F384716

General Info

Members Datasets Scaffolds Average Seq Length
282 146 564 72

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100425654|Ga0070683_1004256542
Length 72
Sequence MTEIHVIVTGPEEAYDNEAEFWRANEMLGVTVLHEGRLHLRIDPRADGSPWLADVTSLAHALVEAQERLAAY

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
102 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
103 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
104 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
111 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
112 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
113 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
114 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
115 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
116 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
117 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
121 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
127 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
128 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
129 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
130 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
131 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
146 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 11.35
Rhizosphere 86.88
Stem 0
Stem Tuber 0
Unclassified 6.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100425654 3300005329 Bacteria 1266
2 Ga0070682_100176299 3300005337 Bacteria 1489
3 Ga0068868_100236989 3300005338 Bacteria 1532
4 Ga0068868_100272393 3300005338 Bacteria 1430
5 Ga0068868_101201138 3300005338 Bacteria 701
6 Ga0068868_101295359 3300005338 Bacteria 677
7 Ga0070661_101636954 3300005344 Unclassified 545
8 Ga0070661_101718763 3300005344 Bacteria 532
9 Ga0070692_10335383 3300005345 Bacteria 935
10 Ga0070668_100327598 3300005347 Bacteria 1291
11 Ga0070668_101078319 3300005347 Bacteria 724
12 Ga0070669_101150985 3300005353 Bacteria 669
13 Ga0070675_101067535 3300005354 Bacteria 742
14 Ga0070671_101124981 3300005355 Unclassified 690
15 Ga0070671_101420567 3300005355 Bacteria 613
16 Ga0070671_101469442 3300005355 Bacteria 603
17 Ga0070671_102128822 3300005355 Bacteria 500
18 Ga0070674_101697857 3300005356 Unclassified 571
19 Ga0070674_102178880 3300005356 Unclassified 506
20 Ga0070659_100007682 3300005366 Bacteria 7843
21 Ga0070659_101193057 3300005366 Bacteria 673
22 Ga0070667_101025239 3300005367 Bacteria 770
23 Ga0070714_100035764 3300005435 Bacteria 4163
24 Ga0070713_100194613 3300005436 Bacteria 1828
25 Ga0070713_101665943 3300005436 Bacteria 619
26 Ga0070711_101398966 3300005439 Unclassified 609
27 Ga0070700_100187815 3300005441 Bacteria 1443
28 Ga0070700_101207945 3300005441 Bacteria 632
29 Ga0070663_101539786 3300005455 Bacteria 592
30 Ga0068867_100983382 3300005459 Bacteria 764
31 Ga0068867_101194588 3300005459 Unclassified 698
32 Ga0068867_102339496 3300005459 Bacteria 508
33 Ga0070684_100749322 3300005535 Bacteria 912
34 Ga0070672_100347736 3300005543 Bacteria 1263
35 Ga0070672_101058251 3300005543 Bacteria 720
36 Ga0070693_100829510 3300005547 Bacteria 687
37 Ga0070665_101348423 3300005548 Bacteria 723
38 Ga0070704_100240917 3300005549 Bacteria 1480
39 Ga0070664_100276811 3300005564 Bacteria 1513
