F385131

General Info

Members Datasets Scaffolds Average Seq Length
282 185 564 372

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0072100|Ga0451576_0072100_1895_3271
Length 434
Sequence MNKKLRLIATAVVLPVAATGAWVLHRADAREVSSYRFATVERGSLKSTVSATGALSAVRTVQVGTQVSGQVSAIYVDFNDKVKKGELLARIDPTLQQQAVQDAQATLARVDAQNVQAKADYDRQKSLFDQKIITESEFQTSQTNFAVARANVRSAQIALDKARQNLAYTNIYSPIDGVIVERDVDVGQTVAASLSAPQLFLIANDLAQMQILASVDESDIGQVKEGQPVSFTVQSYANDMFNGTVKQVRLQSKTTDNVVNYTVVVGVDNPSGKLLPGMTATVAFTTGGADNVMTVSNSALRFRPTPEMLAQIKPDSTARGDSTSRRRWRDSSGTQGGNFAPSDSARAAFVARMRAGNGGQGXGQSFGGGNGAPRMRSNVATIYVVDSAGKLSAIRVRTGLSDGQKTEVQSPRLKEGMQVIVGVTNGETATGRGF

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
116 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
117 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
118 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
119 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
121 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
122 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
123 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
130 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
136 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
140 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
141 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
145 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
146 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
153 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
154 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
155 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
162 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
163 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
164 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
165 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
183 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
184 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
185 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.71
Nodule 0
Rhizoplane 0.71
Rhizosphere 95.74
Stem 0
Stem Tuber 0
Unclassified 1.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0072100 3300045051 Bacteria 3595
2 Ga0070658_10009863 3300005327 Bacteria 7674
3 Ga0070658_10049183 3300005327 Bacteria 3415
4 Ga0070658_10076354 3300005327 Bacteria 2748
5 Ga0070683_100000050 3300005329 Bacteria 90949
6 Ga0070683_100007015 3300005329 Bacteria 9483
7 Ga0070683_100032316 3300005329 Bacteria 4766
8 Ga0070683_100215054 3300005329 Bacteria 1826
9 Ga0070690_100076202 3300005330 Bacteria 2188
10 Ga0070670_100008265 3300005331 Bacteria 8862
11 Ga0068869_100172115 3300005334 Bacteria 1692
12 Ga0070680_100000074 3300005336 Bacteria 53742
13 Ga0070680_100080002 3300005336 Bacteria 2695
14 Ga0070682_100000003 3300005337 Bacteria 469319
15 Ga0070682_100033300 3300005337 Bacteria 3130
16 Ga0068868_100000270 3300005338 Bacteria 35160
17 Ga0068868_100002093 3300005338 Bacteria 13749
18 Ga0068868_100011071 3300005338 Bacteria 6559
19 Ga0068868_100118036 3300005338 Bacteria 2162
20 Ga0070660_100005640 3300005339 Bacteria 8672
21 Ga0070689_100001489 3300005340 Bacteria 14946
22 Ga0070689_100013736 3300005340 Bacteria 5866
