F385285

General Info

Members Datasets Scaffolds Average Seq Length
282 213 564 484

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2954673503|2954680497
Length 519
Sequence GAQVVNRLRTDSVPPRSGAFVHRRLIAPGAFAAASLMLAIPASAAGFSPGAPGIGDPYYPDYGNGGYDVSHYDLRLKYQPATDELEGTATLLARTTQDLSRFDLDFLLDVSEVRVNGAKASFSTSGEHELQITPKSPLVKGTSVTVVVRYSGVPSSKQAYGFTSWHRTPDGGVGANEPEAAWWWFPSNDHPLDKATYDVSVLVPDGSQAISNGTLQSTSSRLGWTRWNWRSAKPQATYLATLAVGRFDLTTGTTDGGIPVVNAYSKDLGANSGAARAGVERTGEIADWLSGYFGPYPFDALGEYVPNTTTGYALETQTRPFYSPRQFANGSNTSVVVHELAHQWYGDLVSVRGWKDIWINEGFARYAQWLWSEHEDEGTAQELADYVYASHPADDVFWTVRPGDPGPENQFDIAVYDRGALALQALRNEIGDEAFFAVLKGWPQKYAYGNASVADFRKYAEEVSGRPLAALFDTWLFQPSKPGAPAARGASIARSAEASVRPESWRKIAATNDVHEHEH

