F384541

General Info

Members Datasets Scaffolds Average Seq Length
281 164 562 230

Family's Representative Sequence

Representative Sequence 3300048910|Ga0496107_0469176|Ga0496107_0469176_135_869
Length 244
Sequence VTAVEDGGPAERDMATIGITTCRKLEDYRQAILHAGGEPRVLDSTMSVDAALDGIEGLLLTGGDDVMPNRYGEQPHPATVQAEPGRDEFEIALVNSARARQLPILAICRGIQVLNVACGGTLVQDIPTQVPGALAHSLTVPPNQAYSLAHEIWIEKDSLLSRLMRERLNDADTCDVNSRHHQAVKNVATGFKVSATAPDGVVEAIEDPAARFCLGVQWHPENFWRTGEFRPLFEGFLNSTDPNA

Samples

Sample ID Description Type Environment
1 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
116 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
117 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
118 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
119 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
120 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
121 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
122 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
123 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
124 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
125 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
126 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
127 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
136 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
137 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
141 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
163 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
164 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.91
Rhizosphere 96.09
Stem 0
Stem Tuber 0
Unclassified 7.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496107_0469176 3300048910 Bacteria 934
2 Ga0065712_10070068 3300005290 Bacteria 6360
3 Ga0065712_10083466 3300005290 Bacteria 2834
4 Ga0065712_10237400 3300005290 Unclassified 994
5 Ga0070658_10316011 3300005327 Bacteria 1333
6 Ga0070676_10011293 3300005328 Bacteria 4855
7 Ga0070683_100489797 3300005329 Bacteria 1174
8 Ga0070683_100895720 3300005329 Bacteria 851
9 Ga0070670_100092464 3300005331 Bacteria 2601
10 Ga0068869_100264870 3300005334 Bacteria 1377
11 Ga0070666_10061429 3300005335 Bacteria 2544
12 Ga0070660_100026226 3300005339 Bacteria 4337
13 Ga0070660_100492277 3300005339 Bacteria 1020
14 Ga0070689_100367044 3300005340 Bacteria 1211
15 Ga0070691_10010602 3300005341 Bacteria 4208
16 Ga0070692_10196692 3300005345 Bacteria 1178
17 Ga0070669_100009260 3300005353 Bacteria 7017
18 Ga0070675_100002612 3300005354 Bacteria 13522
19 Ga0070671_100223910 3300005355 Bacteria 1596
20 Ga0070671_100684482 3300005355 Bacteria 889
21 Ga0070673_100117549 3300005364 Bacteria 2213
22 Ga0070688_100348080 3300005365 Unclassified 1084
23 Ga0070659_100225939 3300005366 Bacteria 1546
24 Ga0070667_100853283 3300005367 Bacteria 847
25 Ga0070703_10075797 3300005406 Unclassified 1134
26 Ga0070703_10157722 3300005406 Bacteria 858
27 Ga0070714_100022100 3300005435 Bacteria 5212
28 Ga0070713_100022262 3300005436 Bacteria 4895
29 Ga0070701_10023281 3300005438 Bacteria 2981
30 Ga0070705_100004319 3300005440 Bacteria 6924
31 Ga0070700_100011121 3300005441 Bacteria 4979
32 Ga0070694_100026094 3300005444 Bacteria 3784
33 Ga0070694_100041123 3300005444 Bacteria 3082
34 Ga0070708_100207892 3300005445 Bacteria 1834
35 Ga0070681_10004283 3300005458 Bacteria 13547
36 Ga0070681_10062388 3300005458 Bacteria 3701
