F385344

General Info

Members Datasets Scaffolds Average Seq Length
283 160 566 284

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10051434|Ga0070676_100514341
Length 288
Sequence MCDQDHFEEDRAYYEAKGWVTRREFGVLAGGAGLAMMLPEVVNAVAVTESEVSIKTPDGTADCYFVHPSTGTGAGVLYWPDIFGLRPAARQMGKRLAESGYSVLVVNPFYRTKKAPEVAPQGGQTPIPTLLPLAQSLNETTHMTDAKAFIAWLDQQPSVAKNRKIGTQGYCMGGPMAFRTAAAVPDRVGAIASFHGGGLVTNMPNSPHLQASKTKASLLIAIAENDDMRAPNDKVVLKDTFAKSGQAAEIEVYPAAHGWCPPDTTVYNKEQSEKAWGRLLALYGKALA

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
124 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
128 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
131 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
132 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
133 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
134 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
135 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
136 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
137 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
138 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
139 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
155 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
159 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
160 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0.71
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 4.24
Rhizosphere 92.93
Stem 0
Stem Tuber 0
Unclassified 13.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10051434 3300005328 Bacteria 2419
2 rootH2_10109541 3300003320 Bacteria 3925
3 rootL2_10108833 3300003322 Bacteria 2532
4 Ga0058860_11914301 3300004801 Bacteria 989
5 Ga0065712_10077464 3300005290 Bacteria 3469
6 Ga0065712_10117242 3300005290 Bacteria 1723
7 Ga0065715_10010724 3300005293 Bacteria 2618
8 Ga0065715_10102662 3300005293 Bacteria 3095
9 Ga0065715_10136958 3300005293 Unclassified 1914
10 Ga0065715_10149084 3300005293 Unclassified 1751
11 Ga0065715_10226196 3300005293 Bacteria 1252
12 Ga0070676_10057604 3300005328 Bacteria 2300
13 Ga0070690_100024151 3300005330 Bacteria 3738
14 Ga0070690_100049944 3300005330 Bacteria 2668
15 Ga0070690_100093342 3300005330 Bacteria 1985
16 Ga0070690_100483904 3300005330 Bacteria 923
17 Ga0070670_100019823 3300005331 Bacteria 5774
18 Ga0070670_100025376 3300005331 Bacteria 5100
19 Ga0070670_100038547 3300005331 Bacteria 4109
20 Ga0070670_100064182 3300005331 Bacteria 3151
21 Ga0070670_100155299 3300005331 Bacteria 1981
22 Ga0070670_100392060 3300005331 Bacteria 1225
23 Ga0068869_100066747 3300005334 Unclassified 2652
24 Ga0070666_10001843 3300005335 Bacteria 12919
25 Ga0070666_10033627 3300005335 Bacteria 3393
26 Ga0070666_10036231 3300005335 Unclassified 3273
27 Ga0070666_10095911 3300005335 Bacteria 2041
28 Ga0070682_100049766 3300005337 Bacteria 2613
29 Ga0068868_100001624 3300005338 Bacteria 15344
30 Ga0070689_100134602 3300005340 Bacteria 1984
31 Ga0070687_100069496 3300005343 Bacteria 1886