40 Ga0070664_100887855 3300005564 Bacteria 835
41 Ga0068857_100331943 3300005577 Bacteria 1406
42 Ga0068857_101088040 3300005577 Bacteria 772
43 Ga0068854_100283614 3300005578 Bacteria 1334
44 Ga0070702_100157084 3300005615 Bacteria 1466
45 Ga0070702_100258408 3300005615 Bacteria 1184
46 Ga0068852_100273570 3300005616 Bacteria 1626
47 Ga0068852_100493988 3300005616 Bacteria 1218
48 Ga0068852_101425339 3300005616 Bacteria 715
49 Ga0068859_100340212 3300005617 Bacteria 1595
50 Ga0068859_100923402 3300005617 Bacteria 957
51 Ga0068864_100097410 3300005618 Bacteria 2604
52 Ga0068864_101173113 3300005618 Bacteria 766
53 Ga0068864_102442662 3300005618 Bacteria 529
54 Ga0068866_10098067 3300005718 Bacteria 1611
55 Ga0068861_100188144 3300005719 Bacteria 1724
56 Ga0068861_100342648 3300005719 Bacteria 1308
57 Ga0068851_11120997 3300005834 Unclassified 500
58 Ga0068870_10112619 3300005840 Bacteria 1556
59 Ga0068858_102041196 3300005842 Bacteria 567
60 Ga0068862_100532853 3300005844 Bacteria 1119
61 Ga0081455_10005421 3300005937 Bacteria 13993
62 Ga0081539_10084236 3300005985 Bacteria 1662
63 Ga0070717_10017026 3300006028 Bacteria 5646
64 Ga0070717_12028640 3300006028 Bacteria 518
65 Ga0068865_100489489 3300006881 Bacteria 1023
66 Ga0068865_100550107 3300006881 Bacteria 969
67 Ga0068865_101436787 3300006881 Bacteria 617
68 Ga0097620_100340218 3300006931 Bacteria 1595
69 Ga0097620_100923602 3300006931 Bacteria 957
70 Ga0105240_10628964 3300009093 Bacteria 1179
71 Ga0111539_12136881 3300009094 Bacteria 650
72 Ga0105245_10187280 3300009098 Bacteria 1980
73 Ga0105245_10615531 3300009098 Bacteria 1114
74 Ga0105245_10644605 3300009098 Bacteria 1089
75 Ga0105245_10899432 3300009098 Bacteria 927
76 Ga0105245_11495474 3300009098 Bacteria 726
77 Ga0105247_10089506 3300009101 Bacteria 1951
78 Ga0105243_10392427 3300009148 Bacteria 1287
79 Ga0105243_10614997 3300009148 Bacteria 1048
80 Ga0105243_12235607 3300009148 Bacteria 584
81 Ga0105242_11188248 3300009176 Bacteria 781
82 Ga0105248_11739905 3300009177 Bacteria 707
83 Ga0105238_11822003 3300009551 Bacteria 641
84 Ga0105249_10602905 3300009553 Bacteria 1153
85 Ga0105239_10636551 3300010375 Bacteria 1218
86 Ga0105246_10630730 3300011119 Bacteria 930
87 Ga0157378_12991510 3300013297 Bacteria 524
88 Ga0163162_10269374 3300013306 Bacteria 1835
89 Ga0163162_11136284 3300013306 Bacteria 886
90 Ga0157372_11757633 3300013307 Bacteria 713
91 Ga0157375_10441344 3300013308 Bacteria 1467
92 Ga0157375_11087715 3300013308 Bacteria 935
93 Ga0157375_12357278 3300013308 Bacteria 635
94 Ga0163163_12419877 3300014325 Bacteria 583
95 Ga0157380_10997107 3300014326 Bacteria 871
96 Ga0157380_11522913 3300014326 Bacteria 722
97 Ga0157377_10256807 3300014745 Bacteria 1135
98 Ga0157377_10411210 3300014745 Bacteria 924
99 Ga0207656_10419506 3300025321 Bacteria 674
100 Ga0207642_10182232 3300025899 Bacteria 1145
101 Ga0207642_10216158 3300025899 Bacteria 1068
102 Ga0207643_10137556 3300025908 Bacteria 1457
103 Ga0207649_10128271 3300025920 Bacteria 1719
104 Ga0207659_11032789 3300025926 Bacteria 707
105 Ga0207659_11198197 3300025926 Bacteria 653
106 Ga0207687_11188267 3300025927 Unclassified 655
107 Ga0207687_11287669 3300025927 Bacteria 628