23 Ga0070689_100030373 3300005340 Bacteria 4101
24 Ga0070687_100002123 3300005343 Bacteria 7331
25 Ga0070692_10012401 3300005345 Bacteria 3944
26 Ga0070668_100026789 3300005347 Bacteria 4375
27 Ga0070669_100004251 3300005353 Bacteria 10344
28 Ga0070669_100180246 3300005353 Bacteria 1652
29 Ga0070671_100030866 3300005355 Bacteria 4423
30 Ga0070659_100050892 3300005366 Bacteria 3256
31 Ga0070659_100114616 3300005366 Unclassified 2178
32 Ga0070714_100017368 3300005435 Bacteria 5828
33 Ga0070713_100020392 3300005436 Bacteria 5082
34 Ga0070701_10005118 3300005438 Bacteria 5387
35 Ga0070701_10007492 3300005438 Bacteria 4666
36 Ga0070700_100005114 3300005441 Bacteria 6921
37 Ga0070708_100004476 3300005445 Bacteria 10990
38 Ga0070708_100162045 3300005445 Bacteria 2084
39 Ga0070663_100011419 3300005455 Bacteria 5575
40 Ga0070663_100028974 3300005455 Bacteria 3777
41 Ga0070662_100004827 3300005457 Bacteria 8545
42 Ga0070681_10029211 3300005458 Bacteria 5535
43 Ga0070681_10323126 3300005458 Unclassified 1453
44 Ga0068867_100006180 3300005459 Bacteria 8480
45 Ga0068867_100043823 3300005459 Bacteria 3276
46 Ga0070698_100107680 3300005471 Bacteria 2755
47 Ga0070679_100002681 3300005530 Bacteria 16216
48 Ga0070679_100234658 3300005530 Bacteria 1793
49 Ga0070684_100003563 3300005535 Bacteria 11709
50 Ga0070684_100016402 3300005535 Bacteria 6054
51 Ga0070684_100104465 3300005535 Bacteria 2534
52 Ga0070684_100146838 3300005535 Bacteria 2135
53 Ga0070697_100017707 3300005536 Bacteria 5612
54 Ga0070672_100008811 3300005543 Bacteria 6927
55 Ga0070672_100044724 3300005543 Bacteria 3421
56 Ga0070672_100208269 3300005543 Unclassified 1637
57 Ga0070695_100180626 3300005545 Bacteria 1495
58 Ga0070704_100059421 3300005549 Bacteria 2728
59 Ga0070664_100013040 3300005564 Bacteria 6762
60 Ga0070664_100051294 3300005564 Bacteria 3493
61 Ga0068854_100035732 3300005578 Bacteria 3480
62 Ga0070702_100011646 3300005615 Bacteria 4380
63 Ga0068852_100012847 3300005616 Bacteria 6383
64 Ga0068852_100073134 3300005616 Bacteria 3015
65 Ga0068859_100063111 3300005617 Bacteria 3735
66 Ga0068864_100000013 3300005618 Bacteria 326235
67 Ga0068864_100092634 3300005618 Bacteria 2668
68 Ga0068861_100006846 3300005719 Bacteria 7784
69 Ga0068861_100038668 3300005719 Bacteria 3556
70 Ga0068863_100139758 3300005841 Bacteria 2314
71 Ga0068858_100006238 3300005842 Bacteria 11617
72 Ga0068860_100031499 3300005843 Bacteria 5098
73 Ga0068860_100089104 3300005843 Bacteria 2937
74 Ga0081455_10000039 3300005937 Bacteria 135506
75 Ga0070717_10000042 3300006028 Bacteria 109755
76 Ga0070712_100090539 3300006175 Bacteria 2239
77 Ga0075431_100231205 3300006847 Bacteria 1884
78 Ga0075434_100020452 3300006871 Bacteria 6422
79 Ga0068865_100004211 3300006881 Bacteria 8668
80 Ga0068865_100042157 3300006881 Bacteria 3111
81 Ga0097620_100063111 3300006931 Bacteria 3735
82 Ga0075435_100081287 3300007076 Bacteria 2662
83 Ga0105240_10061257 3300009093 Bacteria 4689
84 Ga0111539_10000007 3300009094 Bacteria 418059
85 Ga0111539_10356537 3300009094 Unclassified 1702
86 Ga0105245_10000006 3300009098 Bacteria 330960
87 Ga0105245_10000506 3300009098 Bacteria 35764