32 Ga0070661_100397519 3300005344 Bacteria 1089
33 Ga0070668_100303043 3300005347 Unclassified 1340
34 Ga0070669_100030383 3300005353 Unclassified 3898
35 Ga0070669_100033292 3300005353 Bacteria 3727
36 Ga0070669_100117328 3300005353 Bacteria 2026
37 Ga0070669_100282141 3300005353 Bacteria 1331
38 Ga0070675_100000915 3300005354 Bacteria 20980
39 Ga0070675_100062934 3300005354 Bacteria 3066
40 Ga0070671_100003483 3300005355 Bacteria 12281
41 Ga0070671_100050688 3300005355 Bacteria 3452
42 Ga0070674_100054893 3300005356 Unclassified 2757
43 Ga0070673_100087565 3300005364 Unclassified 2538
44 Ga0070673_100167048 3300005364 Bacteria 1876
45 Ga0070673_100172442 3300005364 Bacteria 1847
46 Ga0070688_100001916 3300005365 Bacteria 10449
47 Ga0070688_100015785 3300005365 Bacteria 4305
48 Ga0070688_100069213 3300005365 Bacteria 2253
49 Ga0070688_100252677 3300005365 Bacteria 1256
50 Ga0070659_100011733 3300005366 Bacteria 6486
51 Ga0070667_100016196 3300005367 Bacteria 6167
52 Ga0070667_100027707 3300005367 Bacteria 4715
53 Ga0070667_100038529 3300005367 Bacteria 4007
54 Ga0070667_100516867 3300005367 Unclassified 1095
55 Ga0070714_100136806 3300005435 Unclassified 2195
56 Ga0070663_100030602 3300005455 Bacteria 3691
57 Ga0070663_100246591 3300005455 Unclassified 1412
58 Ga0070678_100085891 3300005456 Bacteria 2399
59 Ga0070678_100378401 3300005456 Bacteria 1224
60 Ga0070662_100020662 3300005457 Bacteria 4489
61 Ga0068867_100120394 3300005459 Bacteria 2028
62 Ga0070685_10071686 3300005466 Bacteria 2055
63 Ga0070685_10092239 3300005466 Bacteria 1835
64 Ga0070707_100050527 3300005468 Bacteria 3985
65 Ga0070684_100017405 3300005535 Bacteria 5898
66 Ga0070684_100079461 3300005535 Bacteria 2899
67 Ga0068853_100466312 3300005539 Bacteria 1189
68 Ga0070672_100006390 3300005543 Bacteria 7917
69 Ga0070672_100047702 3300005543 Bacteria 3325
70 Ga0070672_100155292 3300005543 Bacteria 1895
71 Ga0070686_100019845 3300005544 Bacteria 3969
72 Ga0070686_100147955 3300005544 Unclassified 1642
73 Ga0070686_100180037 3300005544 Bacteria 1501
74 Ga0070693_100037757 3300005547 Bacteria 2695
75 Ga0070665_100038286 3300005548 Bacteria 4821
76 Ga0070665_100097648 3300005548 Unclassified 2942
77 Ga0070664_100007815 3300005564 Bacteria 8638
78 Ga0070664_100086427 3300005564 Bacteria 2710
79 Ga0070664_100118214 3300005564 Bacteria 2319
80 Ga0068856_100208507 3300005614 Bacteria 1969
81 Ga0070702_100230098 3300005615 Bacteria 1245
82 Ga0068859_100001640 3300005617 Bacteria 22832
83 Ga0068859_100009352 3300005617 Bacteria 9896
84 Ga0068859_100482201 3300005617 Bacteria 1335
85 Ga0068859_100517760 3300005617 Bacteria 1288
86 Ga0068864_100001716 3300005618 Bacteria 18002
87 Ga0068864_100066503 3300005618 Bacteria 3129
88 Ga0068864_100606750 3300005618 Unclassified 1062
89 Ga0068861_100045394 3300005719 Bacteria 3309
90 Ga0068870_10035473 3300005840 Unclassified 2559
91 Ga0068863_100001500 3300005841 Bacteria 23101
92 Ga0068863_100002565 3300005841 Bacteria 18020