37 Ga0070681_10504388 3300005458 Unclassified 1123
38 Ga0068867_100040636 3300005459 Bacteria 3396
39 Ga0070707_100168581 3300005468 Bacteria 2134
40 Ga0070699_100160903 3300005518 Bacteria 1987
41 Ga0070679_100046944 3300005530 Bacteria 4305
42 Ga0070679_100180865 3300005530 Bacteria 2081
43 Ga0070684_100319573 3300005535 Bacteria 1426
44 Ga0068853_100290172 3300005539 Unclassified 1510
45 Ga0070686_100002768 3300005544 Bacteria 9659
46 Ga0070695_100001838 3300005545 Bacteria 11967
47 Ga0070695_100006527 3300005545 Bacteria 6894
48 Ga0070696_100237264 3300005546 Bacteria 1374
49 Ga0070696_100514348 3300005546 Bacteria 954
50 Ga0070665_100003796 3300005548 Bacteria 15992
51 Ga0070704_100011464 3300005549 Bacteria 5434
52 Ga0070704_100252608 3300005549 Bacteria 1449
53 Ga0068855_100060180 3300005563 Bacteria 4442
54 Ga0068855_100386362 3300005563 Bacteria 1536
55 Ga0068855_100919881 3300005563 Bacteria 923
56 Ga0070664_100169375 3300005564 Bacteria 1937
57 Ga0068857_100210970 3300005577 Bacteria 1772
58 Ga0068857_100239400 3300005577 Bacteria 1661
59 Ga0068854_100011151 3300005578 Bacteria 5837
60 Ga0068854_100184909 3300005578 Bacteria 1630
61 Ga0068856_100362505 3300005614 Bacteria 1468
62 Ga0070702_100002300 3300005615 Bacteria 8189
63 Ga0068859_100004898 3300005617 Bacteria 13639
64 Ga0068859_100108018 3300005617 Bacteria 2844
65 Ga0068864_100047642 3300005618 Bacteria 3682
66 Ga0068864_100546394 3300005618 Unclassified 1119
67 Ga0068861_100033667 3300005719 Bacteria 3782
68 Ga0068863_100112042 3300005841 Bacteria 2598
69 Ga0068858_100032825 3300005842 Bacteria 4821
70 Ga0068858_100049543 3300005842 Bacteria 3890
71 Ga0068860_100576667 3300005843 Bacteria 1129
72 Ga0068860_101169721 3300005843 Bacteria 789
73 Ga0068862_100199638 3300005844 Bacteria 1803
74 Ga0081539_10010273 3300005985 Bacteria 7643
75 Ga0097621_100003783 3300006237 Bacteria 10482
76 Ga0097621_100110375 3300006237 Bacteria 2324
77 Ga0097621_100433217 3300006237 Bacteria 1182
78 Ga0068871_100002077 3300006358 Bacteria 13547
79 Ga0068871_100036512 3300006358 Bacteria 3913
80 Ga0075428_100075004 3300006844 Bacteria 3695
81 Ga0075428_100288151 3300006844 Bacteria 1767
82 Ga0075433_10064287 3300006852 Bacteria 3216
83 Ga0075433_10148375 3300006852 Bacteria 2086
84 Ga0075433_10506766 3300006852 Bacteria 1062
85 Ga0075434_100001992 3300006871 Bacteria 17717
86 Ga0075434_100014912 3300006871 Bacteria 7435
87 Ga0075434_100032332 3300006871 Bacteria 5160
88 Ga0075434_100202465 3300006871 Bacteria 2005
89 Ga0068865_100008189 3300006881 Bacteria 6453
90 Ga0075436_100003393 3300006914 Bacteria 10911
91 Ga0075436_100004609 3300006914 Bacteria 9447
92 Ga0075436_100005416 3300006914 Bacteria 8780
93 Ga0075436_100012463 3300006914 Bacteria 5827
94 Ga0075436_100086518 3300006914 Bacteria 2177
95 Ga0075436_100316660 3300006914 Bacteria 1120
96 Ga0097620_100004898 3300006931 Bacteria 13639
97 Ga0097620_100108018 3300006931 Bacteria 2844
98 Ga0075435_100000194 3300007076 Bacteria 36738
99 Ga0075435_100002678 3300007076 Bacteria 11891
100 Ga0075435_100006862 3300007076 Bacteria 8081
101 Ga0075435_100013513 3300007076 Bacteria 6076
102 Ga0075435_100028109 3300007076 Bacteria 4408
103 Ga0075435_100034963 3300007076 Bacteria 3985
104 Ga0075435_100037179 3300007076 Bacteria 3875
105 Ga0105240_10061383 3300009093 Bacteria 4684
106 Ga0105240_10283921 3300009093 Bacteria 1900
107 Ga0111539_10006401 3300009094 Bacteria 15188