88 Ga0114129_10150592 3300009147 Bacteria 3184
89 Ga0105242_10021590 3300009176 Bacteria 5056
90 Ga0105248_10016291 3300009177 Bacteria 8183
91 Ga0105238_10000005 3300009551 Bacteria 372840
92 Ga0105249_10003817 3300009553 Bacteria 13006
93 Ga0105249_10005088 3300009553 Bacteria 11328
94 Ga0105249_10079095 3300009553 Bacteria 3052
95 Ga0105239_10004585 3300010375 Bacteria 16468
96 Ga0105239_10032587 3300010375 Bacteria 5726
97 Ga0157373_10007306 3300013100 Bacteria 8225
98 Ga0157373_10067326 3300013100 Bacteria 2532
99 Ga0157369_10000703 3300013105 Bacteria 43189
100 Ga0157369_10000866 3300013105 Bacteria 38603
101 Ga0157369_10050783 3300013105 Bacteria 4489
102 Ga0157369_10062891 3300013105 Bacteria 3999
103 Ga0157374_10000006 3300013296 Bacteria 640284
104 Ga0157378_10000335 3300013297 Bacteria 46123
105 Ga0157378_10000904 3300013297 Bacteria 27354
106 Ga0157378_10009293 3300013297 Bacteria 8564
107 Ga0157378_10176107 3300013297 Bacteria 2009
108 Ga0157378_10206022 3300013297 Bacteria 1863
109 Ga0163162_10006311 3300013306 Bacteria 11479
110 Ga0163162_10020491 3300013306 Bacteria 6499
111 Ga0157372_10001054 3300013307 Bacteria 30118
112 Ga0157372_10012672 3300013307 Bacteria 8984
113 Ga0157372_10101810 3300013307 Bacteria 3280
114 Ga0157372_10242098 3300013307 Bacteria 2093
115 Ga0157375_10000009 3300013308 Bacteria 366440
116 Ga0157375_10000030 3300013308 Bacteria 199141
117 Ga0157375_10000331 3300013308 Bacteria 42533
118 Ga0157375_10423163 3300013308 Bacteria 1498
119 Ga0163163_10017250 3300014325 Bacteria 6730
120 Ga0157380_10018663 3300014326 Bacteria 5153
121 Ga0157380_10019121 3300014326 Bacteria 5101
122 Ga0157380_10034590 3300014326 Bacteria 3898
123 Ga0157377_10000003 3300014745 Bacteria 435133
124 Ga0157377_10000070 3300014745 Bacteria 80262
125 Ga0157377_10008192 3300014745 Bacteria 5086
126 Ga0213873_10000001 3300021358 Bacteria 1657979
127 Ga0213876_10000002 3300021384 Bacteria 1168769
128 Ga0213876_10000028 3300021384 Bacteria 222108
129 Ga0213876_10008734 3300021384 Bacteria 5475
130 Ga0207697_10000898 3300025315 Bacteria 16842
131 Ga0207656_10036851 3300025321 Bacteria 2054
132 Ga0207642_10033308 3300025899 Bacteria 2179
133 Ga0207688_10052113 3300025901 Bacteria 2293
134 Ga0207645_10000447 3300025907 Bacteria 34363
135 Ga0207705_10000772 3300025909 Bacteria 26312
136 Ga0207684_10061980 3300025910 Bacteria 3176
137 Ga0207707_10094538 3300025912 Bacteria 2611
138 Ga0207693_10026651 3300025915 Bacteria 4573
139 Ga0207660_10000017 3300025917 Bacteria 75942
140 Ga0207660_10078915 3300025917 Bacteria 2414
141 Ga0207662_10002824 3300025918 Bacteria 8781
142 Ga0207649_10053574 3300025920 Bacteria 2508
143 Ga0207694_10000001 3300025924 Bacteria 4078485
144 Ga0207687_10000006 3300025927 Bacteria 641680
145 Ga0207687_10000914 3300025927 Bacteria 20106
146 Ga0207687_10001596 3300025927 Bacteria 15607
147 Ga0207690_10033915 3300025932 Bacteria 3285
148 Ga0207706_10000440 3300025933 Bacteria 44385
149 Ga0207670_10000984 3300025936 Bacteria 15057
150 Ga0207704_10017079 3300025938 Bacteria 3751
151 Ga0207665_10071405 3300025939 Bacteria 2370
152 Ga0207691_10000391 3300025940 Bacteria 43895
153 Ga0207691_10002366 3300025940 Bacteria 18473