93 Ga0068863_100006091 3300005841 Bacteria 11832
94 Ga0068858_100010650 3300005842 Bacteria 8700
95 Ga0068858_100027627 3300005842 Bacteria 5271
96 Ga0068858_100557053 3300005842 Unclassified 1110
97 Ga0068860_100002402 3300005843 Bacteria 19655
98 Ga0068860_100066634 3300005843 Bacteria 3421
99 Ga0068862_100312794 3300005844 Unclassified 1448
100 Ga0097621_100014337 3300006237 Bacteria 5930
101 Ga0068871_100014622 3300006358 Bacteria 5855
102 Ga0068871_100042449 3300006358 Bacteria 3651
103 Ga0068871_100074334 3300006358 Bacteria 2803
104 Ga0075428_100013739 3300006844 Bacteria 9016
105 Ga0075434_100048162 3300006871 Bacteria 4230
106 Ga0068865_100208113 3300006881 Unclassified 1522
107 Ga0075436_100183885 3300006914 Bacteria 1478
108 Ga0097620_100001640 3300006931 Bacteria 22832
109 Ga0097620_100009352 3300006931 Bacteria 9896
110 Ga0097620_100482174 3300006931 Bacteria 1335
111 Ga0097620_100517702 3300006931 Bacteria 1288
112 Ga0075435_100012564 3300007076 Bacteria 6272
113 Ga0105240_10022745 3300009093 Bacteria 8304
114 Ga0105240_10513896 3300009093 Bacteria 1330
115 Ga0111539_10628783 3300009094 Bacteria 1250
116 Ga0111539_10879036 3300009094 Bacteria 1042
117 Ga0105245_10012917 3300009098 Bacteria 7279
118 Ga0105245_10098271 3300009098 Bacteria 2705
119 Ga0105247_10005390 3300009101 Bacteria 8061
120 Ga0114129_10048118 3300009147 Bacteria 5992
121 Ga0105243_10087372 3300009148 Bacteria 2559
122 Ga0105242_10053532 3300009176 Bacteria 3296
123 Ga0105248_10000923 3300009177 Bacteria 32713
124 Ga0105248_10003141 3300009177 Bacteria 18278
125 Ga0105248_10005087 3300009177 Bacteria 14508
126 Ga0105248_10015669 3300009177 Bacteria 8353
127 Ga0105238_10004607 3300009551 Bacteria 13641
128 Ga0105238_10099287 3300009551 Bacteria 2894
129 Ga0105249_10003403 3300009553 Bacteria 13778
130 Ga0105249_10304705 3300009553 Bacteria 1599
131 Ga0105246_10018476 3300011119 Bacteria 4444
132 Ga0157369_10297153 3300013105 Unclassified 1680
133 Ga0157374_10037250 3300013296 Bacteria 4462
134 Ga0157374_10292872 3300013296 Bacteria 1609
135 Ga0157378_10010670 3300013297 Bacteria 8027
136 Ga0157378_10027140 3300013297 Bacteria 5052
137 Ga0163162_10001585 3300013306 Bacteria 21262
138 Ga0163162_10003208 3300013306 Bacteria 15651
139 Ga0163162_10111704 3300013306 Bacteria 2831
140 Ga0157375_10002866 3300013308 Bacteria 14936
141 Ga0157375_10040464 3300013308 Bacteria 4493
142 Ga0157375_10117518 3300013308 Bacteria 2765
143 Ga0157375_10328108 3300013308 Bacteria 1695
144 Ga0163163_10017003 3300014325 Bacteria 6773
145 Ga0163163_10021309 3300014325 Bacteria 6114
146 Ga0163163_10080928 3300014325 Bacteria 3249
147 Ga0163163_10111242 3300014325 Bacteria 2768
148 Ga0157380_10459880 3300014326 Bacteria 1225
149 Ga0157377_10056214 3300014745 Bacteria 2234
150 Ga0157377_10072803 3300014745 Bacteria 1990
151 Ga0157379_10001354 3300014968 Bacteria 20055
152 Ga0157379_10004873 3300014968 Bacteria 11527
153 Ga0157376_10012144 3300014969 Bacteria 6381