108 Ga0111539_10017811 3300009094 Bacteria 8796
109 Ga0111539_10470095 3300009094 Bacteria 1464
110 Ga0105247_10043617 3300009101 Bacteria 2749
111 Ga0114129_10000192 3300009147 Bacteria 68551
112 Ga0114129_10003659 3300009147 Bacteria 21614
113 Ga0114129_10017742 3300009147 Bacteria 10135
114 Ga0114129_10389332 3300009147 Bacteria 1839
115 Ga0105243_10174744 3300009148 Unclassified 1863
116 Ga0105242_10044359 3300009176 Bacteria 3601
117 Ga0105242_10205720 3300009176 Bacteria 1751
118 Ga0105248_10024063 3300009177 Bacteria 6768
119 Ga0105248_10026415 3300009177 Bacteria 6459
120 Ga0105248_10119055 3300009177 Bacteria 2979
121 Ga0105248_10591601 3300009177 Bacteria 1252
122 Ga0105237_10232141 3300009545 Bacteria 1846
123 Ga0105238_10408176 3300009551 Bacteria 1352
124 Ga0157374_10464303 3300013296 Bacteria 1268
125 Ga0157378_10164871 3300013297 Bacteria 2075
126 Ga0157378_10916300 3300013297 Bacteria 908
127 Ga0163162_10959661 3300013306 Unclassified 966
128 Ga0163163_10483037 3300014325 Bacteria 1300
129 Ga0163163_10777059 3300014325 Bacteria 1021
130 Ga0157379_10078758 3300014968 Bacteria 2952
131 Ga0157379_10313029 3300014968 Bacteria 1432
132 Ga0157379_10812233 3300014968 Bacteria 883
133 Ga0157376_10008346 3300014969 Bacteria 7472
134 Ga0157376_10032099 3300014969 Bacteria 4213
135 Ga0157376_10250743 3300014969 Bacteria 1653
136 Ga0207680_10116915 3300025903 Unclassified 1738
137 Ga0207680_10460677 3300025903 Bacteria 903
138 Ga0207685_10114784 3300025905 Bacteria 1173
139 Ga0207645_10015258 3300025907 Bacteria 5112
140 Ga0207645_10099603 3300025907 Bacteria 1874
141 Ga0207645_10102547 3300025907 Unclassified 1847
142 Ga0207707_10099958 3300025912 Bacteria 2535
143 Ga0207695_10173858 3300025913 Unclassified 2077
144 Ga0207695_10632887 3300025913 Bacteria 951
145 Ga0207662_10060870 3300025918 Unclassified 2265
146 Ga0207657_10029966 3300025919 Bacteria 4945
147 Ga0207652_10032541 3300025921 Bacteria 4385
148 Ga0207646_10174179 3300025922 Bacteria 1943
149 Ga0207694_10196538 3300025924 Bacteria 1640
150 Ga0207650_10022084 3300025925 Unclassified 4504
151 Ga0207650_10303464 3300025925 Bacteria 1304
152 Ga0207659_10000250 3300025926 Bacteria 32723
153 Ga0207690_10121808 3300025932 Bacteria 1896
154 Ga0207690_10170930 3300025932 Bacteria 1628
155 Ga0207686_10042198 3300025934 Bacteria 2786
156 Ga0207686_10579861 3300025934 Bacteria 880
157 Ga0207670_10681385 3300025936 Unclassified 850
158 Ga0207704_10349605 3300025938 Bacteria 1150
159 Ga0207665_10186418 3300025939 Bacteria 1505
160 Ga0207691_10470539 3300025940 Bacteria 1068
161 Ga0207711_10030615 3300025941 Bacteria 4540
162 Ga0207711_10073595 3300025941 Bacteria 2970
163 Ga0207711_10176935 3300025941 Bacteria 1939
164 Ga0207711_10272157 3300025941 Bacteria 1558
165 Ga0207711_10395165 3300025941 Bacteria 1284
166 Ga0207689_10143791 3300025942 Bacteria 1965
167 Ga0207661_10694588 3300025944 Unclassified 936
168 Ga0207667_10024831 3300025949 Bacteria 6571
169 Ga0207651_10058115 3300025960 Bacteria 2672
170 Ga0207640_10003402 3300025981 Bacteria 8575
171 Ga0207640_10281551 3300025981 Bacteria 1306
172 Ga0207640_10282647 3300025981 Bacteria 1304
173 Ga0207658_10578011 3300025986 Bacteria 1008
174 Ga0207677_10036921 3300026023 Bacteria 3189
175 Ga0207677_10421903 3300026023 Bacteria 1136
176 Ga0207703_10017649 3300026035 Bacteria 5570
177 Ga0207639_10143971 3300026041 Bacteria 1989
