F385040

General Info

Members Datasets Scaffolds Average Seq Length
282 179 183 286

Family's Representative Sequence

Representative Sequence 3300031911|Ga0307412_10004976|Ga0307412_100049763
Length 314
Sequence MIIDPLLTEALPTDYRIAKYDTHNNERERVMRCSDKATLNHWYPLGTEKEIALGRTNTRLLGTELTIDRAIDGTVIVMADDNDQPLPIIRRFGLVWSTLGEPNGGLFALPEADEHDRRVVNCGAVMVRASGLRIIENFLDMAHFPFVHTDILGGEPHTEVMHYNAEIRRDVDEVWATNCQFFQPQAALSASSGIMTDYIYRVMTPFSTLLYKTCPSSANRLDVICLFVQPLAADRCIAHPVMFLIDDVSTTTELVHFQQLIFLQDRIILENQRPSLLPMEARAEIPTRADASSIAYRRWLKEKGITYGTTATAA

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
3 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
4 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
5 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
6 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
7 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
8 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
9 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
10 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
11 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
12 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
13 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
14 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
15 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
16 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
17 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
18 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
19 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
20 2643221599 Rhizobium sp. Root708 Isolate Unclassified
21 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
22 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
23 2643221719 Rhizobium sp. Root274 Isolate Unclassified
24 2738541293 Rhizobium sp. GV031 Isolate Unclassified
25 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
26 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
27 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
28 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
29 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
30 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
31 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
32 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
33 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
34 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
35 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
36 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
37 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
38 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
39 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
40 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
41 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
42 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
43 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
44 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
45 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
46 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
47 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
48 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
49 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
50 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
51 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
52 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
53 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
54 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
55 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
56 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
58 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
59 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
60 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
62 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
63 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
64 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
65 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
66 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
80 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
81 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
83 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
84 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