154 Ga0157376_10038785 3300014969 Bacteria 3879
155 Ga0157376_10161472 3300014969 Bacteria 2032
156 Ga0213875_10065619 3300021388 Bacteria 1696
157 Ga0207697_10013661 3300025315 Bacteria 3384
158 Ga0207656_10012738 3300025321 Bacteria 3202
159 Ga0207680_10030866 3300025903 Bacteria 3028
160 Ga0207680_10283331 3300025903 Bacteria 1152
161 Ga0207645_10153774 3300025907 Bacteria 1502
162 Ga0207707_10447368 3300025912 Bacteria 1106
163 Ga0207660_10154048 3300025917 Bacteria 1768
164 Ga0207662_10019697 3300025918 Bacteria 3844
165 Ga0207662_10115375 3300025918 Unclassified 1678
166 Ga0207649_10372014 3300025920 Bacteria 1063
167 Ga0207652_10524282 3300025921 Bacteria 1066
168 Ga0207681_10087445 3300025923 Unclassified 2217
169 Ga0207681_10102179 3300025923 Bacteria 2070
170 Ga0207681_10132151 3300025923 Bacteria 1847
171 Ga0207681_10199990 3300025923 Bacteria 1534
172 Ga0207681_10243674 3300025923 Bacteria 1400
173 Ga0207681_10417518 3300025923 Unclassified 1086
174 Ga0207694_10005259 3300025924 Bacteria 9974
175 Ga0207650_10010939 3300025925 Bacteria 6237
176 Ga0207650_10028878 3300025925 Bacteria 3982
177 Ga0207650_10194417 3300025925 Unclassified 1622
178 Ga0207650_10236444 3300025925 Unclassified 1475
179 Ga0207659_10000399 3300025926 Bacteria 26210
180 Ga0207659_10141980 3300025926 Bacteria 1865
181 Ga0207687_10006902 3300025927 Bacteria 7481
182 Ga0207687_10104210 3300025927 Bacteria 2093
183 Ga0207687_10165080 3300025927 Unclassified 1703
184 Ga0207644_10006304 3300025931 Bacteria 7727
185 Ga0207706_10015616 3300025933 Bacteria 6862
186 Ga0207686_10023392 3300025934 Bacteria 3568
187 Ga0207709_10180967 3300025935 Unclassified 1489
188 Ga0207670_10015772 3300025936 Bacteria 4523
189 Ga0207670_10244031 3300025936 Bacteria 1385
190 Ga0207669_10046071 3300025937 Unclassified 2574
191 Ga0207669_10074263 3300025937 Unclassified 2149
192 Ga0207704_10083011 3300025938 Bacteria 2078
193 Ga0207691_10007288 3300025940 Bacteria 10670
194 Ga0207691_10033198 3300025940 Bacteria 4805
195 Ga0207691_10171872 3300025940 Bacteria 1897
196 Ga0207691_10178336 3300025940 Bacteria 1857
197 Ga0207711_10002229 3300025941 Bacteria 17400
198 Ga0207711_10009690 3300025941 Bacteria 8025
199 Ga0207711_10054680 3300025941 Bacteria 3426
200 Ga0207689_10368466 3300025942 Unclassified 1195
201 Ga0207689_10553457 3300025942 Bacteria 966
202 Ga0207661_10225635 3300025944 Bacteria 1657
203 Ga0207679_10008568 3300025945 Bacteria 6516
204 Ga0207679_10025214 3300025945 Unclassified 4087
205 Ga0207679_10125031 3300025945 Bacteria 2054
206 Ga0207651_10046571 3300025960 Bacteria 2917
207 Ga0207651_10071296 3300025960 Bacteria 2462
208 Ga0207651_10077197 3300025960 Bacteria 2384
209 Ga0207651_10543911 3300025960 Bacteria 1009
210 Ga0207712_10241603 3300025961 Unclassified 1455
211 Ga0207668_10226644 3300025972 Unclassified 1504
212 Ga0207658_10127966 3300025986 Bacteria 2035
213 Ga0207658_10175816 3300025986 Bacteria 1768
214 Ga0207677_10003859 3300026023 Bacteria 7983