108 Ga0207700_10409021 3300025928 Bacteria 1190
109 Ga0207700_11051690 3300025928 Bacteria 728
110 Ga0207664_10050166 3300025929 Bacteria 3290
111 Ga0207664_10100154 3300025929 Bacteria 2392
112 Ga0207644_10312886 3300025931 Bacteria 1268
113 Ga0207644_11832193 3300025931 Bacteria 508
114 Ga0207690_10234198 3300025932 Bacteria 1411
115 Ga0207690_10579414 3300025932 Bacteria 914
116 Ga0207690_11181940 3300025932 Bacteria 638
117 Ga0207706_10910134 3300025933 Bacteria 743
118 Ga0207686_11783600 3300025934 Bacteria 509
119 Ga0207709_10300935 3300025935 Bacteria 1192
120 Ga0207709_11167973 3300025935 Bacteria 634
121 Ga0207670_10371483 3300025936 Bacteria 1137
122 Ga0207669_11392719 3300025937 Unclassified 597
123 Ga0207704_10238154 3300025938 Bacteria 1358
124 Ga0207704_10600135 3300025938 Bacteria 901
125 Ga0207691_10143446 3300025940 Bacteria 2103
126 Ga0207691_10974603 3300025940 Bacteria 708
127 Ga0207661_10055257 3300025944 Bacteria 3184
128 Ga0207661_10570999 3300025944 Bacteria 1037
129 Ga0207661_10970859 3300025944 Bacteria 783
130 Ga0207679_10207687 3300025945 Bacteria 1640
131 Ga0207679_10866497 3300025945 Bacteria 825
132 Ga0207679_12139803 3300025945 Bacteria 508
133 Ga0207667_11203033 3300025949 Bacteria 737
134 Ga0207712_10381968 3300025961 Bacteria 1179
135 Ga0207668_10245679 3300025972 Bacteria 1451
136 Ga0207668_11140330 3300025972 Bacteria 700
137 Ga0207640_10299824 3300025981 Bacteria 1271
138 Ga0207677_11399187 3300026023 Bacteria 644
139 Ga0207677_11581596 3300026023 Bacteria 607
140 Ga0207677_11735244 3300026023 Bacteria 579
141 Ga0207708_10076731 3300026075 Bacteria 2564
142 Ga0207708_10079600 3300026075 Bacteria 2517
143 Ga0207648_10561947 3300026089 Bacteria 1049
144 Ga0207648_10648797 3300026089 Bacteria 975
145 Ga0207648_10838828 3300026089 Bacteria 857
146 Ga0207676_10305231 3300026095 Unclassified 1455
147 Ga0207676_11063053 3300026095 Bacteria 799
148 Ga0207676_11875086 3300026095 Bacteria 598
149 Ga0207674_10307341 3300026116 Bacteria 1535
150 Ga0207674_10871401 3300026116 Bacteria 868
151 Ga0207675_100363553 3300026118 Bacteria 1420
152 Ga0207675_100382419 3300026118 Unclassified 1384
153 Ga0207698_10560381 3300026142 Bacteria 1121
154 Ga0207698_10568552 3300026142 Bacteria 1114
155 Ga0207698_11338899 3300026142 Bacteria 731
156 Ga0268265_10806095 3300028380 Bacteria 916
157 Ga0268264_11414320 3300028381 Bacteria 706
158 Ga0307405_10736167 3300031731 Bacteria 820
159 Ga0307413_10043185 3300031824 Bacteria 2655
160 Ga0307413_10397961 3300031824 Bacteria 1078
161 Ga0307410_10656968 3300031852 Bacteria 880
162 Ga0307406_10070933 3300031901 Bacteria 2282
163 Ga0307406_10997349 3300031901 Bacteria 718
164 Ga0307407_10046450 3300031903 Bacteria 2459
165 Ga0307412_11179708 3300031911 Bacteria 685
166 Ga0307409_100285367 3300031995 Bacteria 1528
167 Ga0307409_101415523 3300031995 Bacteria 722
168 Ga0307416_100132704 3300032002 Bacteria 2246
169 Ga0307416_100820447 3300032002 Bacteria 1027
170 Ga0307416_100994960 3300032002 Bacteria 941
171 Ga0307416_103582534 3300032002 Bacteria 520
172 Ga0307415_100012426 3300032126 Bacteria 4923
173 Ga0307415_100147340 3300032126 Bacteria 1807
174 Ga0307415_100350587 3300032126 Bacteria 1242
175 Ga0307415_100683774 3300032126 Bacteria 924