154 Ga0207691_10069331 3300025940 Bacteria 3185
155 Ga0207689_10047901 3300025942 Bacteria 3526
156 Ga0207661_10000013 3300025944 Bacteria 348811
157 Ga0207661_10030156 3300025944 Bacteria 4174
158 Ga0207661_10118672 3300025944 Bacteria 2249
159 Ga0207679_10003534 3300025945 Bacteria 9676
160 Ga0207679_10006662 3300025945 Bacteria 7314
161 Ga0207667_10184387 3300025949 Bacteria 2143
162 Ga0207640_10015051 3300025981 Bacteria 4469
163 Ga0207677_10000032 3300026023 Bacteria 119113
164 Ga0207677_10000869 3300026023 Bacteria 17194
165 Ga0207703_10002505 3300026035 Bacteria 15892
166 Ga0207703_10025282 3300026035 Bacteria 4670
167 Ga0207678_10012784 3300026067 Bacteria 7371
168 Ga0207678_10030614 3300026067 Bacteria 4698
169 Ga0207708_10016828 3300026075 Bacteria 5506
170 Ga0207708_10027153 3300026075 Bacteria 4335
171 Ga0207641_10101703 3300026088 Bacteria 2533
172 Ga0207648_10006740 3300026089 Bacteria 11393
173 Ga0207676_10000030 3300026095 Bacteria 221663
174 Ga0207676_10246439 3300026095 Bacteria 1606
175 Ga0207674_10000530 3300026116 Bacteria 50056
176 Ga0207675_100000151 3300026118 Bacteria 60922
177 Ga0207675_100005960 3300026118 Bacteria 11613
178 Ga0207683_10094228 3300026121 Bacteria 2669
179 Ga0207698_10008630 3300026142 Bacteria 6455
180 Ga0207698_10034145 3300026142 Bacteria 3705
181 Ga0207428_10000008 3300027907 Bacteria 423201
182 Ga0268264_10061085 3300028381 Bacteria 3160
183 Ga0307515_10014062 3300028794 Bacteria 14889
184 Ga0307408_100000668 3300031548 Bacteria 28582
185 Ga0265314_10006446 3300031711 Bacteria 10389
186 Ga0307406_10001041 3300031901 Bacteria 15476
187 Ga0373926_0001136 3300035083 Bacteria 7914
188 Ga0373934_0000885 3300035086 Bacteria 10802
189 Ga0373934_0007897 3300035086 Unclassified 3959
190 Ga0373944_0004332 3300035089 Bacteria 3692
191 Ga0373932_0000476 3300035112 Bacteria 12299
192 Ga0373936_0088899 3300035113 Bacteria 1293
193 Ga0373945_0006838 3300035116 Bacteria 3686
194 Ga0373943_0013484 3300035170 Bacteria 3692
195 Ga0373946_0000198 3300035171 Bacteria 18492
196 Ga0373955_0028830 3300035172 Bacteria 2881
197 Ga0373955_0030701 3300035172 Bacteria 2809
198 Ga0373927_0007304 3300035695 Bacteria 7491
199 Ga0373933_0011208 3300035724 Bacteria 4933
200 Ga0373933_0026249 3300035724 Bacteria 3344
201 Ga0373947_0011890 3300035725 Bacteria 4986
202 Ga0373925_0008597 3300037068 Bacteria 7439
203 Ga0436365_0826484 3300039437 Bacteria 12946
204 Ga0436365_0828231 3300039437 Bacteria 3576
205 Ga0436365_1159326 3300039437 Bacteria 152569
206 Ga0436365_1236731 3300039437 Bacteria 89746
207 Ga0436362_0877575 3300039453 Bacteria 6217
208 Ga0436362_0984254 3300039453 Bacteria 405590
209 Ga0466960_0092280 3300044901 Bacteria 1546
210 Ga0466959_0015060 3300045049 Bacteria 5632
211 Ga0451576_0007411 3300045051 Bacteria 13126
212 Ga0466967_0177516 3300045976 Bacteria 2007
213 Ga0495603_0001158 3300046455 Bacteria 15356
214 Ga0495629_0005089 3300046459 Bacteria 9834
215 Ga0495651_0003674 3300046462 Bacteria 11749
216 Ga0495653_0017562 3300046463 Bacteria 5817
217 Ga0495653_0024382 3300046463 Bacteria 4876
218 Ga0495580_0064034 3300046472 Bacteria 2578
219 Ga0495582_0033947 3300046473 Bacteria 2805