215 Ga0207703_10012918 3300026035 Bacteria 6508
216 Ga0207703_10047512 3300026035 Bacteria 3461
217 Ga0207703_10240991 3300026035 Bacteria 1626
218 Ga0207678_10021218 3300026067 Bacteria 5694
219 Ga0207708_10183387 3300026075 Bacteria 1662
220 Ga0207702_10452639 3300026078 Bacteria 1246
221 Ga0207702_10619194 3300026078 Bacteria 1063
222 Ga0207641_10005354 3300026088 Bacteria 10957
223 Ga0207641_10028810 3300026088 Bacteria 4590
224 Ga0207641_10034495 3300026088 Bacteria 4210
225 Ga0207648_10141663 3300026089 Bacteria 2119
226 Ga0207676_10006713 3300026095 Bacteria 8140
227 Ga0207676_10123419 3300026095 Bacteria 2188
228 Ga0207676_10461482 3300026095 Bacteria 1199
229 Ga0207675_100052278 3300026118 Bacteria 3812
230 Ga0207675_100516396 3300026118 Unclassified 1190
231 Ga0207683_10099235 3300026121 Bacteria 2599
232 Ga0207683_10108054 3300026121 Bacteria 2489
233 Ga0207683_10218638 3300026121 Bacteria 1735
234 Ga0268266_10017845 3300028379 Bacteria 6048
235 Ga0268266_10062470 3300028379 Bacteria 3215
236 Ga0268265_10055920 3300028380 Bacteria 3000
237 Ga0268265_10380104 3300028380 Bacteria 1299
238 Ga0268264_10070762 3300028381 Bacteria 2953
239 Ga0268264_10093043 3300028381 Bacteria 2603
240 Ga0265338_10145683 3300028800 Bacteria 1848
241 Ga0373943_0009991 3300035170 Unclassified 4255
242 Ga0373947_0520673 3300035725 Bacteria 809
243 Ga0436364_0540794 3300037853 Bacteria 3171
244 Ga0436365_0161433 3300039437 Bacteria 13949
245 Ga0436365_1233515 3300039437 Bacteria 2286
246 Ga0439435_0015202 3300042436 Bacteria 1912
247 Ga0439460_0136687 3300042461 Bacteria 811
248 Ga0451576_0429403 3300045051 Bacteria 1386
249 Ga0495603_0017661 3300046455 Bacteria 4318
250 Ga0495639_0011461 3300046475 Bacteria 3822
251 Ga0495652_0515633 3300046529 Unclassified 827
252 Ga0495586_0384768 3300046535 Bacteria 807
253 Ga0495621_0228388 3300046539 Bacteria 755
254 Ga0495659_0043860 3300046664 Bacteria 1606
255 Ga0495658_0069042 3300046683 Bacteria 2048
256 Ga0495684_0249897 3300047471 Bacteria 1291
257 Ga0496100_0161044 3300048903 Bacteria 1609
258 Ga0496101_0079214 3300048904 Bacteria 2425
259 Ga0496104_0015437 3300048907 Bacteria 6917
260 Ga0496108_0020492 3300048911 Bacteria 5437
261 Ga0496109_0010248 3300048912 Bacteria 8003
262 Ga0496110_0020461 3300048913 Bacteria 5588
263 Ga0496111_0055502 3300048914 Bacteria 2865
264 Ga0496111_0283776 3300048914 Unclassified 1228
265 Ga0496112_0004120 3300048915 Bacteria 12225
266 Ga0496112_0009574 3300048915 Bacteria 8738
267 Ga0496113_0326516 3300048916 Bacteria 1230
268 Ga0496113_0524768 3300048916 Unclassified 950
269 Ga0501306_022803 3300049127 Bacteria 885
270 Ga0501036_0372342 3300049572 Bacteria 1192
271 Ga0501039_0100694 3300049575 Bacteria 2255
272 Ga0501041_0162551 3300049577 Bacteria 1396
273 Ga0501069_0244218 3300049585 Bacteria 1047
274 Ga0501070_0007967 3300049586 Bacteria 8973
275 Ga0501080_0400915 3300049742 Bacteria 1234
276 Ga0501045_0116103 3300049824 Bacteria 1986