176 Ga0307415_101886412 3300032126 Bacteria 580
177 Ga0373943_0734848 3300035170 Bacteria 586
178 Ga0373931_1104126 3300035691 Bacteria 540
179 Ga0373935_0282583 3300035692 Unclassified 1169
180 Ga0373925_0096996 3300037068 Bacteria 2261
181 Ga0395899_0286939 3300037312 Bacteria 1118
182 Ga0395900_0093947 3300037418 Bacteria 3081
183 Ga0395900_0322280 3300037418 Bacteria 1525
184 Ga0395900_0501818 3300037418 Bacteria 1164
185 Ga0395900_1338458 3300037418 Unclassified 630
186 Ga0395898_0013389 3300037466 Bacteria 8448
187 Ga0395898_0044956 3300037466 Bacteria 4342
188 Ga0395898_0653293 3300037466 Bacteria 994
189 Ga0395898_0672697 3300037466 Bacteria 977
190 Ga0395898_0968013 3300037466 Bacteria 788
191 Ga0395898_1396775 3300037466 Bacteria 628
192 Ga0395898_1676308 3300037466 Bacteria 559
193 Ga0395905_0095106 3300037471 Bacteria 2796
194 Ga0395905_0851193 3300037471 Bacteria 815
195 Ga0395905_1046556 3300037471 Bacteria 719
196 Ga0395901_0198137 3300038443 Bacteria 2105
197 Ga0395901_0198832 3300038443 Bacteria 2101
198 Ga0395901_0209865 3300038443 Bacteria 2039
199 Ga0395901_0225960 3300038443 Bacteria 1955
200 Ga0395901_0552280 3300038443 Bacteria 1167
201 Ga0395901_0710413 3300038443 Unclassified 1002
202 Ga0395901_0770969 3300038443 Bacteria 953
203 Ga0395901_0886677 3300038443 Bacteria 875
204 Ga0395901_1151419 3300038443 Bacteria 744
205 Ga0395901_1697793 3300038443 Bacteria 583
206 Ga0395901_2101852 3300038443 Bacteria 510
207 Ga0451795_0296383 3300041456 Bacteria 627
208 Ga0451835_0600955 3300041492 Bacteria 594
209 Ga0451837_1737095 3300041494 Bacteria 707
210 Ga0451851_1049092 3300041507 Bacteria 595
211 Ga0451853_2354465 3300041512 Bacteria 829
212 Ga0439448_0271419 3300042005 Bacteria 600
213 Ga0450905_028103 3300042142 Bacteria 857
214 Ga0439458_0054431 3300042157 Bacteria 991
215 Ga0466966_0430736 3300044684 Bacteria 793
216 Ga0466963_0013546 3300044694 Bacteria 5008
217 Ga0466963_0132234 3300044694 Bacteria 1724
218 Ga0466964_0206918 3300044706 Bacteria 945
219 Ga0466964_0224426 3300044706 Bacteria 914
220 Ga0466968_0652461 3300044735 Bacteria 534
221 Ga0466968_0667120 3300044735 Bacteria 529
222 Ga0466957_0693394 3300044842 Bacteria 718
223 Ga0466957_1358447 3300044842 Bacteria 517
224 Ga0466960_0052083 3300044901 Bacteria 1979
225 Ga0466967_0023020 3300045976 Bacteria 5097
226 Ga0466967_0072528 3300045976 Bacteria 3086
227 Ga0466967_0207809 3300045976 Bacteria 1856
228 Ga0466967_0252294 3300045976 Bacteria 1686
229 Ga0466967_0351562 3300045976 Bacteria 1427
230 Ga0466967_0467893 3300045976 Bacteria 1234
231 Ga0466967_0496316 3300045976 Bacteria 1197
232 Ga0466967_0652185 3300045976 Bacteria 1041
233 Ga0466967_0954699 3300045976 Bacteria 853
234 Ga0466967_1014664 3300045976 Unclassified 826
235 Ga0466967_1140123 3300045976 Bacteria 777
236 Ga0466967_1707946 3300045976 Bacteria 627
237 Ga0466967_1811597 3300045976 Bacteria 607
238 Ga0466967_1997290 3300045976 Bacteria 577
239 Ga0466967_2031244 3300045976 Bacteria 571
240 Ga0495603_0827761 3300046455 Bacteria 527
241 Ga0495629_0097783 3300046459 Bacteria 2048
242 Ga0495641_0100016 3300046461 Bacteria 1294
243 Ga0495641_0113133 3300046461 Bacteria 1211
244 Ga0495582_0172880 3300046473 Bacteria 1230
245 Ga0495582_0446167 3300046473 Bacteria 747