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
5 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
6 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
7 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
8 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
9 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
10 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
11 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
12 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
13 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
14 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
15 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
16 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
17 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
18 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
19 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
24 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
25 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
26 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
27 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
28 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
29 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
30 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
31 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
32 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
33 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
34 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
35 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
36 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
37 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
38 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
39 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
40 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
41 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
42 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
43 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
44 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
45 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
46 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
47 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
48 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
49 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
50 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
51 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
52 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
53 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
54 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
55 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
56 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
57 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
58 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
59 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
60 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
61 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
62 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
63 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
64 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
65 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
66 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
67 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
68 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
69 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
70 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
71 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
72 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
73 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
74 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
75 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
76 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
77 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
78 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
79 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
80 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
81 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
82 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
83 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
84 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
85 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
86 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
87 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
88 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
89 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
90 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
91 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
92 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
93 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
94 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
95 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
96 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
97 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
98 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
99 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
100 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
101 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
102 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
114 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
115 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
116 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
119 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
120 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
121 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
122 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
123 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
124 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
125 2501939600 Micromonospora sp. L5 Isolate Unclassified
126 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
127 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
128 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
129 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
130 2643221561 Nocardioides sp. Root151 Isolate Unclassified
131 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
132 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
133 2643221647 Streptomyces sp. Root369 Isolate Unclassified
134 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
135 2643221696 Nocardioides sp. Root140 Isolate Unclassified
136 2643221714 Streptomyces sp. Root264 Isolate Unclassified
137 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
138 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
139 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
140 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
141 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
142 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
143 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
144 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
145 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
146 2808606448 Streptomyces sp. 193411 Isolate Unclassified
147 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
148 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
149 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
150 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
151 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
152 2855683550 Micromonospora sp. RP3T Isolate Unclassified
153 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
154 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
155 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
156 2858868258 Micromonospora sp. MH33 Isolate Unclassified
157 2858882152 Micromonospora noduli MED15 Isolate Nodule
158 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
159 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
160 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
161 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
162 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
163 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
164 2867369537 Streptomyces sp. Z26 Isolate Unclassified
165 2867428634 Streptomyces sp. RP5T Isolate Unclassified
166 2867475112 Streptomyces sp. TM32 Isolate Unclassified
167 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
168 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
169 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
170 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
171 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
172 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
173 2902582711 Micromonospora sp. AP08 Isolate Unclassified
174 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
175 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
176 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
177 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
178 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
179 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
180 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
181 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
182 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
183 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
184 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
185 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
186 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
187 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
188 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
189 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
190 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
191 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
192 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
193 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