277 nmdc:mga0k408_296305_c1 3300050493 Unclassified 965
278 nmdc:mga05p37_25401_c1 3300050507 Bacteria 7204
279 nmdc:mga0rr50_58049_c1 3300050513 Bacteria 2898
280 Ga0495601_0257750 3300053077 Bacteria 1139
281 Ga0501084_0298839 3300054114 Bacteria 1360
282 Ga0501084_0817870 3300054114 Bacteria 784
283 Ga0501082_0373788 3300060353 Bacteria 1243
284 Ga0070676_10051434
285 rootH2_10109541
286 rootL2_10108833
287 Ga0058860_11914301
288 Ga0065712_10077464
289 Ga0065712_10117242
290 Ga0065715_10010724
291 Ga0065715_10102662
292 Ga0065715_10136958
293 Ga0065715_10149084
294 Ga0065715_10226196
295 Ga0070676_10057604
296 Ga0070690_100024151
297 Ga0070690_100049944
298 Ga0070690_100093342
299 Ga0070690_100483904
300 Ga0070670_100019823
301 Ga0070670_100025376
302 Ga0070670_100038547
303 Ga0070670_100064182
304 Ga0070670_100155299
305 Ga0070670_100392060
306 Ga0068869_100066747
307 Ga0070666_10001843
308 Ga0070666_10033627
309 Ga0070666_10036231
310 Ga0070666_10095911
311 Ga0070682_100049766
312 Ga0068868_100001624
313 Ga0070689_100134602
314 Ga0070687_100069496
315 Ga0070661_100397519
316 Ga0070668_100303043
317 Ga0070669_100030383
318 Ga0070669_100033292
319 Ga0070669_100117328
320 Ga0070669_100282141
321 Ga0070675_100000915
322 Ga0070675_100062934
323 Ga0070671_100003483
324 Ga0070671_100050688
325 Ga0070674_100054893
326 Ga0070673_100087565
327 Ga0070673_100167048
328 Ga0070673_100172442
329 Ga0070688_100001916
330 Ga0070688_100015785
331 Ga0070688_100069213
332 Ga0070688_100252677
333 Ga0070659_100011733
334 Ga0070667_100016196
335 Ga0070667_100027707
336 Ga0070667_100038529
337 Ga0070667_100516867
338 Ga0070714_100136806
339 Ga0070663_100030602
340 Ga0070663_100246591
341 Ga0070678_100085891
342 Ga0070678_100378401
343 Ga0070662_100020662
344 Ga0068867_100120394
345 Ga0070685_10071686
346 Ga0070685_10092239
347 Ga0070707_100050527
348 Ga0070684_100017405
349 Ga0070684_100079461
350 Ga0068853_100466312
351 Ga0070672_100006390
352 Ga0070672_100047702
353 Ga0070672_100155292
354 Ga0070686_100019845
355 Ga0070686_100147955
356 Ga0070686_100180037
357 Ga0070693_100037757
358 Ga0070665_100038286
359 Ga0070665_100097648
360 Ga0070664_100007815
361 Ga0070664_100086427
362 Ga0070664_100118214
363 Ga0068856_100208507
364 Ga0070702_100230098
365 Ga0068859_100001640
366 Ga0068859_100009352
367 Ga0068859_100482201
368 Ga0068859_100517760
369 Ga0068864_100001716
370 Ga0068864_100066503
371 Ga0068864_100606750
372 Ga0068861_100045394
373 Ga0068870_10035473
374 Ga0068863_100001500
375 Ga0068863_100002565
376 Ga0068863_100006091
377 Ga0068858_100010650
378 Ga0068858_100027627
379 Ga0068858_100557053
380 Ga0068860_100002402
381 Ga0068860_100066634
382 Ga0068862_100312794
383 Ga0097621_100014337
384 Ga0068871_100014622
385 Ga0068871_100042449
386 Ga0068871_100074334
387 Ga0075428_100013739
388 Ga0075434_100048162
389 Ga0068865_100208113
390 Ga0075436_100183885
391 Ga0097620_100001640
392 Ga0097620_100009352
393 Ga0097620_100482174
394 Ga0097620_100517702