220 Ga0495639_0004649 3300046475 Bacteria 5894
221 Ga0495664_0016004 3300046477 Bacteria 4271
222 Ga0495594_0011561 3300046499 Bacteria 4590
223 Ga0495594_0082619 3300046499 Bacteria 1795
224 Ga0495608_0016525 3300046511 Bacteria 5106
225 Ga0495608_0041307 3300046511 Bacteria 3087
226 Ga0495628_0017610 3300046516 Bacteria 5942
227 Ga0495632_0032751 3300046519 Bacteria 2675
228 Ga0495652_0000930 3300046529 Bacteria 33634
229 Ga0495652_0022723 3300046529 Bacteria 5565
230 Ga0495665_0000482 3300046531 Bacteria 20066
231 Ga0495665_0023529 3300046531 Bacteria 3309
232 Ga0495586_0028617 3300046535 Bacteria 2981
233 Ga0495587_0003204 3300046536 Bacteria 10933
234 Ga0495587_0011752 3300046536 Bacteria 5538
235 Ga0495645_0000213 3300046543 Bacteria 41703
236 Ga0495667_0000873 3300046559 Bacteria 19485
237 Ga0495667_0017547 3300046559 Bacteria 4834
238 Ga0495635_0001486 3300046663 Bacteria 15684
239 Ga0495588_0000941 3300046674 Bacteria 12699
240 Ga0495657_0025648 3300046675 Bacteria 4183
241 Ga0495599_0001152 3300046678 Bacteria 14982
242 Ga0495599_0013796 3300046678 Bacteria 4999
243 Ga0495623_0000171 3300046679 Bacteria 40554
244 Ga0495623_0014782 3300046679 Bacteria 5045
245 Ga0495658_0002658 3300046683 Bacteria 8990
246 Ga0495613_0007651 3300046689 Bacteria 8041
247 Ga0495581_0002718 3300047315 Bacteria 10074
248 Ga0495604_0005027 3300047317 Bacteria 10468
249 Ga0495604_0056752 3300047317 Bacteria 3012
250 Ga0495674_0018602 3300047319 Bacteria 6467
251 Ga0495675_0011547 3300047444 Bacteria 5545
252 Ga0495675_0016273 3300047444 Bacteria 4704
253 Ga0495684_0000583 3300047471 Bacteria 29477
254 Ga0495684_0002532 3300047471 Bacteria 14559
255 Ga0495593_0001615 3300047673 Bacteria 13327
256 Ga0495602_0021512 3300048088 Bacteria 6346
257 Ga0495602_0060482 3300048088 Bacteria 3300
258 Ga0495614_0000289 3300048089 Bacteria 19831
259 Ga0496109_0016708 3300048912 Bacteria 6420
260 Ga0496113_0159667 3300048916 Bacteria 1782
261 Ga0501033_0006713 3300049570 Bacteria 8991
262 Ga0501036_0041654 3300049572 Bacteria 3885
263 Ga0501038_0059493 3300049574 Bacteria 3273
264 Ga0501043_0026017 3300049579 Bacteria 4591
265 Ga0501043_0029304 3300049579 Bacteria 4323
266 Ga0501070_0007549 3300049586 Bacteria 9242
267 Ga0501073_0082207 3300049589 Bacteria 2240
268 Ga0501080_0080658 3300049742 Bacteria 3024
269 Ga0501035_0014447 3300049822 Bacteria 7287
270 Ga0501035_0063337 3300049822 Bacteria 3289
271 Ga0501044_0014069 3300049823 Bacteria 8641
272 Ga0501045_0104661 3300049824 Bacteria 2097
273 nmdc:mga09592_38708_c1 3300050508 Bacteria 4003
274 nmdc:mga06r32_9102_c1 3300050510 Bacteria 8950
275 nmdc:mga08y16_13_c2 3300050511 Bacteria 418063
276 nmdc:mga08y16_93667_c1 3300050511 Bacteria 3129
277 nmdc:mga0n895_1875_c1 3300050512 Bacteria 16066
278 nmdc:mga0n895_43703_c1 3300050512 Bacteria 4367
279 Ga0495655_0000036 3300053083 Bacteria 27380
280 Ga0495595_0013870 3300053084 Bacteria 3411
281 Ga0500556_0000333 3300053104 Bacteria 35192
282 Ga0500645_011072 3300053730 Bacteria 2958
283 Ga0451576_0072100
284 Ga0070658_10009863
285 Ga0070658_10049183
286 Ga0070658_10076354
287 Ga0070683_100000050
288 Ga0070683_100007015