88 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
106 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
107 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
108 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
109 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
112 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
113 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
114 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
115 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
116 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
117 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
118 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
119 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
120 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
121 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
122 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
123 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
124 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
125 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
126 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
127 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
128 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
129 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
130 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
131 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
132 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
142 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
143 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
144 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
145 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
146 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
147 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
148 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
149 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
150 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
151 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
152 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
158 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
159 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
160 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
161 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
162 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
163 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
164 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
165 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
166 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
167 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
168 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
169 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
170 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
171 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
172 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
173 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
174 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
175 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
176 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
177 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
178 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
179 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 70.57
Metatranscriptomes 0
Isolates 29.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.86
Nodule 11.7
Rhizoplane 2.84
Rhizosphere 42.91
Stem 0
Stem Tuber 0
Unclassified 22.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000001 3300002773 Bacteria 224104
2 JGI25152J39213_1000015 3300002773 Bacteria 120605
3 JGI25150J39212_1000007 3300002774 Bacteria 253635
4 JGI25159J45721_1000143 3300002987 Bacteria 33010
5 JGI25151J46595_10000013 3300003187 Bacteria 253635
6 JGI25406J46586_10000825 3300003203 Bacteria 14578
7 JGI25153J46596_10002346 3300003215 Bacteria 10965
8 JGI25153J46596_10004064 3300003215 Bacteria 7968
9 JGI25160J50197_1000018 3300003354 Bacteria 239933
10 JGI25161J50226_1000088 3300003374 Bacteria 75140
11 JGI25404J52841_10004130 3300003659 Bacteria 2921
12 Ga0055543_1000004 3300004625 Bacteria 239971
13 Ga0065165_1000065 3300005262 Bacteria 174075
14 Ga0070670_100000552 3300005331 Bacteria 29736