178 Ga0207708_10000748 3300026075 Bacteria 24397
179 Ga0207708_10307874 3300026075 Bacteria 1290
180 Ga0207702_10950140 3300026078 Bacteria 852
181 Ga0207648_10075640 3300026089 Bacteria 2935
182 Ga0207648_10249224 3300026089 Bacteria 1583
183 Ga0207676_10023309 3300026095 Bacteria 4565
184 Ga0207676_10390570 3300026095 Unclassified 1298
185 Ga0207674_10095454 3300026116 Bacteria 2960
186 Ga0207675_100006273 3300026118 Bacteria 11284
187 Ga0207428_10014294 3300027907 Bacteria 6908
188 Ga0207428_10338656 3300027907 Bacteria 1108
189 Ga0207428_10471034 3300027907 Unclassified 914
190 Ga0268266_10015100 3300028379 Bacteria 6632
191 Ga0268264_10452189 3300028381 Bacteria 1244
192 Ga0268264_10572098 3300028381 Unclassified 1111
193 Ga0268264_10619689 3300028381 Bacteria 1068
194 Ga0268264_10743832 3300028381 Bacteria 976
195 Ga0373930_0001816 3300034816 Bacteria 3248
196 Ga0373948_0001509 3300034817 Bacteria 3248
197 Ga0373950_0003986 3300034818 Bacteria 2147
198 Ga0373959_0004559 3300034820 Bacteria 2237
199 Ga0373929_0001729 3300035085 Bacteria 4104
200 Ga0373940_0000138 3300035088 Bacteria 9328
201 Ga0373952_0006397 3300035092 Bacteria 2172
202 Ga0373932_0000981 3300035112 Bacteria 8263
203 Ga0373960_0000993 3300035121 Bacteria 6102
204 Ga0373946_0089390 3300035171 Bacteria 1362
205 Ga0373955_0056759 3300035172 Bacteria 2149
206 Ga0373961_0002729 3300035241 Bacteria 4513
207 Ga0373962_0061160 3300035242 Bacteria 1106
208 Ga0373931_0002045 3300035691 Bacteria 8870
209 Ga0373931_0294822 3300035691 Bacteria 1000
210 Ga0373933_0067279 3300035724 Bacteria 2173
211 Ga0373937_0010946 3300036401 Bacteria 7945
212 Ga0373937_0862211 3300036401 Bacteria 854
213 Ga0373925_0057138 3300037068 Bacteria 2924
214 Ga0451576_0006662 3300045051 Bacteria 14096
215 Ga0451576_0495696 3300045051 Bacteria 1283
216 Ga0495653_0160667 3300046463 Bacteria 1560
217 Ga0495580_0420107 3300046472 Bacteria 900
218 Ga0495662_0080616 3300046476 Unclassified 1583
219 Ga0495664_0054197 3300046477 Bacteria 2385
220 Ga0495640_0151641 3300046533 Bacteria 1489
221 Ga0495640_0163342 3300046533 Unclassified 1426
222 Ga0495645_0006134 3300046543 Bacteria 8318
223 Ga0495635_0045505 3300046663 Bacteria 3029
224 Ga0495647_0027396 3300046681 Bacteria 2094
225 Ga0495658_0163901 3300046683 Bacteria 1372
226 Ga0495658_0200182 3300046683 Bacteria 1245
227 Ga0495658_0229649 3300046683 Bacteria 1163
228 Ga0495674_0746494 3300047319 Bacteria 765
229 Ga0495684_0237594 3300047471 Bacteria 1330
230 Ga0496106_0100684 3300048909 Bacteria 2241
231 Ga0496109_0072198 3300048912 Bacteria 3170
232 Ga0496111_0112796 3300048914 Bacteria 2003
233 Ga0496112_0010798 3300048915 Bacteria 8306
234 Ga0496112_0258708 3300048915 Bacteria 1690
235 Ga0496112_0319192 3300048915 Bacteria 1498
236 Ga0496112_0391169 3300048915 Bacteria 1331
237 Ga0496113_0065624 3300048916 Bacteria 2748
238 Ga0496114_0060879 3300048917 Bacteria 3156
239 Ga0496114_0815828 3300048917 Bacteria 812
240 Ga0501047_0017791 3300049581 Bacteria 6808
241 Ga0501073_0365975 3300049589 Bacteria 996
242 Ga0501080_0430381 3300049742 Bacteria 1184
243 Ga0501081_0373427 3300049743 Bacteria 1053
244 Ga0501044_0002518 3300049823 Bacteria 20880
245 nmdc:mga05p37_143331_c1 3300050507 Bacteria 2926
246 nmdc:mga05p37_186679_c1 3300050507 Bacteria 2520
247 nmdc:mga05p37_32176_c1 3300050507 Bacteria 6413
248 nmdc:mga05p37_50871_c1 3300050507 Bacteria 5095