289 Ga0070683_100032316
290 Ga0070683_100215054
291 Ga0070690_100076202
292 Ga0070670_100008265
293 Ga0068869_100172115
294 Ga0070680_100000074
295 Ga0070680_100080002
296 Ga0070682_100000003
297 Ga0070682_100033300
298 Ga0068868_100000270
299 Ga0068868_100002093
300 Ga0068868_100011071
301 Ga0068868_100118036
302 Ga0070660_100005640
303 Ga0070689_100001489
304 Ga0070689_100013736
305 Ga0070689_100030373
306 Ga0070687_100002123
307 Ga0070692_10012401
308 Ga0070668_100026789
309 Ga0070669_100004251
310 Ga0070669_100180246
311 Ga0070671_100030866
312 Ga0070659_100050892
313 Ga0070659_100114616
314 Ga0070714_100017368
315 Ga0070713_100020392
316 Ga0070701_10005118
317 Ga0070701_10007492
318 Ga0070700_100005114
319 Ga0070708_100004476
320 Ga0070708_100162045
321 Ga0070663_100011419
322 Ga0070663_100028974
323 Ga0070662_100004827
324 Ga0070681_10029211
325 Ga0070681_10323126
326 Ga0068867_100006180
327 Ga0068867_100043823
328 Ga0070698_100107680
329 Ga0070679_100002681
330 Ga0070679_100234658
331 Ga0070684_100003563
332 Ga0070684_100016402
333 Ga0070684_100104465
334 Ga0070684_100146838
335 Ga0070697_100017707
336 Ga0070672_100008811
337 Ga0070672_100044724
338 Ga0070672_100208269
339 Ga0070695_100180626
340 Ga0070704_100059421
341 Ga0070664_100013040
342 Ga0070664_100051294
343 Ga0068854_100035732
344 Ga0070702_100011646
345 Ga0068852_100012847
346 Ga0068852_100073134
347 Ga0068859_100063111
348 Ga0068864_100000013
349 Ga0068864_100092634
350 Ga0068861_100006846
351 Ga0068861_100038668
352 Ga0068863_100139758
353 Ga0068858_100006238
354 Ga0068860_100031499
355 Ga0068860_100089104
356 Ga0081455_10000039
357 Ga0070717_10000042
358 Ga0070712_100090539
359 Ga0075431_100231205
360 Ga0075434_100020452
361 Ga0068865_100004211
362 Ga0068865_100042157
363 Ga0097620_100063111
364 Ga0075435_100081287
365 Ga0105240_10061257
366 Ga0111539_10000007
367 Ga0111539_10356537
368 Ga0105245_10000006
369 Ga0105245_10000506
370 Ga0114129_10150592
371 Ga0105242_10021590
372 Ga0105248_10016291
373 Ga0105238_10000005
374 Ga0105249_10003817
375 Ga0105249_10005088
376 Ga0105249_10079095
377 Ga0105239_10004585
378 Ga0105239_10032587
379 Ga0157373_10007306
380 Ga0157373_10067326
381 Ga0157369_10000703
382 Ga0157369_10000866
383 Ga0157369_10050783
384 Ga0157369_10062891
385 Ga0157374_10000006
386 Ga0157378_10000335
387 Ga0157378_10000904
388 Ga0157378_10009293
389 Ga0157378_10176107
390 Ga0157378_10206022
391 Ga0163162_10006311
392 Ga0163162_10020491
393 Ga0157372_10001054
394 Ga0157372_10012672
395 Ga0157372_10101810
396 Ga0157372_10242098
397 Ga0157375_10000009
398 Ga0157375_10000030
399 Ga0157375_10000331
400 Ga0157375_10423163
401 Ga0163163_10017250
402 Ga0157380_10018663
403 Ga0157380_10019121
404 Ga0157380_10034590
405 Ga0157377_10000003
406 Ga0157377_10000070
407 Ga0157377_10008192
408 Ga0213873_10000001
409 Ga0213876_10000002
410 Ga0213876_10000028
411 Ga0213876_10008734
412 Ga0207697_10000898
413 Ga0207656_10036851
414 Ga0207642_10033308
415 Ga0207688_10052113
416 Ga0207645_10000447
417 Ga0207705_10000772
418 Ga0207684_10061980
419 Ga0207707_10094538
420 Ga0207693_10026651
421 Ga0207660_10000017
422 Ga0207660_10078915
423 Ga0207662_10002824