15 Ga0070667_100149434 3300005367 Bacteria 2051
16 Ga0070714_100242044 3300005435 Bacteria 1665
17 Ga0070713_100025768 3300005436 Bacteria 4604
18 Ga0070713_100136831 3300005436 Bacteria 2165
19 Ga0070665_100004944 3300005548 Bacteria 13818
20 Ga0068852_100004429 3300005616 Bacteria 9925
21 Ga0081540_1000581 3300005983 Bacteria 35234
22 Ga0081540_1018740 3300005983 Bacteria 4233
23 Ga0081539_10000766 3300005985 Bacteria 63256
24 Ga0070717_10000144 3300006028 Bacteria 53223
25 Ga0075370_10078810 3300006353 Bacteria 1892
26 Ga0105240_10000012 3300009093 Bacteria 496639
27 Ga0105243_10016588 3300009148 Bacteria 5569
28 Ga0105237_10000054 3300009545 Bacteria 155063
29 Ga0099796_10000461 3300010159 Bacteria 6821
30 Ga0157373_10238966 3300013100 Bacteria 1284
31 Ga0157370_10000078 3300013104 Bacteria 107381
32 Ga0182005_1015162 3300015265 Bacteria 2151
33 Ga0207425_1000032 3300025245 Bacteria 253689
34 Ga0209677_100868 3300025253 Bacteria 14860
35 Ga0209129_1000056 3300025258 Bacteria 253689
36 Ga0209233_1000161 3300025261 Bacteria 158607
37 Ga0209673_1010659 3300025273 Bacteria 3856
38 Ga0209130_1000035 3300025284 Bacteria 296161
39 Ga0209025_1000090 3300025294 Bacteria 253689
40 Ga0209758_1000084 3300025297 Bacteria 256346
41 Ga0207426_1000017 3300025302 Bacteria 577913
42 Ga0207699_10070771 3300025906 Bacteria 2131
43 Ga0207695_10000097 3300025913 Bacteria 262517
44 Ga0207671_10000023 3300025914 Bacteria 274756
45 Ga0207650_10001446 3300025925 Bacteria 17109
46 Ga0207700_10062768 3300025928 Bacteria 2822
47 Ga0207658_10135956 3300025986 Bacteria 1982
48 Ga0207698_10158668 3300026142 Bacteria 1975
49 Ga0268265_10505109 3300028380 Bacteria 1140
50 Ga0307515_10005875 3300028794 Bacteria 24759
51 Ga0307515_10024458 3300028794 Bacteria 10523
52 Ga0265338_10003832 3300028800 Bacteria 20892
53 Ga0265338_10014294 3300028800 Bacteria 8848
54 Ga0265314_10129732 3300031711 Bacteria 1575
55 Ga0307406_10197684 3300031901 Bacteria 1477
56 Ga0307412_10004976 3300031911 Bacteria 7426
57 Ga0373927_0001738 3300035695 Bacteria 16275
58 Ga0373925_0003894 3300037068 Bacteria 11406
59 Ga0395905_0016072 3300037471 Bacteria 7115
60 Ga0439465_0066132 3300041413 Bacteria 1204
61 Ga0439465_0080730 3300041413 Bacteria 1102
62 Ga0495627_024876 3300046453 Bacteria 1947
63 Ga0495603_0206481 3300046455 Bacteria 1135
64 Ga0495629_0123267 3300046459 Bacteria 1805
65 Ga0495638_0000084 3300046460 Bacteria 153168
66 Ga0495651_0209940 3300046462 Bacteria 1356
67 Ga0495650_0046768 3300046471 Bacteria 1814
68 Ga0495605_0001482 3300046474 Bacteria 15305
69 Ga0495662_0015837 3300046476 Bacteria 3659
70 Ga0495585_0015926 3300046492 Bacteria 4362
71 Ga0495585_0027186 3300046492 Bacteria 3266
72 Ga0495585_0060915 3300046492 Bacteria 2076
73 Ga0495585_0100303 3300046492 Bacteria 1549
74 Ga0495607_0091342 3300046501 Bacteria 1649
75 Ga0495583_0000748 3300046506 Bacteria 41309
76 Ga0495583_0037229 3300046506 Bacteria 2308
77 Ga0495616_0048506 3300046513 Bacteria 2133
78 Ga0495628_0143041 3300046516 Bacteria 1825
79 Ga0495631_0001485 3300046518 Bacteria 14214
80 Ga0495631_0052714 3300046518 Bacteria 1776
81 Ga0495632_0000973 3300046519 Bacteria 25001
82 Ga0495632_0021528 3300046519 Bacteria 3473
83 Ga0495632_0050441 3300046519 Bacteria 2052
84 Ga0495654_0135090 3300046530 Bacteria 1104
85 Ga0495609_0034998 3300046538 Bacteria 2275
86 Ga0495633_0056331 3300046558 Bacteria 1847
87 Ga0495633_0086805 3300046558 Bacteria 1455
88 Ga0495656_0068185 3300046615 Bacteria 1572
89 Ga0495668_0003412 3300046616 Bacteria 11937
90 Ga0495668_0008035 3300046616 Bacteria 6643
91 Ga0495668_0125619 3300046616 Bacteria 1404
92 Ga0495611_0009043 3300046648 Bacteria 4213
93 Ga0495625_0002952 3300046660 Bacteria 17721
94 Ga0495625_0035282 3300046660 Bacteria 3687
95 Ga0495625_0126891 3300046660 Bacteria 1731
96 Ga0495588_0034189 3300046674 Bacteria 2572
97 Ga0495588_0134528 3300046674 Bacteria 1305
98 Ga0495670_0012843 3300046691 Bacteria 4118
99 Ga0495670_0121650 3300046691 Bacteria 1356
100 Ga0495600_0067807 3300046809 Bacteria 2332
101 Ga0495604_0076603 3300047317 Bacteria 2515
102 Ga0495672_0007628 3300047320 Bacteria 8117
103 Ga0495672_0007658 3300047320 Bacteria 8099
104 Ga0495672_0109541 3300047320 Bacteria 1484
105 Ga0495676_0078963 3300047321 Bacteria 2504
106 Ga0495673_0129451 3300047469 Bacteria 993
107 Ga0496100_0020887 3300048903 Bacteria 3934