194 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
195 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
196 649633069 Micromonospora sp. L5 Isolate Unclassified
197 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
198 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
199 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
200 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
201 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
202 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
203 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
204 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
205 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
206 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
207 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
208 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
209 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
210 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
211 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
212 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
213 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 68.09
Metatranscriptomes 0
Isolates 31.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.61
Nodule 2.84
Rhizoplane 0.71
Rhizosphere 68.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10027277 3300003215 Bacteria 2004
2 rootH2_10186401 3300003320 Bacteria 2733
3 Ga0070668_100000573 3300005347 Bacteria 24684
4 Ga0070663_100003663 3300005455 Bacteria 8901
5 Ga0070685_10030450 3300005466 Bacteria 3007
6 Ga0068853_100028208 3300005539 Bacteria 4720
7 Ga0068857_100169079 3300005577 Bacteria 1986
8 Ga0068859_100156383 3300005617 Bacteria 2357
9 Ga0068862_100018067 3300005844 Bacteria 5873
10 Ga0081538_10001789 3300005981 Bacteria 21694
11 Ga0081538_10004566 3300005981 Bacteria 12744
12 Ga0081538_10047194 3300005981 Bacteria 2645
13 Ga0075368_10012274 3300006042 Bacteria 3128
14 Ga0075367_10005712 3300006178 Bacteria 6215
15 Ga0075367_10024184 3300006178 Bacteria 3426
16 Ga0097620_100156381 3300006931 Bacteria 2357
17 Ga0105251_10031342 3300009011 Bacteria 2661
18 Ga0111539_10058032 3300009094 Bacteria 4593
19 Ga0105246_10010904 3300011119 Bacteria 5634
20 Ga0183367_1001 3300015688 Bacteria 1225545
21 Ga0209758_1003466 3300025297 Bacteria 14304
22 Ga0207647_10001329 3300025904 Bacteria 18985
23 Ga0207647_10025270 3300025904 Bacteria 3905
24 Ga0207668_10000819 3300025972 Bacteria 19002
25 Ga0207678_10004297 3300026067 Bacteria 12781
26 Ga0207674_10144722 3300026116 Bacteria 2336
27 Ga0307515_10000163 3300028794 Bacteria 163159
28 Ga0307515_10027391 3300028794 Bacteria 9743
29 Ga0307511_10000150 3300030521 Bacteria 66178
30 Ga0307511_10026328 3300030521 Bacteria 5336
31 Ga0307512_10010523 3300030522 Bacteria 8815
32 Ga0265340_10000537 3300031247 Bacteria 20931
33 Ga0307513_10000041 3300031456 Bacteria 169674
34 Ga0307513_10052023 3300031456 Bacteria 4413
35 Ga0307513_10122810 3300031456 Bacteria 2560
36 Ga0307509_10010645 3300031507 Bacteria 11227
37 Ga0307509_10016946 3300031507 Bacteria 8402
38 Ga0307508_10032037 3300031616 Bacteria 4750
39 Ga0307514_10001738 3300031649 Bacteria 24956
40 Ga0307416_100107107 3300032002 Bacteria 2452
41 Ga0307507_10004114 3300033179 Bacteria 26500
42 Ga0307507_10010394 3300033179 Bacteria 12034
43 Ga0307507_10036903 3300033179 Bacteria 4985
44 Ga0307510_10002647 3300033180 Bacteria 20453
45 Ga0307510_10057408 3300033180 Bacteria 4040
46 Ga0307510_10065045 3300033180 Bacteria 3697
47 Ga0395898_0018983 3300037466 Bacteria 7003
48 Ga0439436_0027938 3300041404 Bacteria 1648
49 Ga0439439_0003503 3300041406 Bacteria 3467
50 Ga0451791_1761287 3300041451 Bacteria 2553
51 Ga0451853_0288226 3300041512 Bacteria 4540
52 Ga0439448_0016399 3300042005 Bacteria 2254
53 Ga0439449_0000789 3300042007 Bacteria 12218
54 Ga0439449_0016505 3300042007 Bacteria 2774
55 Ga0439455_0000232 3300042012 Bacteria 6654
56 Ga0439457_000374 3300042014 Bacteria 12607
57 Ga0439457_001339 3300042014 Bacteria 7402
58 Ga0450903_000358 3300042138 Bacteria 10027
59 Ga0439458_0001121 3300042157 Bacteria 6807
60 Ga0466969_0026269 3300044656 Bacteria 2987
61 Ga0466972_0002890 3300044658 Bacteria 8502
62 Ga0466972_0041529 3300044658 Bacteria 2239
63 Ga0466965_0025216 3300044683 Bacteria 2878
64 Ga0466966_0014776 3300044684 Bacteria 5164
65 Ga0466961_0071233 3300044693 Bacteria 2206
66 Ga0466963_0008086 3300044694 Bacteria 6297
67 Ga0466963_0018210 3300044694 Bacteria 4387
68 Ga0466971_0002086 3300044719 Bacteria 8477
69 Ga0466971_0005787 3300044719 Bacteria 5379
70 Ga0466971_0033015 3300044719 Bacteria 2319
71 Ga0466970_0001147 3300044765 Bacteria 12846
72 Ga0466970_0003166 3300044765 Bacteria 7997
73 Ga0466970_0035076 3300044765 Bacteria 2658
74 Ga0466957_0003255 3300044842 Bacteria 8889
75 Ga0466959_0026207 3300045049 Bacteria 4321
76 Ga0466958_0003383 3300045836 Bacteria 8271
77 Ga0466958_0028039 3300045836 Bacteria 3336