395 Ga0075435_100012564
396 Ga0105240_10022745
397 Ga0105240_10513896
398 Ga0111539_10628783
399 Ga0111539_10879036
400 Ga0105245_10012917
401 Ga0105245_10098271
402 Ga0105247_10005390
403 Ga0114129_10048118
404 Ga0105243_10087372
405 Ga0105242_10053532
406 Ga0105248_10000923
407 Ga0105248_10003141
408 Ga0105248_10005087
409 Ga0105248_10015669
410 Ga0105238_10004607
411 Ga0105238_10099287
412 Ga0105249_10003403
413 Ga0105249_10304705
414 Ga0105246_10018476
415 Ga0157369_10297153
416 Ga0157374_10037250
417 Ga0157374_10292872
418 Ga0157378_10010670
419 Ga0157378_10027140
420 Ga0163162_10001585
421 Ga0163162_10003208
422 Ga0163162_10111704
423 Ga0157375_10002866
424 Ga0157375_10040464
425 Ga0157375_10117518
426 Ga0157375_10328108
427 Ga0163163_10017003
428 Ga0163163_10021309
429 Ga0163163_10080928
430 Ga0163163_10111242
431 Ga0157380_10459880
432 Ga0157377_10056214
433 Ga0157377_10072803
434 Ga0157379_10001354
435 Ga0157379_10004873
436 Ga0157376_10012144
437 Ga0157376_10038785
438 Ga0157376_10161472
439 Ga0213875_10065619
440 Ga0207697_10013661
441 Ga0207656_10012738
442 Ga0207680_10030866
443 Ga0207680_10283331
444 Ga0207645_10153774
445 Ga0207707_10447368
446 Ga0207660_10154048
447 Ga0207662_10019697
448 Ga0207662_10115375
449 Ga0207649_10372014
450 Ga0207652_10524282
451 Ga0207681_10087445
452 Ga0207681_10102179
453 Ga0207681_10132151
454 Ga0207681_10199990
455 Ga0207681_10243674
456 Ga0207681_10417518
457 Ga0207694_10005259
458 Ga0207650_10010939
459 Ga0207650_10028878
460 Ga0207650_10194417
461 Ga0207650_10236444
462 Ga0207659_10000399
463 Ga0207659_10141980
464 Ga0207687_10006902
465 Ga0207687_10104210
466 Ga0207687_10165080
467 Ga0207644_10006304
468 Ga0207706_10015616
469 Ga0207686_10023392
470 Ga0207709_10180967
471 Ga0207670_10015772
472 Ga0207670_10244031
473 Ga0207669_10046071
474 Ga0207669_10074263
475 Ga0207704_10083011
476 Ga0207691_10007288
477 Ga0207691_10033198
478 Ga0207691_10171872
479 Ga0207691_10178336
480 Ga0207711_10002229
481 Ga0207711_10009690
482 Ga0207711_10054680
483 Ga0207689_10368466
484 Ga0207689_10553457
485 Ga0207661_10225635
486 Ga0207679_10008568
487 Ga0207679_10025214
488 Ga0207679_10125031
489 Ga0207651_10046571
490 Ga0207651_10071296
491 Ga0207651_10077197
492 Ga0207651_10543911
493 Ga0207712_10241603
494 Ga0207668_10226644
495 Ga0207658_10127966
496 Ga0207658_10175816
497 Ga0207677_10003859
498 Ga0207703_10012918
499 Ga0207703_10047512
500 Ga0207703_10240991
501 Ga0207678_10021218
502 Ga0207708_10183387
503 Ga0207702_10452639
504 Ga0207702_10619194
505 Ga0207641_10005354
506 Ga0207641_10028810
507 Ga0207641_10034495
508 Ga0207648_10141663
509 Ga0207676_10006713
510 Ga0207676_10123419
511 Ga0207676_10461482
512 Ga0207675_100052278
513 Ga0207675_100516396
514 Ga0207683_10099235
515 Ga0207683_10108054
516 Ga0207683_10218638
517 Ga0268266_10017845
518 Ga0268266_10062470
519 Ga0268265_10055920
520 Ga0268265_10380104
521 Ga0268264_10070762
522 Ga0268264_10093043
523 Ga0265338_10145683