108 Ga0496100_0021467 3300048903 Bacteria 3889
109 Ga0496101_0007620 3300048904 Bacteria 7032
110 Ga0496101_0090529 3300048904 Bacteria 2275
111 Ga0496102_0003296 3300048905 Bacteria 13689
112 Ga0496103_0037177 3300048906 Bacteria 2983
113 Ga0496113_0193449 3300048916 Bacteria 1615
114 Ga0496115_0164758 3300048918 Bacteria 1833
115 Ga0496116_0006324 3300048919 Bacteria 10773
116 Ga0496116_0011035 3300048919 Bacteria 7514
117 Ga0496116_0025844 3300048919 Bacteria 4306
118 Ga0496117_0001500 3300048920 Bacteria 33411
119 Ga0496117_0004109 3300048920 Bacteria 16311
120 Ga0496117_0034422 3300048920 Bacteria 3815
121 Ga0496118_0002016 3300048921 Bacteria 28725
122 Ga0496118_0004741 3300048921 Bacteria 15915
123 Ga0496118_0008221 3300048921 Bacteria 10828
124 Ga0496119_0029708 3300048922 Bacteria 3697
125 Ga0496119_0040981 3300048922 Bacteria 2955
126 Ga0496120_0007370 3300048923 Bacteria 8200
127 Ga0496121_0007927 3300048924 Bacteria 12695
128 Ga0496121_0022630 3300048924 Bacteria 6085
129 Ga0496121_0045685 3300048924 Bacteria 3761
130 Ga0496122_0021162 3300048925 Bacteria 5835
131 Ga0496122_0025412 3300048925 Bacteria 5142
132 Ga0496122_0062393 3300048925 Bacteria 2728
133 Ga0496122_0159491 3300048925 Bacteria 1378
134 Ga0496123_0003850 3300048926 Bacteria 16333
135 Ga0496123_0039933 3300048926 Bacteria 3277
136 Ga0496124_0000832 3300048927 Bacteria 50313
137 Ga0496124_0003345 3300048927 Bacteria 19735
138 Ga0496124_0017820 3300048927 Bacteria 6676
139 Ga0496124_0028306 3300048927 Bacteria 5015
140 Ga0496124_0127402 3300048927 Bacteria 2026
141 Ga0496125_0011789 3300048928 Bacteria 8711
142 Ga0496125_0037420 3300048928 Bacteria 4219
143 Ga0496125_0058452 3300048928 Bacteria 3115
144 Ga0496126_0006408 3300048929 Bacteria 13126
145 Ga0496126_0007684 3300048929 Bacteria 11768
146 Ga0496126_0012477 3300048929 Bacteria 8702
147 Ga0496126_0049385 3300048929 Bacteria 3841
148 Ga0496126_0055703 3300048929 Bacteria 3576
149 Ga0496126_0066429 3300048929 Bacteria 3224
150 Ga0496126_0139797 3300048929 Bacteria 2085
151 Ga0496126_0160215 3300048929 Bacteria 1923
152 Ga0496126_0161487 3300048929 Bacteria 1914
153 Ga0501033_0000026 3300049570 Bacteria 169104
154 Ga0501034_0683016 3300049571 Bacteria 926
155 Ga0501073_0042538 3300049589 Bacteria 3206
156 Ga0501280_001087 3300049776 Bacteria 5497
157 Ga0501035_0000208 3300049822 Bacteria 70678
158 nmdc:mga0sz30_14209_c1 3300050516 Bacteria 3129
159 Ga0500610_0004418 3300053079 Bacteria 5582
160 Ga0500578_0015916 3300053086 Bacteria 4829
161 Ga0500644_0006201 3300053088 Bacteria 3053
162 Ga0500646_0093026 3300053090 Bacteria 936
163 Ga0500651_0078566 3300053093 Bacteria 2046
164 Ga0500650_0031226 3300053098 Bacteria 2421
165 Ga0500562_011738 3300053108 Bacteria 2225
166 Ga0500562_020736 3300053108 Bacteria 1707
167 Ga0500562_021770 3300053108 Bacteria 1670
168 Ga0500569_000653 3300053109 Bacteria 5949
169 Ga0500594_0001556 3300053118 Bacteria 4992
170 Ga0500618_019788 3300053125 Bacteria 1654
171 Ga0500642_0070401 3300053130 Bacteria 1590
172 Ga0500642_0075102 3300053130 Bacteria 1544
173 Ga0500559_0006261 3300053136 Bacteria 5382
174 Ga0500559_0006306 3300053136 Bacteria 5358
175 Ga0500561_0051044 3300053137 Bacteria 1129
176 Ga0500568_0000178 3300053139 Bacteria 55390
177 Ga0500568_0000187 3300053139 Bacteria 54387
178 Ga0500590_001559 3300053148 Bacteria 9530
179 Ga0500616_0000872 3300053153 Bacteria 33370
180 Ga0500616_0001531 3300053153 Bacteria 21753
181 Ga0500622_0001245 3300053156 Bacteria 20825
182 Ga0500624_007103 3300053157 Bacteria 1531
183 Ga0500645_031019 3300053730 Bacteria 1607

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2885383462 2885385308 242
2 3300053137 Ga0500561_0051044 Ga0500561_0051044_37_861 274
3 iso_pu_bacteria 2861691609 2861694580 276
4 iso_pu_bacteria 2643221653 2644299384 279
5 iso_pu_bacteria 2643221719 2644657612 279
6 iso_pu_bacteria 2510461069 2510843152 280
7 iso_pu_bacteria 2738541293 2738803409 280
8 iso_pu_bacteria 2775507049 2776914737 280
9 iso_pu_bacteria 2818991272 2819243956 280
10 iso_pu_bacteria 2889790730 2889791176 280
11 iso_pu_bacteria 2899803654 2899806277 280
12 iso_pu_bacteria 2917554339 2917555695 280
13 iso_pu_bacteria 2937843397 2937847694 280
14 iso_pu_bacteria 2989776772 2989780491 280
15 iso_pu_bacteria 8005246636 8005248197 280