78 Ga0466967_0087008 3300045976 Bacteria 2832
79 Ga0466967_0129657 3300045976 Bacteria 2339
80 Ga0495617_022194 3300046452 Bacteria 2145
81 Ga0495592_0010829 3300046454 Bacteria 6878
82 Ga0495592_0034463 3300046454 Bacteria 3815
83 Ga0495603_0005116 3300046455 Bacteria 7834
84 Ga0495603_0005205 3300046455 Bacteria 7763
85 Ga0495629_0006888 3300046459 Bacteria 8385
86 Ga0495629_0008116 3300046459 Bacteria 7728
87 Ga0495629_0018759 3300046459 Bacteria 4945
88 Ga0495629_0096234 3300046459 Bacteria 2065
89 Ga0495629_0134941 3300046459 Bacteria 1718
90 Ga0495651_0029446 3300046462 Bacteria 4282
91 Ga0495605_0015500 3300046474 Bacteria 4142
92 Ga0495662_0002269 3300046476 Bacteria 9692
93 Ga0495664_0001061 3300046477 Bacteria 14199
94 Ga0495664_0049012 3300046477 Bacteria 2507
95 Ga0495585_0003268 3300046492 Bacteria 11034
96 Ga0495606_0016139 3300046507 Bacteria 5713
97 Ga0495616_0006775 3300046513 Bacteria 6906
98 Ga0495618_0009224 3300046514 Bacteria 5959
99 Ga0495628_0015223 3300046516 Bacteria 6425
100 Ga0495628_0098484 3300046516 Bacteria 2258
101 Ga0495630_0017430 3300046517 Bacteria 5261
102 Ga0495631_0005367 3300046518 Bacteria 6720
103 Ga0495640_0010147 3300046533 Bacteria 7300
104 Ga0495609_0049619 3300046538 Bacteria 1872
105 Ga0495597_0014623 3300046542 Bacteria 3734
106 Ga0495645_0093904 3300046543 Bacteria 2140
107 Ga0495622_0010270 3300046557 Bacteria 4328
108 Ga0495622_0020912 3300046557 Bacteria 3047
109 Ga0495633_0024942 3300046558 Bacteria 2949
110 Ga0495668_0007182 3300046616 Bacteria 7160
111 Ga0495634_0000940 3300046642 Bacteria 27601
112 Ga0495634_0089900 3300046642 Bacteria 1995
113 Ga0495625_0037645 3300046660 Bacteria 3546
114 Ga0495635_0000362 3300046663 Bacteria 28863
115 Ga0495635_0074272 3300046663 Bacteria 2329
116 Ga0495588_0050519 3300046674 Bacteria 2139
117 Ga0495657_0012523 3300046675 Bacteria 6300
118 Ga0495646_0000248 3300046680 Bacteria 27181
119 Ga0495613_0000782 3300046689 Bacteria 24729
120 Ga0495613_0007252 3300046689 Bacteria 8252
121 Ga0495613_0143971 3300046689 Bacteria 1702
122 Ga0495624_0015165 3300046690 Bacteria 5213
123 Ga0495624_0040967 3300046690 Bacteria 2965
124 Ga0495649_0025388 3300046694 Bacteria 3300
125 Ga0495589_0017182 3300046794 Bacteria 3714
126 Ga0495589_0064521 3300046794 Bacteria 1795
127 Ga0495581_0035353 3300047315 Bacteria 2892
128 Ga0495604_0000808 3300047317 Bacteria 26330
129 Ga0495604_0070825 3300047317 Bacteria 2639
130 Ga0495676_0017298 3300047321 Bacteria 6378
131 Ga0495676_0040416 3300047321 Bacteria 3849
132 Ga0495676_0050562 3300047321 Bacteria 3332
133 Ga0495680_0042744 3300047322 Bacteria 3593
134 Ga0495687_002047 3300047443 Bacteria 16978
135 Ga0495675_0015383 3300047444 Bacteria 4839
136 Ga0495675_0048234 3300047444 Bacteria 2709
137 Ga0495675_0058678 3300047444 Bacteria 2440
138 Ga0495685_002839 3300047447 Bacteria 5469
139 Ga0495685_010155 3300047447 Bacteria 3154
140 Ga0495685_024196 3300047447 Bacteria 2089
141 Ga0495681_0000311 3300047470 Bacteria 38913
142 Ga0495686_0024119 3300047472 Bacteria 4000
143 Ga0495593_0001388 3300047673 Bacteria 14178
144 Ga0495614_0000889 3300048089 Bacteria 12695
145 Ga0495614_0050613 3300048089 Bacteria 1779
146 Ga0495626_0013756 3300048091 Bacteria 4197
147 Ga0495678_030366 3300049459 Bacteria 2262
148 Ga0501031_0113811 3300049568 Bacteria 1767
149 Ga0501032_0034778 3300049569 Bacteria 3447
150 Ga0501032_0150509 3300049569 Bacteria 1530
151 Ga0501033_0005550 3300049570 Bacteria 9975
152 Ga0501033_0005615 3300049570 Bacteria 9913
153 Ga0501033_0013157 3300049570 Bacteria 6303
154 Ga0501033_0065192 3300049570 Bacteria 2680
155 Ga0501034_0043754 3300049571 Bacteria 4529
156 Ga0501034_0166776 3300049571 Bacteria 2171
157 Ga0501034_0188636 3300049571 Bacteria 2024
158 Ga0501034_0230242 3300049571 Bacteria 1802
159 Ga0501034_0233526 3300049571 Bacteria 1787
160 Ga0501036_0000951 3300049572 Bacteria 21789
161 Ga0501036_0000952 3300049572 Bacteria 21786
162 Ga0501036_0021519 3300049572 Bacteria 5422
163 Ga0501037_0026380 3300049573 Bacteria 4294
164 Ga0501037_0075257 3300049573 Bacteria 2452
165 Ga0501038_0033280 3300049574 Bacteria 4541
166 Ga0501038_0055244 3300049574 Bacteria 3412
167 Ga0501038_0082097 3300049574 Bacteria 2714
168 Ga0501042_0035557 3300049578 Bacteria 3534
169 Ga0501043_0022632 3300049579 Bacteria 4927
170 Ga0501043_0023933 3300049579 Bacteria 4791
171 Ga0501047_0026108 3300049581 Bacteria 5618
172 Ga0501047_0063817 3300049581 Bacteria 3553
173 Ga0501047_0086187 3300049581 Bacteria 3018
174 Ga0501047_0127818 3300049581 Bacteria 2421
175 Ga0501048_0117139 3300049582 Bacteria 1881
176 Ga0501070_0002167 3300049586 Bacteria 17251
177 Ga0501071_0020024 3300049587 Bacteria 4649
178 Ga0501072_0011941 3300049588 Bacteria 6633
179 Ga0501035_0017342 3300049822 Bacteria 6639
180 Ga0501035_0025554 3300049822 Bacteria 5413
181 Ga0501044_0008984 3300049823 Bacteria 10927
182 Ga0501044_0015981 3300049823 Bacteria 8075
183 Ga0501044_0060588 3300049823 Bacteria 3874