246 Ga0495647_0302680 3300046681 Bacteria 721
247 Ga0495581_0717869 3300047315 Unclassified 576
248 Ga0495676_0293539 3300047321 Bacteria 1098
249 Ga0495676_1077412 3300047321 Unclassified 511
250 Ga0496100_0068364 3300048903 Bacteria 2362
251 Ga0496101_0495946 3300048904 Bacteria 965
252 Ga0496102_0188487 3300048905 Bacteria 1944
253 Ga0496102_1281769 3300048905 Bacteria 652
254 Ga0496102_1502615 3300048905 Unclassified 592
255 Ga0496103_0332498 3300048906 Bacteria 977
256 Ga0496103_0368166 3300048906 Bacteria 924
257 Ga0496104_0081155 3300048907 Bacteria 3093
258 Ga0496106_0033358 3300048909 Bacteria 3841
259 Ga0496106_0493990 3300048909 Bacteria 983
260 Ga0496106_0679461 3300048909 Bacteria 821
261 Ga0496108_0001143 3300048911 Bacteria 20720
262 Ga0496108_0079918 3300048911 Bacteria 2769
263 Ga0496108_0971136 3300048911 Bacteria 727
264 Ga0496108_1736923 3300048911 Bacteria 513
265 Ga0496109_0002380 3300048912 Bacteria 15713
266 Ga0496109_0145517 3300048912 Bacteria 2217
267 Ga0496109_1905737 3300048912 Bacteria 527
268 Ga0496109_2032807 3300048912 Unclassified 506
269 Ga0496110_0115111 3300048913 Bacteria 2420
270 Ga0496110_0434323 3300048913 Bacteria 1197
271 Ga0496110_1595125 3300048913 Bacteria 563
272 Ga0496110_1776143 3300048913 Bacteria 527
273 Ga0496111_0835726 3300048914 Bacteria 665
274 Ga0496112_0001597 3300048915 Bacteria 17518
275 Ga0496112_0003133 3300048915 Bacteria 13571
276 Ga0496112_0011056 3300048915 Bacteria 8224
277 Ga0496112_0249869 3300048915 Bacteria 1725
278 Ga0496112_0956767 3300048915 Bacteria 777
279 Ga0496113_0010676 3300048916 Bacteria 6083
280 Ga0496114_1697990 3300048917 Bacteria 520
281 Ga0500588_0248075 3300053146 Bacteria 668
282 Ga0587076_032454 3300059645 Bacteria 934
283 Ga0070683_100425654
284 Ga0070682_100176299
285 Ga0068868_100236989
286 Ga0068868_100272393
287 Ga0068868_101201138
288 Ga0068868_101295359
289 Ga0070661_101636954
290 Ga0070661_101718763
291 Ga0070692_10335383
292 Ga0070668_100327598
293 Ga0070668_101078319
294 Ga0070669_101150985
295 Ga0070675_101067535
296 Ga0070671_101124981
297 Ga0070671_101420567
298 Ga0070671_101469442
299 Ga0070671_102128822
300 Ga0070674_101697857
301 Ga0070674_102178880
302 Ga0070659_100007682
303 Ga0070659_101193057
304 Ga0070667_101025239
305 Ga0070714_100035764
306 Ga0070713_100194613
307 Ga0070713_101665943
308 Ga0070711_101398966
309 Ga0070700_100187815
310 Ga0070700_101207945
311 Ga0070663_101539786
312 Ga0068867_100983382
313 Ga0068867_101194588
314 Ga0068867_102339496
315 Ga0070684_100749322
316 Ga0070672_100347736
317 Ga0070672_101058251
318 Ga0070693_100829510
319 Ga0070665_101348423
320 Ga0070704_100240917
321 Ga0070664_100276811
322 Ga0070664_100887855
323 Ga0068857_100331943
324 Ga0068857_101088040
325 Ga0068854_100283614
326 Ga0070702_100157084
327 Ga0070702_100258408
328 Ga0068852_100273570
329 Ga0068852_100493988
330 Ga0068852_101425339
331 Ga0068859_100340212
332 Ga0068859_100923402
333 Ga0068864_100097410
334 Ga0068864_101173113
335 Ga0068864_102442662
336 Ga0068866_10098067
337 Ga0068861_100188144
338 Ga0068861_100342648
339 Ga0068851_11120997
340 Ga0068870_10112619
341 Ga0068858_102041196
342 Ga0068862_100532853
343 Ga0081455_10005421
344 Ga0081539_10084236