16 3300005435 Ga0070714_100242044 Ga0070714_1002420442 281
17 3300005436 Ga0070713_100136831 Ga0070713_1001368312 281
18 3300015265 Ga0182005_1015162 Ga0182005_10151622 281
19 3300025906 Ga0207699_10070771 Ga0207699_100707712 281
20 3300028800 Ga0265338_10003832 Ga0265338_1000383212 281
21 3300028800 Ga0265338_10014294 Ga0265338_100142942 281
22 3300048903 Ga0496100_0020887 Ga0496100_0020887_209_1054 281
23 3300048905 Ga0496102_0003296 Ga0496102_0003296_9029_9874 281
24 3300048906 Ga0496103_0037177 Ga0496103_0037177_441_1286 281
25 3300048920 Ga0496117_0001500 Ga0496117_0001500_17668_18513 281
26 3300048921 Ga0496118_0002016 Ga0496118_0002016_14863_15708 281
27 3300048923 Ga0496120_0007370 Ga0496120_0007370_6572_7417 281
28 3300048924 Ga0496121_0007927 Ga0496121_0007927_8125_8970 281
29 3300048927 Ga0496124_0000832 Ga0496124_0000832_36495_37340 281
30 3300048929 Ga0496126_0006408 Ga0496126_0006408_3668_4513 281
31 3300048929 Ga0496126_0139797 Ga0496126_0139797_1032_1877 281
32 iso_pu_bacteria 2508501128 2509146756 281
33 iso_pu_bacteria 2510917022 2511134873 281
34 iso_pu_bacteria 2513237098 2513672126 281
35 iso_pu_bacteria 2524023210 2524464622 281
36 iso_pu_bacteria 2582581307 2585275637 281
37 iso_pu_bacteria 2582581308 2585278170 281
38 iso_pu_bacteria 2582581315 2585325014 281
39 iso_pu_bacteria 2582581316 2585335886 281
40 iso_pu_bacteria 2582581866 2585396935 281
41 iso_pu_bacteria 2585427527 2585532170 281
42 iso_pu_bacteria 2585427530 2585552530 281
43 iso_pu_bacteria 2585427531 2585562507 281
44 iso_pu_bacteria 2585427608 2585899185 281
45 iso_pu_bacteria 2585427609 2585906326 281
46 iso_pu_bacteria 2585428125 2587981748 281
47 iso_pu_bacteria 2615840626 2616307688 281
48 iso_pu_bacteria 2818991453 2819640415 281
49 iso_pu_bacteria 2852387548 2852394767 281
50 iso_pu_bacteria 2885383462 2885385323 281
51 iso_pu_bacteria 2888350351 2888351299 281
52 iso_pu_bacteria 2889010040 2889013685 281
53 iso_pu_bacteria 2889016732 2889021598 281
54 iso_pu_bacteria 2903768456 2903771275 281
55 iso_pu_bacteria 2906354277 2906360405 281
56 iso_pu_bacteria 2922130491 2922133426 281
57 iso_pu_bacteria 2922185730 2922190767 281
58 iso_pu_bacteria 2958100919 2958105594 281
59 iso_pu_bacteria 2958172287 2958177355 281
60 iso_pu_bacteria 2965119406 2965125261 281
61 iso_pu_bacteria 2977971508 2977971897 281
62 iso_pu_bacteria 2979710463 2979716239 281
63 iso_pu_bacteria 2979742915 2979746922 281
64 iso_pu_bacteria 2987652177 2987658676 281
65 iso_pu_bacteria 8024486573 8024487504 281
66 iso_pu_bacteria 8046767195 8046771313 281
67 3300013100 Ga0157373_10238966 Ga0157373_102389662 282
68 iso_pu_bacteria 2861691609 2861694594 282
69 3300048929 Ga0496126_0066429 Ga0496126_0066429_1720_2571 283
70 iso_pu_bacteria 2888350351 2888351315 283
71 iso_pu_bacteria 2889010040 2889013701 283
72 iso_pu_bacteria 2889016732 2889021582 283
73 iso_pu_bacteria 2906354277 2906362230 283
74 iso_pu_bacteria 2922130491 2922136563 283
75 iso_pu_bacteria 2958100919 2958105610 283
76 iso_pu_bacteria 2958172287 2958177879 283
77 iso_pu_bacteria 2965119406 2965124584 283
78 iso_pu_bacteria 2977971508 2977971913 283
79 iso_pu_bacteria 2979710463 2979716223 283
80 iso_pu_bacteria 2987652177 2987654813 283
81 3300002773 JGI25152J39213_1000015 JGI25152J39213_100001536 284
82 3300002774 JGI25150J39212_1000007 JGI25150J39212_1000007160 284
83 3300003187 JGI25151J46595_10000013 JGI25151J46595_10000013161 284
84 3300003215 JGI25153J46596_10002346 JGI25153J46596_100023464 284
85 3300025245 Ga0207425_1000032 Ga0207425_1000032157 284
86 3300025258 Ga0209129_1000056 Ga0209129_1000056157 284
87 3300025294 Ga0209025_1000090 Ga0209025_1000090157 284
88 3300025297 Ga0209758_1000084 Ga0209758_1000084157 284
89 3300048904 Ga0496101_0090529 Ga0496101_0090529_168_1022 284
90 3300048916 Ga0496113_0193449 Ga0496113_0193449_334_1188 284
91 3300048918 Ga0496115_0164758 Ga0496115_0164758_649_1503 284
92 3300048919 Ga0496116_0006324 Ga0496116_0006324_8567_9421 284
93 3300048920 Ga0496117_0034422 Ga0496117_0034422_2378_3232 284
94 3300048921 Ga0496118_0008221 Ga0496118_0008221_1635_2489 284
95 3300048927 Ga0496124_0003345 Ga0496124_0003345_8692_9546 284
96 3300048928 Ga0496125_0011789 Ga0496125_0011789_2356_3210 284
97 3300048929 Ga0496126_0012477 Ga0496126_0012477_875_1729 284
98 3300048929 Ga0496126_0160215 Ga0496126_0160215_97_951 284