424 Ga0207649_10053574
425 Ga0207694_10000001
426 Ga0207687_10000006
427 Ga0207687_10000914
428 Ga0207687_10001596
429 Ga0207690_10033915
430 Ga0207706_10000440
431 Ga0207670_10000984
432 Ga0207704_10017079
433 Ga0207665_10071405
434 Ga0207691_10000391
435 Ga0207691_10002366
436 Ga0207691_10069331
437 Ga0207689_10047901
438 Ga0207661_10000013
439 Ga0207661_10030156
440 Ga0207661_10118672
441 Ga0207679_10003534
442 Ga0207679_10006662
443 Ga0207667_10184387
444 Ga0207640_10015051
445 Ga0207677_10000032
446 Ga0207677_10000869
447 Ga0207703_10002505
448 Ga0207703_10025282
449 Ga0207678_10012784
450 Ga0207678_10030614
451 Ga0207708_10016828
452 Ga0207708_10027153
453 Ga0207641_10101703
454 Ga0207648_10006740
455 Ga0207676_10000030
456 Ga0207676_10246439
457 Ga0207674_10000530
458 Ga0207675_100000151
459 Ga0207675_100005960
460 Ga0207683_10094228
461 Ga0207698_10008630
462 Ga0207698_10034145
463 Ga0207428_10000008
464 Ga0268264_10061085
465 Ga0307515_10014062
466 Ga0307408_100000668
467 Ga0265314_10006446
468 Ga0307406_10001041
469 Ga0373926_0001136
470 Ga0373934_0000885
471 Ga0373934_0007897
472 Ga0373944_0004332
473 Ga0373932_0000476
474 Ga0373936_0088899
475 Ga0373945_0006838
476 Ga0373943_0013484
477 Ga0373946_0000198
478 Ga0373955_0028830
479 Ga0373955_0030701
480 Ga0373927_0007304
481 Ga0373933_0011208
482 Ga0373933_0026249
483 Ga0373947_0011890
484 Ga0373925_0008597
485 Ga0436365_0826484
486 Ga0436365_0828231
487 Ga0436365_1159326
488 Ga0436365_1236731
489 Ga0436362_0877575
490 Ga0436362_0984254
491 Ga0466960_0092280
492 Ga0466959_0015060
493 Ga0451576_0007411
494 Ga0466967_0177516
495 Ga0495603_0001158
496 Ga0495629_0005089
497 Ga0495651_0003674
498 Ga0495653_0017562
499 Ga0495653_0024382
500 Ga0495580_0064034
501 Ga0495582_0033947
502 Ga0495639_0004649
503 Ga0495664_0016004
504 Ga0495594_0011561
505 Ga0495594_0082619
506 Ga0495608_0016525
507 Ga0495608_0041307
508 Ga0495628_0017610
509 Ga0495632_0032751
510 Ga0495652_0000930
511 Ga0495652_0022723
512 Ga0495665_0000482
513 Ga0495665_0023529
514 Ga0495586_0028617
515 Ga0495587_0003204
516 Ga0495587_0011752
517 Ga0495645_0000213
518 Ga0495667_0000873
519 Ga0495667_0017547
520 Ga0495635_0001486
521 Ga0495588_0000941
522 Ga0495657_0025648
523 Ga0495599_0001152
524 Ga0495599_0013796
525 Ga0495623_0000171
526 Ga0495623_0014782
527 Ga0495658_0002658
528 Ga0495613_0007651
529 Ga0495581_0002718
530 Ga0495604_0005027
531 Ga0495604_0056752
532 Ga0495674_0018602
533 Ga0495675_0011547
534 Ga0495675_0016273
535 Ga0495684_0000583
536 Ga0495684_0002532
537 Ga0495593_0001615
538 Ga0495602_0021512
539 Ga0495602_0060482
540 Ga0495614_0000289
541 Ga0496109_0016708
542 Ga0496113_0159667
543 Ga0501033_0006713
544 Ga0501036_0041654
545 Ga0501038_0059493
546 Ga0501043_0026017
547 Ga0501043_0029304
548 Ga0501070_0007549
549 Ga0501073_0082207
550 Ga0501080_0080658
551 Ga0501035_0014447
552 Ga0501035_0063337
553 Ga0501044_0014069
554 Ga0501045_0104661
555 nmdc:mga09592_38708_c1
556 nmdc:mga06r32_9102_c1
557 nmdc:mga08y16_13_c2
558 nmdc:mga08y16_93667_c1
559 nmdc:mga0n895_1875_c1
560 nmdc:mga0n895_43703_c1
561 Ga0495655_0000036
562 Ga0495595_0013870
563 Ga0500556_0000333
564 Ga0500645_011072