345 Ga0070717_10017026
346 Ga0070717_12028640
347 Ga0068865_100489489
348 Ga0068865_100550107
349 Ga0068865_101436787
350 Ga0097620_100340218
351 Ga0097620_100923602
352 Ga0105240_10628964
353 Ga0111539_12136881
354 Ga0105245_10187280
355 Ga0105245_10615531
356 Ga0105245_10644605
357 Ga0105245_10899432
358 Ga0105245_11495474
359 Ga0105247_10089506
360 Ga0105243_10392427
361 Ga0105243_10614997
362 Ga0105243_12235607
363 Ga0105242_11188248
364 Ga0105248_11739905
365 Ga0105238_11822003
366 Ga0105249_10602905
367 Ga0105239_10636551
368 Ga0105246_10630730
369 Ga0157378_12991510
370 Ga0163162_10269374
371 Ga0163162_11136284
372 Ga0157372_11757633
373 Ga0157375_10441344
374 Ga0157375_11087715
375 Ga0157375_12357278
376 Ga0163163_12419877
377 Ga0157380_10997107
378 Ga0157380_11522913
379 Ga0157377_10256807
380 Ga0157377_10411210
381 Ga0207656_10419506
382 Ga0207642_10182232
383 Ga0207642_10216158
384 Ga0207643_10137556
385 Ga0207649_10128271
386 Ga0207659_11032789
387 Ga0207659_11198197
388 Ga0207687_11188267
389 Ga0207687_11287669
390 Ga0207700_10409021
391 Ga0207700_11051690
392 Ga0207664_10050166
393 Ga0207664_10100154
394 Ga0207644_10312886
395 Ga0207644_11832193
396 Ga0207690_10234198
397 Ga0207690_10579414
398 Ga0207690_11181940
399 Ga0207706_10910134
400 Ga0207686_11783600
401 Ga0207709_10300935
402 Ga0207709_11167973
403 Ga0207670_10371483
404 Ga0207669_11392719
405 Ga0207704_10238154
406 Ga0207704_10600135
407 Ga0207691_10143446
408 Ga0207691_10974603
409 Ga0207661_10055257
410 Ga0207661_10570999
411 Ga0207661_10970859
412 Ga0207679_10207687
413 Ga0207679_10866497
414 Ga0207679_12139803
415 Ga0207667_11203033
416 Ga0207712_10381968
417 Ga0207668_10245679
418 Ga0207668_11140330
419 Ga0207640_10299824
420 Ga0207677_11399187
421 Ga0207677_11581596
422 Ga0207677_11735244
423 Ga0207708_10076731
424 Ga0207708_10079600
425 Ga0207648_10561947
426 Ga0207648_10648797
427 Ga0207648_10838828
428 Ga0207676_10305231
429 Ga0207676_11063053
430 Ga0207676_11875086
431 Ga0207674_10307341
432 Ga0207674_10871401
433 Ga0207675_100363553
434 Ga0207675_100382419
435 Ga0207698_10560381
436 Ga0207698_10568552
437 Ga0207698_11338899
438 Ga0268265_10806095
439 Ga0268264_11414320
440 Ga0307405_10736167
441 Ga0307413_10043185
442 Ga0307413_10397961
443 Ga0307410_10656968
444 Ga0307406_10070933
445 Ga0307406_10997349
446 Ga0307407_10046450
447 Ga0307412_11179708
448 Ga0307409_100285367
449 Ga0307409_101415523
450 Ga0307416_100132704
451 Ga0307416_100820447
452 Ga0307416_100994960
453 Ga0307416_103582534
454 Ga0307415_100012426
455 Ga0307415_100147340
456 Ga0307415_100350587
457 Ga0307415_100683774
458 Ga0307415_101886412
459 Ga0373943_0734848
460 Ga0373931_1104126
461 Ga0373935_0282583
462 Ga0373925_0096996
463 Ga0395899_0286939
464 Ga0395900_0093947
465 Ga0395900_0322280
466 Ga0395900_0501818
467 Ga0395900_1338458
468 Ga0395898_0013389
469 Ga0395898_0044956
470 Ga0395898_0653293
471 Ga0395898_0672697
472 Ga0395898_0968013
473 Ga0395898_1396775
474 Ga0395898_1676308
475 Ga0395905_0095106
476 Ga0395905_0851193
477 Ga0395905_1046556
478 Ga0395901_0198137
479 Ga0395901_0198832
480 Ga0395901_0209865
481 Ga0395901_0225960
482 Ga0395901_0552280
483 Ga0395901_0710413
484 Ga0395901_0770969
485 Ga0395901_0886677
486 Ga0395901_1151419