99 3300048929 Ga0496126_0161487 Ga0496126_0161487_93_947 284
100 3300049776 Ga0501280_001087 Ga0501280_001087_1281_2138 284
101 3300050516 nmdc:mga0sz30_14209_c1 nmdc:mga0sz30_14209_c1_1847_2701 284
102 iso_pu_bacteria 2508501128 2509146771 284
103 iso_pu_bacteria 2513237098 2513672111 284
104 iso_pu_bacteria 2524023210 2524464607 284
105 iso_pu_bacteria 2775507049 2776914753 284
106 iso_pu_bacteria 2889790730 2889791190 284
107 iso_pu_bacteria 2903768456 2903771290 284
108 3300002987 JGI25159J45721_1000143 JGI25159J45721_100014326 285
109 3300003203 JGI25406J46586_10000825 JGI25406J46586_1000082510 285
110 3300003354 JGI25160J50197_1000018 JGI25160J50197_100001822 285
111 3300003374 JGI25161J50226_1000088 JGI25161J50226_100008851 285
112 3300003659 JGI25404J52841_10004130 JGI25404J52841_100041302 285
113 3300004625 Ga0055543_1000004 Ga0055543_100000423 285
114 3300005262 Ga0065165_1000065 Ga0065165_100006523 285
115 3300005331 Ga0070670_100000552 Ga0070670_1000005522 285
116 3300005367 Ga0070667_100149434 Ga0070667_1001494342 285
117 3300005436 Ga0070713_100025768 Ga0070713_1000257682 285
118 3300005548 Ga0070665_100004944 Ga0070665_10000494410 285
119 3300005616 Ga0068852_100004429 Ga0068852_1000044293 285
120 3300005983 Ga0081540_1000581 Ga0081540_100058128 285
121 3300005983 Ga0081540_1018740 Ga0081540_10187402 285
122 3300005985 Ga0081539_10000766 Ga0081539_1000076631 285
123 3300006028 Ga0070717_10000144 Ga0070717_1000014434 285
124 3300006353 Ga0075370_10078810 Ga0075370_100788102 285
125 3300009093 Ga0105240_10000012 Ga0105240_10000012327 285
126 3300009148 Ga0105243_10016588 Ga0105243_100165884 285
127 3300009545 Ga0105237_10000054 Ga0105237_1000005493 285
128 3300010159 Ga0099796_10000461 Ga0099796_100004618 285
129 3300013104 Ga0157370_10000078 Ga0157370_1000007860 285
130 3300025253 Ga0209677_100868 Ga0209677_1008682 285
131 3300025261 Ga0209233_1000161 Ga0209233_1000161138 285
132 3300025284 Ga0209130_1000035 Ga0209130_1000035203 285
133 3300025302 Ga0207426_1000017 Ga0207426_1000017203 285
134 3300025913 Ga0207695_10000097 Ga0207695_10000097118 285
135 3300025914 Ga0207671_10000023 Ga0207671_10000023201 285
136 3300025925 Ga0207650_10001446 Ga0207650_100014463 285
137 3300025928 Ga0207700_10062768 Ga0207700_100627682 285
138 3300025986 Ga0207658_10135956 Ga0207658_101359562 285
139 3300026142 Ga0207698_10158668 Ga0207698_101586682 285
140 3300028794 Ga0307515_10005875 Ga0307515_1000587521 285
141 3300028794 Ga0307515_10024458 Ga0307515_100244585 285
142 3300031711 Ga0265314_10129732 Ga0265314_101297322 285
143 3300031911 Ga0307412_10004976 Ga0307412_100049763 285
144 3300035695 Ga0373927_0001738 Ga0373927_0001738_8045_8905 285
145 3300037068 Ga0373925_0003894 Ga0373925_0003894_1239_2099 285
146 3300037471 Ga0395905_0016072 Ga0395905_0016072_1628_2485 285
147 3300041413 Ga0439465_0066132 Ga0439465_0066132_266_1126 285
148 3300046459 Ga0495629_0123267 Ga0495629_0123267_549_1424 285
149 3300046460 Ga0495638_0000084 Ga0495638_0000084_22223_23098 285
150 3300046462 Ga0495651_0209940 Ga0495651_0209940_489_1346 285
151 3300046474 Ga0495605_0001482 Ga0495605_0001482_7013_7888 285
152 3300046476 Ga0495662_0015837 Ga0495662_0015837_2549_3424 285
153 3300046492 Ga0495585_0015926 Ga0495585_0015926_631_1512 285
154 3300046492 Ga0495585_0100303 Ga0495585_0100303_102_977 285
155 3300046506 Ga0495583_0000748 Ga0495583_0000748_6611_7492 285
156 3300046516 Ga0495628_0143041 Ga0495628_0143041_90_965 285
157 3300046518 Ga0495631_0001485 Ga0495631_0001485_11036_11911 285
158 3300046519 Ga0495632_0021528 Ga0495632_0021528_1001_1876 285
159 3300046538 Ga0495609_0034998 Ga0495609_0034998_731_1606 285
160 3300046616 Ga0495668_0003412 Ga0495668_0003412_1512_2387 285
161 3300046660 Ga0495625_0002952 Ga0495625_0002952_7914_8789 285
162 3300046660 Ga0495625_0126891 Ga0495625_0126891_690_1571 285
163 3300046674 Ga0495588_0034189 Ga0495588_0034189_1335_2210 285
164 3300046674 Ga0495588_0134528 Ga0495588_0134528_222_1103 285
165 3300046809 Ga0495600_0067807 Ga0495600_0067807_560_1435 285
166 3300047317 Ga0495604_0076603 Ga0495604_0076603_493_1368 285
167 3300047320 Ga0495672_0007628 Ga0495672_0007628_6271_7170 285
168 3300047320 Ga0495672_0007658 Ga0495672_0007658_5662_6537 285
169 3300047321 Ga0495676_0078963 Ga0495676_0078963_797_1672 285
170 3300047469 Ga0495673_0129451 Ga0495673_0129451_57_932 285