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13533

Biotin_lipoyl_2

Biotin-lipoyl like

58

108

0.95

PF13437

HlyD_3

HlyD family secretion protein

170

277

0.86

PF16576

HlyD_D23

Barrel-sandwich domain of CusB or HlyD membrane-fusion

44

280

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wta-assembly1.cif.gz_D cryo-em structure of human pyruvate carboxylase in apo state 0.8296 37 170
4qsh-assembly1.cif.gz_D crystal structure of l. monocytogenes pyruvate carboxylase in complex with cyclic-di-amp 0.8131 37 172
5ks8-assembly1.cif.gz_F crystal structure of two-subunit pyruvate carboxylase from methylobacillus flagellatus 0.7981 38 172
5ks8-assembly1.cif.gz_D crystal structure of two-subunit pyruvate carboxylase from methylobacillus flagellatus 0.7905 38 172
5gua-assembly1.cif.gz_A structure of biotin carboxyl carrier protein from pyrococcus horikoshi ot3 (delta n79) a138y mutant 0.7636 34 170
ID Description Score Start End Superfamily
3fppB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8806 34 173 2.40.50.100
3fppB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8593 34 173 2.40.50.100
1vf7H02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8582 34 172 2.40.50.100
1vf7H02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8474 34 172 2.40.50.100
af_Q54KE6_633_699_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8463 38 155 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A1F4RP84-F1-model_v4 RND efflux pump membrane fusion protein barrel-sandwich domain-containing protein 0.8293 172 272 GO:0030313
AF-A0A7X7NJ48-F1-model_v4 HlyD family efflux transporter periplasmic adaptor subunit 0.8146 19 257 GO:0030313
AF-A0A1F4RP84-F1-model_v4 RND efflux pump membrane fusion protein barrel-sandwich domain-containing protein 0.8146 172 272 GO:0030313
AF-M5UI80-F1-model_v4 Membrane-fusion protein 0.7938 19 256 GO:0030313
AF-A0A3A0FPX5-F1-model_v4 RND efflux pump membrane fusion protein barrel-sandwich domain-containing protein 0.7858 1 343 GO:0005886
GO:0015679
GO:0022857
GO:0030313
GO:0060003

Map