487 Ga0395901_1697793
488 Ga0395901_2101852
489 Ga0451795_0296383
490 Ga0451835_0600955
491 Ga0451837_1737095
492 Ga0451851_1049092
493 Ga0451853_2354465
494 Ga0439448_0271419
495 Ga0450905_028103
496 Ga0439458_0054431
497 Ga0466966_0430736
498 Ga0466963_0013546
499 Ga0466963_0132234
500 Ga0466964_0206918
501 Ga0466964_0224426
502 Ga0466968_0652461
503 Ga0466968_0667120
504 Ga0466957_0693394
505 Ga0466957_1358447
506 Ga0466960_0052083
507 Ga0466967_0023020
508 Ga0466967_0072528
509 Ga0466967_0207809
510 Ga0466967_0252294
511 Ga0466967_0351562
512 Ga0466967_0467893
513 Ga0466967_0496316
514 Ga0466967_0652185
515 Ga0466967_0954699
516 Ga0466967_1014664
517 Ga0466967_1140123
518 Ga0466967_1707946
519 Ga0466967_1811597
520 Ga0466967_1997290
521 Ga0466967_2031244
522 Ga0495603_0827761
523 Ga0495629_0097783
524 Ga0495641_0100016
525 Ga0495641_0113133
526 Ga0495582_0172880
527 Ga0495582_0446167
528 Ga0495647_0302680
529 Ga0495581_0717869
530 Ga0495676_0293539
531 Ga0495676_1077412
532 Ga0496100_0068364
533 Ga0496101_0495946
534 Ga0496102_0188487
535 Ga0496102_1281769
536 Ga0496102_1502615
537 Ga0496103_0332498
538 Ga0496103_0368166
539 Ga0496104_0081155
540 Ga0496106_0033358
541 Ga0496106_0493990
542 Ga0496106_0679461
543 Ga0496108_0001143
544 Ga0496108_0079918
545 Ga0496108_0971136
546 Ga0496108_1736923
547 Ga0496109_0002380
548 Ga0496109_0145517
549 Ga0496109_1905737
550 Ga0496109_2032807
551 Ga0496110_0115111
552 Ga0496110_0434323
553 Ga0496110_1595125
554 Ga0496110_1776143
555 Ga0496111_0835726
556 Ga0496112_0001597
557 Ga0496112_0003133
558 Ga0496112_0011056
559 Ga0496112_0249869
560 Ga0496112_0956767
561 Ga0496113_0010676
562 Ga0496114_1697990
563 Ga0500588_0248075
564 Ga0587076_032454

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fkg-assembly1.cif.gz_A the crystal structure of engineered ospa 0.6715 2 49
4v3d-assembly2.cif.gz_B the cidra domain from hb3var03 pfemp1 bound to endothelial protein c receptor 0.6102 18 69
8c44-assembly1.cif.gz_C hb3var03 apo headstructure (pfemp1 a) complexed with epcr 0.6091 18 69
2kxv-assembly1.cif.gz_A nmr structure and calcium-binding properties of the tellurite resistance protein terd from klebsiella pneumoniae 0.6089 19 43
7oks-assembly3.cif.gz_C x-ray structure of soluble epcr in p212121 space group 0.5997 18 69
ID Description Score Start End Superfamily
af_Q2FV11_9_533_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.678 22 43 3.50.50.60
af_Q6UPE0_47_576_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.6503 22 45 3.50.50.60
af_E7F3P0_1_83_3.10.320.10 Alpha Beta;Roll;Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1;Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 0.6479 18 68 3.10.320.10
af_A0A1D6H359_25_157_2.40.70.10 Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases 0.6395 15 45 2.40.70.10
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6336 4 36 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A538CT74-F1-model_v4 Uncharacterized protein 0.9627 1 72
AF-A0A7V5C2E5-F1-model_v4 Uncharacterized protein 0.8375 1 67
AF-A0A7J9YYR2-F1-model_v4 Uncharacterized protein 0.8328 7 72
AF-A0A3N5LE61-F1-model_v4 Uncharacterized protein 0.8311 1 65
AF-A0A7Y1V0J3-F1-model_v4 Uncharacterized protein 0.8237 1 67

Map