171 3300048919 Ga0496116_0025844 Ga0496116_0025844_704_1561 285
172 3300048922 Ga0496119_0029708 Ga0496119_0029708_125_982 285
173 3300048924 Ga0496121_0045685 Ga0496121_0045685_324_1223 285
174 3300048925 Ga0496122_0021162 Ga0496122_0021162_3508_4365 285
175 3300048925 Ga0496122_0025412 Ga0496122_0025412_2372_3229 285
176 3300048926 Ga0496123_0003850 Ga0496123_0003850_12992_13849 285
177 3300048927 Ga0496124_0028306 Ga0496124_0028306_1168_2025 285
178 3300048928 Ga0496125_0058452 Ga0496125_0058452_976_1833 285
179 3300048929 Ga0496126_0049385 Ga0496126_0049385_2179_3036 285
180 3300049570 Ga0501033_0000026 Ga0501033_0000026_122616_123473 285
181 3300049822 Ga0501035_0000208 Ga0501035_0000208_28321_29178 285
182 3300053079 Ga0500610_0004418 Ga0500610_0004418_1473_2348 285
183 3300053093 Ga0500651_0078566 Ga0500651_0078566_1087_1944 285
184 3300053098 Ga0500650_0031226 Ga0500650_0031226_664_1539 285
185 3300053108 Ga0500562_011738 Ga0500562_011738_506_1381 285
186 3300053118 Ga0500594_0001556 Ga0500594_0001556_2509_3384 285
187 3300053130 Ga0500642_0070401 Ga0500642_0070401_55_912 285
188 3300053130 Ga0500642_0075102 Ga0500642_0075102_141_1016 285
189 3300053136 Ga0500559_0006306 Ga0500559_0006306_2465_3334 285
190 3300053139 Ga0500568_0000178 Ga0500568_0000178_45609_46466 285
191 3300053139 Ga0500568_0000187 Ga0500568_0000187_22204_23079 285
192 3300053148 Ga0500590_001559 Ga0500590_001559_2694_3569 285
193 3300053153 Ga0500616_0000872 Ga0500616_0000872_1959_2834 285
194 3300053157 Ga0500624_007103 Ga0500624_007103_237_1094 285
195 3300053730 Ga0500645_031019 Ga0500645_031019_158_1033 285
196 iso_pu_bacteria 2582581299 2585229295 285
197 iso_pu_bacteria 2582581299 2585229310 285
198 iso_pu_bacteria 2582581304 2585255420 285
199 iso_pu_bacteria 2582581304 2585255435 285
200 iso_pu_bacteria 2643221599 2644003398 285
201 iso_pu_bacteria 2643221599 2644003413 285
202 iso_pu_bacteria 2643221634 2644196330 285
203 iso_pu_bacteria 2643221634 2644196345 285
204 iso_pu_bacteria 2738541293 2738803395 285
205 iso_pu_bacteria 2899803654 2899806263 285
206 iso_pu_bacteria 2937843397 2937845525 285
207 iso_pu_bacteria 2937843397 2937847679 285
208 iso_pu_bacteria 2939669807 2939671075 285
209 iso_pu_bacteria 3005452660 3005456795 285
210 iso_pu_bacteria 3005452660 3005456810 285
211 iso_pu_bacteria 2979742915 2979744840 286
212 3300041413 Ga0439465_0080730 Ga0439465_0080730_61_927 288
213 3300048925 Ga0496122_0159491 Ga0496122_0159491_158_1024 288
214 3300048929 Ga0496126_0007684 Ga0496126_0007684_3281_4147 288
215 3300049571 Ga0501034_0683016 Ga0501034_0683016_37_906 288
216 3300049589 Ga0501073_0042538 Ga0501073_0042538_2142_3011 288
217 3300053108 Ga0500562_021770 Ga0500562_021770_717_1583 288
218 3300053136 Ga0500559_0006261 Ga0500559_0006261_4129_4995 288
219 3300053139 Ga0500568_0000178 Ga0500568_0000178_28660_29526 288
220 3300002773 JGI25152J39213_1000001 JGI25152J39213_100000187 289
221 3300002773 JGI25152J39213_1000015 JGI25152J39213_100001521 289
222 3300002774 JGI25150J39212_1000007 JGI25150J39212_1000007145 289
223 3300003187 JGI25151J46595_10000013 JGI25151J46595_10000013146 289
224 3300003215 JGI25153J46596_10004064 JGI25153J46596_100040642 289
225 3300005331 Ga0070670_100000552 Ga0070670_10000055215 289
226 3300025245 Ga0207425_1000032 Ga0207425_1000032142 289
227 3300025258 Ga0209129_1000056 Ga0209129_1000056142 289
228 3300025273 Ga0209673_1010659 Ga0209673_10106592 289
229 3300025294 Ga0209025_1000090 Ga0209025_1000090142 289
230 3300025297 Ga0209758_1000084 Ga0209758_1000084142 289
231 3300025925 Ga0207650_10001446 Ga0207650_1000144617 289
232 3300028380 Ga0268265_10505109 Ga0268265_105051092 289
233 3300028794 Ga0307515_10005875 Ga0307515_100058756 289
234 3300031901 Ga0307406_10197684 Ga0307406_101976842 289
235 3300046453 Ga0495627_024876 Ga0495627_024876_333_1208 289
236 3300046455 Ga0495603_0206481 Ga0495603_0206481_85_960 289
237 3300046460 Ga0495638_0000084 Ga0495638_0000084_6180_7052 289
238 3300046471 Ga0495650_0046768 Ga0495650_0046768_489_1358 289
239 3300046492 Ga0495585_0027186 Ga0495585_0027186_1085_1960 289
240 3300046492 Ga0495585_0060915 Ga0495585_0060915_675_1550 289
241 3300046501 Ga0495607_0091342 Ga0495607_0091342_315_1187 289
242 3300046506 Ga0495583_0000748 Ga0495583_0000748_21442_22311 289
243 3300046506 Ga0495583_0037229 Ga0495583_0037229_172_1044 289