184 Ga0501044_0126464 3300049823 Bacteria 2553
185 nmdc:mga06z11_17624_c1 3300050494 Bacteria 3246
186 Ga0500583_0043935 3300053092 Bacteria 2044
187 Ga0500560_001789 3300053107 Bacteria 3871
188 Ga0500568_0003516 3300053139 Bacteria 8689
189 Ga0500573_0010845 3300053140 Bacteria 5091
190 Ga0500573_0028719 3300053140 Bacteria 3205
191 Ga0500616_0000504 3300053153 Bacteria 49924
192 Ga0500616_0008582 3300053153 Bacteria 6328
193 2954680497 2954673503 Bacteria 9685905
194 2501944937 2501939600 Bacteria 6907073
195 2547412148 2547132111 Bacteria 8013147
196 2585304049 2582581313 Bacteria 10042643
197 2585312036 2582581314 Bacteria 11452267
198 2616698994 2616644814 Bacteria 11555299
199 2643826230 2643221561 Bacteria 4984412
200 2644019811 2643221601 Bacteria 7493239
201 2644180299 2643221631 Bacteria 8168043
202 2644263811 2643221647 Bacteria 10741251
203 2644438143 2643221678 Bacteria 9540101
204 2644532207 2643221696 Bacteria 5431823
205 2644631865 2643221714 Bacteria 9015452
206 2772644271 2772190715 Bacteria 6959372
207 2784591906 2784132148 Bacteria 8627943
208 2785339811 2784746763 Bacteria 9783172
209 2785373133 2784746768 Bacteria 10036182
210 2786674905 2786546132 Bacteria 10419719
211 2791916318 2791354901 Bacteria 8322202
212 2793979775 2791355406 Bacteria 11364898
213 2808845276 2808606359 Bacteria 9866990
214 2808914974 2808606375 Bacteria 9466072
215 2809235517 2808606448 Bacteria 8656184
216 2812354437 2811994879 Bacteria 9313447
217 2819746574 2818991472 Bacteria 10089953
218 2852636060 2852635781 Bacteria 8251373
219 2855676505 2855670206 Bacteria 7120389
220 2855678572 2855676851 Bacteria 7063653
221 2855684660 2855683550 Bacteria 7134265
222 2856864414 2856858025 Bacteria 7255264
223 2857290121 2857288857 Bacteria 7189066
224 2858852087 2858848962 Bacteria 6963058
225 2858871602 2858868258 Bacteria 7683772
226 2858888657 2858882152 Bacteria 7230291
227 2858888910 2858888857 Bacteria 7060307
228 2858897495 2858895516 Bacteria 7378898
229 2858905690 2858902515 Bacteria 7086037
230 2862283100 2862281513 Bacteria 9621493
231 2862295032 2862290372 Bacteria 7471434
232 2862384382 2862382967 Bacteria 10317375
233 2867374870 2867369537 Bacteria 6501581
234 2867430685 2867428634 Bacteria 9590268
235 2867476036 2867475112 Bacteria 6909112
236 2869052912 2869048445 Bacteria 6875584
237 2869063961 2869061728 Bacteria 7112407
238 2869074807 2869068681 Bacteria 7205615
239 2877677768 2877676314 Bacteria 9512378
240 2880489756 2880489317 Bacteria 7096270
241 2880502833 2880495981 Bacteria 7340502
242 2902583507 2902582711 Bacteria 6187705
243 2912716055 2912715099 Bacteria 9460473
244 2912729005 2912723979 Bacteria 8557534
245 2919470933 2919468124 Bacteria 9133025
246 2929224625 2929219909 Bacteria 6984360
247 2929232433 2929226422 Bacteria 7248583
248 2946071266 2946064051 Bacteria 8957905
249 2946079102 2946072368 Bacteria 8999607
250 2947225479 2947224130 Bacteria 9938529
251 2954382549 2954380949 Bacteria 10050426
252 2954683655 2954682443 Bacteria 9862841
253 2954693350 2954691527 Bacteria 10720516
254 2954708443 2954701450 Bacteria 10834262
255 2954713056 2954711539 Bacteria 10867210
256 2954723016 2954721474 Bacteria 10456478
257 2954738814 2954731030 Bacteria 10243860
258 2954741925 2954740390 Bacteria 10229294
259 2954757673 2954749733 Bacteria 10366972
260 2954760902 2954759201 Bacteria 9358192
261 2990094016 2990088156 Bacteria 6657676
262 3006321685 3006321560 Bacteria 8247479
263 3006397459 3006393351 Bacteria 6615579
264 3006494772 3006493962 Bacteria 8825450
265 649814058 649633069 Bacteria 6962533
266 8003324101 8003314358 Bacteria 10575343
267 8003832513 8003830390 Bacteria 6541657
268 8003877780 8003870546 Bacteria 7396674
269 8008564204 8008558824 Bacteria 10610750
270 8008575918 8008574985 Bacteria 7815457
271 8023631440 8023623736 Bacteria 8593882
272 8047895063 8047893842 Bacteria 11723082
273 8048136285 8048127548 Bacteria 11053136
274 8048363985 8048356638 Bacteria 11044339
275 8048372090 8048369669 Bacteria 11666822
276 8048381024 8048379754 Bacteria 11877923
277 8054707839 8054704163 Bacteria 7247792
278 8054732716 8054727385 Bacteria 7558670
279 8054738009 8054734606 Bacteria 6947278
280 8055417540 8055412473 Bacteria 6257500
281 8056066392 8056060235 Bacteria 7259403
282 8056836056 8056829672 Bacteria 9045328
283 JGI25153J46596_10027277
284 rootH2_10186401
285 Ga0070668_100000573
286 Ga0070663_100003663
287 Ga0070685_10030450
288 Ga0068853_100028208
289 Ga0068857_100169079
290 Ga0068859_100156383
291 Ga0068862_100018067
292 Ga0081538_10001789
293 Ga0081538_10004566
294 Ga0081538_10047194
295 Ga0075368_10012274
296 Ga0075367_10005712
297 Ga0075367_10024184
298 Ga0097620_100156381
299 Ga0105251_10031342
300 Ga0111539_10058032
301 Ga0105246_10010904
302 Ga0183367_1001
303 Ga0209758_1003466
304 Ga0207647_10001329
305 Ga0207647_10025270
306 Ga0207668_10000819
307 Ga0207678_10004297
308 Ga0207674_10144722
309 Ga0307515_10000163
310 Ga0307515_10027391