524 Ga0373943_0009991
525 Ga0373947_0520673
526 Ga0436364_0540794
527 Ga0436365_0161433
528 Ga0436365_1233515
529 Ga0439435_0015202
530 Ga0439460_0136687
531 Ga0451576_0429403
532 Ga0495603_0017661
533 Ga0495639_0011461
534 Ga0495652_0515633
535 Ga0495586_0384768
536 Ga0495621_0228388
537 Ga0495659_0043860
538 Ga0495658_0069042
539 Ga0495684_0249897
540 Ga0496100_0161044
541 Ga0496101_0079214
542 Ga0496104_0015437
543 Ga0496108_0020492
544 Ga0496109_0010248
545 Ga0496110_0020461
546 Ga0496111_0055502
547 Ga0496111_0283776
548 Ga0496112_0004120
549 Ga0496112_0009574
550 Ga0496113_0326516
551 Ga0496113_0524768
552 Ga0501306_022803
553 Ga0501036_0372342
554 Ga0501039_0100694
555 Ga0501041_0162551
556 Ga0501069_0244218
557 Ga0501070_0007967
558 Ga0501080_0400915
559 Ga0501045_0116103
560 nmdc:mga0k408_296305_c1
561 nmdc:mga05p37_25401_c1
562 nmdc:mga0rr50_58049_c1
563 Ga0495601_0257750
564 Ga0501084_0298839
565 Ga0501084_0817870
566 Ga0501082_0373788

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

61

287

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u2e-assembly1.cif.gz_A crystal structure of dienelactone hydrolase s-3 variant (q35h, f38l, q110l, c123s, y137c, y145c, n154d, e199g, s208g, g211d and k234n) at 1.70 a resolution 0.8703 47 285
4u2g-assembly1.cif.gz_A crystal structure of dienelactone hydrolase b-4 variant (q35h, f38l, y64h, q76l, q110l, c123s, y137c, a141v, y145c, n154d, e199g, s208g, g211d, s233g and 237q) at 1.80 a resolution 0.8659 47 285
1ziy-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase mutant (c123s) bound with the pms moiety of the protease inhibitor, phenylmethylsulfonyl fluoride (pmsf)- 1.9 a 0.8633 47 285
1ggv-assembly1.cif.gz_A crystal structure of the c123s mutant of dienelactone hydrolase (dlh) bound with the pms moiety of the protease inhibitor, phenylmethylsulfonyl fluoride (pmsf) 0.8631 47 285
4u2c-assembly1.cif.gz_A crystal structure of dienelactone hydrolase a-6 variant (s7t, a24v, q35h, f38l, q110l, c123s, y145c, e199g and s208g) at 1.95 a resolution 0.8628 47 285
ID Description Score Start End Superfamily
af_I6XF92_3_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9504 45 283 3.40.50.1820
af_I6XF92_3_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9389 45 283 3.40.50.1820
af_Q54MZ9_1_255_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9269 44 287 3.40.50.1820
af_Q54MZ9_1_255_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8854 44 287 3.40.50.1820
4zv9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8681 42 287 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A3C1VTF1-F1-model_v4 Dienelactone hydrolase 0.9905 192 285 GO:0016787
AF-A0A349Z5K7-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.9763 136 287 GO:0016787
AF-A0A7X4FRE1-F1-model_v4 Dienelactone hydrolase family protein 0.9757 43 287 GO:0016787
AF-A0A520F7M0-F1-model_v4 deleted 0.9717 57 287
AF-A0A7X4FRE1-F1-model_v4 Dienelactone hydrolase family protein 0.9717 43 287 GO:0016787

Map