244 3300046513 Ga0495616_0048506 Ga0495616_0048506_438_1310 289
245 3300046518 Ga0495631_0052714 Ga0495631_0052714_318_1190 289
246 3300046519 Ga0495632_0000973 Ga0495632_0000973_17588_18457 289
247 3300046519 Ga0495632_0050441 Ga0495632_0050441_1103_1975 289
248 3300046530 Ga0495654_0135090 Ga0495654_0135090_192_1064 289
249 3300046558 Ga0495633_0056331 Ga0495633_0056331_535_1410 289
250 3300046558 Ga0495633_0086805 Ga0495633_0086805_86_961 289
251 3300046615 Ga0495656_0068185 Ga0495656_0068185_113_988 289
252 3300046616 Ga0495668_0008035 Ga0495668_0008035_2287_3159 289
253 3300046616 Ga0495668_0125619 Ga0495668_0125619_93_968 289
254 3300046648 Ga0495611_0009043 Ga0495611_0009043_822_1694 289
255 3300046660 Ga0495625_0035282 Ga0495625_0035282_2045_2917 289
256 3300046691 Ga0495670_0012843 Ga0495670_0012843_2613_3485 289
257 3300046691 Ga0495670_0121650 Ga0495670_0121650_54_929 289
258 3300047320 Ga0495672_0109541 Ga0495672_0109541_160_1032 289
259 3300048903 Ga0496100_0021467 Ga0496100_0021467_328_1197 289
260 3300048904 Ga0496101_0007620 Ga0496101_0007620_1562_2431 289
261 3300048919 Ga0496116_0011035 Ga0496116_0011035_1246_2115 289
262 3300048920 Ga0496117_0004109 Ga0496117_0004109_11165_12034 289
263 3300048921 Ga0496118_0004741 Ga0496118_0004741_3192_4061 289
264 3300048922 Ga0496119_0040981 Ga0496119_0040981_955_1824 289
265 3300048924 Ga0496121_0022630 Ga0496121_0022630_2580_3449 289
266 3300048925 Ga0496122_0062393 Ga0496122_0062393_616_1485 289
267 3300048926 Ga0496123_0039933 Ga0496123_0039933_1765_2634 289
268 3300048927 Ga0496124_0017820 Ga0496124_0017820_5127_5996 289
269 3300048927 Ga0496124_0127402 Ga0496124_0127402_616_1485 289
270 3300048928 Ga0496125_0037420 Ga0496125_0037420_2681_3550 289
271 3300048929 Ga0496126_0055703 Ga0496126_0055703_146_1030 289
272 3300049570 Ga0501033_0000026 Ga0501033_0000026_137423_138292 289
273 3300049822 Ga0501035_0000208 Ga0501035_0000208_43128_43997 289
274 3300053086 Ga0500578_0015916 Ga0500578_0015916_484_1356 289
275 3300053088 Ga0500644_0006201 Ga0500644_0006201_1245_2114 289
276 3300053090 Ga0500646_0093026 Ga0500646_0093026_25_897 289
277 3300053108 Ga0500562_020736 Ga0500562_020736_41_913 289
278 3300053109 Ga0500569_000653 Ga0500569_000653_2066_2938 289
279 3300053125 Ga0500618_019788 Ga0500618_019788_360_1229 289
280 3300053139 Ga0500568_0000187 Ga0500568_0000187_6160_7032 289
281 3300053153 Ga0500616_0001531 Ga0500616_0001531_17371_18243 289
282 3300053156 Ga0500622_0001245 Ga0500622_0001245_9471_10340 289

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19112

VanA_C

Vanillate O-demethylase oxygenase C-terminal domain

127

304

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7szh-assembly1.cif.gz_B structure of the rieske non-heme iron oxygenase sxtt with beta-saxitoxinol bound 0.8682 3 284
6wnb-assembly1.cif.gz_B structure of the rieske non-heme iron oxygenase sxtt with dideoxysaxitoxin bound 0.8514 3 284
7szh-assembly1.cif.gz_A structure of the rieske non-heme iron oxygenase sxtt with beta-saxitoxinol bound 0.8514 4 284
6wnd-assembly1.cif.gz_C-3 structure of the rieske non-heme iron oxygenase gxta with dideoxysaxitoxin bound 0.8501 4 284
7szh-assembly1.cif.gz_B structure of the rieske non-heme iron oxygenase sxtt with beta-saxitoxinol bound 0.8453 3 284
ID Description Score Start End Superfamily
3gobA01 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8003 10 77 2.102.10.10
2ckfA02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.7917 11 75 2.102.10.10
af_Q2FVL9_1_103_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.7855 12 72 2.102.10.10
2xrxU02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.7831 12 75 2.102.10.10
af_Q6DHJ3_118_252_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.7491 11 87 2.102.10.10
ID Description Score Start End GO Terms
AF-A0A2N3PYK0-F1-model_v4 (2Fe-2S)-binding protein 0.947 3 289 GO:0016491
AF-A0A2N3PYK0-F1-model_v4 (2Fe-2S)-binding protein 0.9405 3 289 GO:0016491
AF-A0A529M2I0-F1-model_v4 Aromatic ring-hydroxylating dioxygenase subunit alpha 0.9378 125 285 GO:0051213
AF-A0A2S5TRB0-F1-model_v4 deleted 0.9361 139 289
AF-A0A529WP52-F1-model_v4 Aromatic ring-hydroxylating dioxygenase subunit alpha 0.9354 3 86 GO:0051213
GO:0051537

Feature Viewer

pLDDT pTM Quality
87.91 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map