311 Ga0307511_10000150
312 Ga0307511_10026328
313 Ga0307512_10010523
314 Ga0265340_10000537
315 Ga0307513_10000041
316 Ga0307513_10052023
317 Ga0307513_10122810
318 Ga0307509_10010645
319 Ga0307509_10016946
320 Ga0307508_10032037
321 Ga0307514_10001738
322 Ga0307416_100107107
323 Ga0307507_10004114
324 Ga0307507_10010394
325 Ga0307507_10036903
326 Ga0307510_10002647
327 Ga0307510_10057408
328 Ga0307510_10065045
329 Ga0395898_0018983
330 Ga0439436_0027938
331 Ga0439439_0003503
332 Ga0451791_1761287
333 Ga0451853_0288226
334 Ga0439448_0016399
335 Ga0439449_0000789
336 Ga0439449_0016505
337 Ga0439455_0000232
338 Ga0439457_000374
339 Ga0439457_001339
340 Ga0450903_000358
341 Ga0439458_0001121
342 Ga0466969_0026269
343 Ga0466972_0002890
344 Ga0466972_0041529
345 Ga0466965_0025216
346 Ga0466966_0014776
347 Ga0466961_0071233
348 Ga0466963_0008086
349 Ga0466963_0018210
350 Ga0466971_0002086
351 Ga0466971_0005787
352 Ga0466971_0033015
353 Ga0466970_0001147
354 Ga0466970_0003166
355 Ga0466970_0035076
356 Ga0466957_0003255
357 Ga0466959_0026207
358 Ga0466958_0003383
359 Ga0466958_0028039
360 Ga0466967_0087008
361 Ga0466967_0129657
362 Ga0495617_022194
363 Ga0495592_0010829
364 Ga0495592_0034463
365 Ga0495603_0005116
366 Ga0495603_0005205
367 Ga0495629_0006888
368 Ga0495629_0008116
369 Ga0495629_0018759
370 Ga0495629_0096234
371 Ga0495629_0134941
372 Ga0495651_0029446
373 Ga0495605_0015500
374 Ga0495662_0002269
375 Ga0495664_0001061
376 Ga0495664_0049012
377 Ga0495585_0003268
378 Ga0495606_0016139
379 Ga0495616_0006775
380 Ga0495618_0009224
381 Ga0495628_0015223
382 Ga0495628_0098484
383 Ga0495630_0017430
384 Ga0495631_0005367
385 Ga0495640_0010147
386 Ga0495609_0049619
387 Ga0495597_0014623
388 Ga0495645_0093904
389 Ga0495622_0010270
390 Ga0495622_0020912
391 Ga0495633_0024942
392 Ga0495668_0007182
393 Ga0495634_0000940
394 Ga0495634_0089900
395 Ga0495625_0037645
396 Ga0495635_0000362
397 Ga0495635_0074272
398 Ga0495588_0050519
399 Ga0495657_0012523
400 Ga0495646_0000248
401 Ga0495613_0000782
402 Ga0495613_0007252
403 Ga0495613_0143971
404 Ga0495624_0015165
405 Ga0495624_0040967
406 Ga0495649_0025388
407 Ga0495589_0017182
408 Ga0495589_0064521
409 Ga0495581_0035353
410 Ga0495604_0000808
411 Ga0495604_0070825
412 Ga0495676_0017298
413 Ga0495676_0040416
414 Ga0495676_0050562
415 Ga0495680_0042744
416 Ga0495687_002047
417 Ga0495675_0015383
418 Ga0495675_0048234
419 Ga0495675_0058678
420 Ga0495685_002839
421 Ga0495685_010155
422 Ga0495685_024196
423 Ga0495681_0000311
424 Ga0495686_0024119
425 Ga0495593_0001388
426 Ga0495614_0000889
427 Ga0495614_0050613
428 Ga0495626_0013756
429 Ga0495678_030366
430 Ga0501031_0113811
431 Ga0501032_0034778
432 Ga0501032_0150509
433 Ga0501033_0005550
434 Ga0501033_0005615
435 Ga0501033_0013157
436 Ga0501033_0065192
437 Ga0501034_0043754
438 Ga0501034_0166776
439 Ga0501034_0188636
440 Ga0501034_0230242
441 Ga0501034_0233526
442 Ga0501036_0000951
443 Ga0501036_0000952
444 Ga0501036_0021519
445 Ga0501037_0026380
446 Ga0501037_0075257
447 Ga0501038_0033280
448 Ga0501038_0055244
449 Ga0501038_0082097
450 Ga0501042_0035557
451 Ga0501043_0022632
452 Ga0501043_0023933
453 Ga0501047_0026108
454 Ga0501047_0063817
455 Ga0501047_0086187
456 Ga0501047_0127818
457 Ga0501048_0117139
458 Ga0501070_0002167
459 Ga0501071_0020024
460 Ga0501072_0011941
461 Ga0501035_0017342
462 Ga0501035_0025554
463 Ga0501044_0008984
464 Ga0501044_0015981
465 Ga0501044_0060588
466 Ga0501044_0126464
467 nmdc:mga06z11_17624_c1
468 Ga0500583_0043935
469 Ga0500560_001789
470 Ga0500568_0003516
471 Ga0500573_0010845
472 Ga0500573_0028719
473 Ga0500616_0000504
474 Ga0500616_0008582
475 2954680497
476 2501944937
477 2547412148
478 2585304049
479 2585312036
480 2616698994
481 2643826230
482 2644019811
483 2644180299
484 2644263811
485 2644438143
486 2644532207
487 2644631865
488 2772644271
489 2784591906
490 2785339811
491 2785373133
492 2786674905
493 2791916318
494 2793979775
495 2808845276
496 2808914974
497 2809235517
498 2812354437
499 2819746574
500 2852636060
501 2855676505
502 2855678572
503 2855684660
504 2856864414
505 2857290121
506 2858852087
507 2858871602
508 2858888657
509 2858888910
510 2858897495
511 2858905690
512 2862283100
513 2862295032
514 2862384382
515 2867374870
516 2867430685
517 2867476036
518 2869052912
519 2869063961
520 2869074807
521 2877677768
522 2880489756
523 2880502833
524 2902583507
525 2912716055
526 2912729005
527 2919470933
528 2929224625
529 2929232433
530 2946071266
531 2946079102
532 2947225479
533 2954382549
534 2954683655
535 2954693350
536 2954708443
537 2954713056
538 2954723016
539 2954738814
540 2954741925
541 2954757673
542 2954760902
543 2990094016
544 3006321685
545 3006397459
546 3006494772
547 649814058
548 8003324101
549 8003832513
550 8003877780
551 8008564204
552 8008575918
553 8023631440
554 8047895063
555 8048136285
556 8048363985
557 8048372090
558 8048381024
559 8054707839
560 8054732716
561 8054738009
562 8055417540
563 8056066392
564 8056836056

