 144 193 2.60.40.1120
1jxdA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.861 52 139 2.60.40.420
ID Description Score Start End GO Terms
AF-A0A2V9XDN1-F1-model_v4 Blue (type 1) copper domain-containing protein 0.9951 54 163 GO:0005507
GO:0009055
AF-A0A3D1AQ33-F1-model_v4 Blue (type 1) copper domain-containing protein 0.9806 17 193 GO:0005507
GO:0009055
GO:0030246
AF-A0A3D1AQ33-F1-model_v4 Blue (type 1) copper domain-containing protein 0.9698 17 193 GO:0005507
GO:0009055
GO:0030246
AF-A0A5M8S983-F1-model_v4 Blue (type 1) copper domain-containing protein 0.963 18 193 GO:0005507
GO:0009055
GO:0030246
AF-A0A2V9YWB5-F1-model_v4 Blue (type 1) copper domain-containing protein 0.9519 1 193 GO:0005507
GO:0009055
GO:0016020

Map