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01433

Peptidase_M1

Peptidase family M1 domain

314

475

0.89

PF17900

Peptidase_M1_N

Peptidase M1 N-terminal domain

69

239

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6a8z-assembly1.cif.gz_A crystal structure of m1 zinc metallopeptidase from deinococcus radiodurans 0.8931 33 469
6ifg-assembly2.cif.gz_B crystal structure of m1 zinc metallopeptidase e323a mutant bound to tyr-ser-ala substrate from deinococcus radiodurans 0.8904 33 469
6a8z-assembly2.cif.gz_B crystal structure of m1 zinc metallopeptidase from deinococcus radiodurans 0.8852 33 469
6ifg-assembly2.cif.gz_B crystal structure of m1 zinc metallopeptidase e323a mutant bound to tyr-ser-ala substrate from deinococcus radiodurans 0.8847 33 469
6iff-assembly2.cif.gz_B crystal structure of m1 zinc metallopeptidase e323a mutant from deinococcus radiodurans 0.8825 33 469
ID Description Score Start End Superfamily
af_Q9USX1_7_213_2.60.40.1730 Mainly Beta;Sandwich;Immunoglobulin-like;tricorn interacting facor f3 domain 0.8798 42 226 2.60.40.1730
1gw6A01 Mainly Beta;Sandwich;Immunoglobulin-like;tricorn interacting facor f3 domain 0.8686 47 225 2.60.40.1730
af_Q59KZ1_58_264_2.60.40.1730 Mainly Beta;Sandwich;Immunoglobulin-like;tricorn interacting facor f3 domain 0.8681 46 225 2.60.40.1730
af_Q55CY7_5_208_2.60.40.1730 Mainly Beta;Sandwich;Immunoglobulin-like;tricorn interacting facor f3 domain 0.8654 46 227 2.60.40.1730
af_Q9VFW9_54_261_2.60.40.1730 Mainly Beta;Sandwich;Immunoglobulin-like;tricorn interacting facor f3 domain 0.8595 46 224 2.60.40.1730
ID Description Score Start End GO Terms
AF-I0GYS6-F1-model_v4 Aminopeptidase N (EC 3.4.11.2) 0.9667 27 464 GO:0006508
GO:0008237
GO:0008270
AF-U5VUG6-F1-model_v4 Aminopeptidase N (EC 3.4.11.2) 0.9595 57 464 GO:0006508
GO:0008237
GO:0008270
AF-I0GYS6-F1-model_v4 Aminopeptidase N (EC 3.4.11.2) 0.958 27 464 GO:0006508
GO:0008237
GO:0008270
AF-U5VUG6-F1-model_v4 Aminopeptidase N (EC 3.4.11.2) 0.9548 57 464 GO:0006508
GO:0008237
GO:0008270
AF-A0A7Y5UEL1-F1-model_v4 deleted 0.9544 152 463

Map