249 nmdc:mga05p37_68567_c1 3300050507 Bacteria 4362
250 nmdc:mga05p37_8953_c1 3300050507 Bacteria 11838
251 nmdc:mga09592_289557_c1 3300050508 Bacteria 1420
252 nmdc:mga08y16_11800_c1 3300050511 Bacteria 9179
253 nmdc:mga08y16_149291_c1 3300050511 Bacteria 2430
254 nmdc:mga08y16_220673_c1 3300050511 Bacteria 1963
255 nmdc:mga08y16_90684_c1 3300050511 Bacteria 3186
256 nmdc:mga0n895_280838_c1 3300050512 Bacteria 1689
257 nmdc:mga0n895_358194_c1 3300050512 Bacteria 1477
258 nmdc:mga0n895_364335_c1 3300050512 Bacteria 1463
259 nmdc:mga0n895_399_c1 3300050512 Bacteria 29189
260 nmdc:mga0n895_4609_c1 3300050512 Bacteria 11361
261 nmdc:mga0rr50_102551_c1 3300050513 Bacteria 2251
262 nmdc:mga0rr50_17399_c1 3300050513 Bacteria 4799
263 nmdc:mga0rr50_207299_c1 3300050513 Bacteria 1614
264 nmdc:mga0rr50_2_c1 3300050513 Bacteria 373938
265 nmdc:mga0rr50_52859_c1 3300050513 Bacteria 3020
266 nmdc:mga0rr50_6226_c1 3300050513 Bacteria 7234
267 nmdc:mga08x19_103271_c1 3300050514 Bacteria 1893
268 nmdc:mga08x19_14537_c1 3300050514 Bacteria 4775
269 nmdc:mga08x19_190597_c1 3300050514 Bacteria 1403
270 nmdc:mga08x19_230_c1 3300050514 Bacteria 42633
271 nmdc:mga08x19_28212_c1 3300050514 Bacteria 3514
272 nmdc:mga08x19_66357_c2 3300050514 Bacteria 1821
273 nmdc:mga08x19_7602_c1 3300050514 Bacteria 6436
274 nmdc:mga0a205_130920_c1 3300050515 Bacteria 2409
275 nmdc:mga0a205_141206_c1 3300050515 Bacteria 2309
276 nmdc:mga0a205_42759_c1 3300050515 Bacteria 4366
277 Ga0495601_0109809 3300053077 Unclassified 1786
278 Ga0495595_0069214 3300053084 Unclassified 1666
279 Ga0495619_0014491 3300053085 Bacteria 4980
280 Ga0495619_0171838 3300053085 Bacteria 1499
281 Ga0495619_0209580 3300053085 Bacteria 1350
282 Ga0496107_0469176
283 Ga0065712_10070068
284 Ga0065712_10083466
285 Ga0065712_10237400
286 Ga0070658_10316011
287 Ga0070676_10011293
288 Ga0070683_100489797
289 Ga0070683_100895720
290 Ga0070670_100092464
291 Ga0068869_100264870
292 Ga0070666_10061429
293 Ga0070660_100026226
294 Ga0070660_100492277
295 Ga0070689_100367044
296 Ga0070691_10010602
297 Ga0070692_10196692
298 Ga0070669_100009260
299 Ga0070675_100002612
300 Ga0070671_100223910
301 Ga0070671_100684482
302 Ga0070673_100117549
303 Ga0070688_100348080
304 Ga0070659_100225939
305 Ga0070667_100853283
306 Ga0070703_10075797
307 Ga0070703_10157722
308 Ga0070714_100022100
309 Ga0070713_100022262
310 Ga0070701_10023281
311 Ga0070705_100004319
312 Ga0070700_100011121
313 Ga0070694_100026094
314 Ga0070694_100041123
315 Ga0070708_100207892
316 Ga0070681_10004283
317 Ga0070681_10062388
318 Ga0070681_10504388
319 Ga0068867_100040636
320 Ga0070707_100168581
321 Ga0070699_100160903
322 Ga0070679_100046944
323 Ga0070679_100180865
324 Ga0070684_100319573
325 Ga0068853_100290172
326 Ga0070686_100002768
327 Ga0070695_100001838
328 Ga0070695_100006527
329 Ga0070696_100237264
330 Ga0070696_100514348
331 Ga0070665_100003796
332 Ga0070704_100011464
333 Ga0070704_100252608
334 Ga0068855_100060180
335 Ga0068855_100386362
336 Ga0068855_100919881
337 Ga0070664_100169375
338 Ga0068857_100210970
339 Ga0068857_100239400
340 Ga0068854_100011151
341 Ga0068854_100184909
342 Ga0068856_100362505
343 Ga0070702_100002300
344 Ga0068859_100004898
345 Ga0068859_100108018
346 Ga0068864_100047642
347 Ga0068864_100546394
348 Ga0068861_100033667
349 Ga0068863_100112042
350 Ga0068858_100032825
351 Ga0068858_100049543
352 Ga0068860_100576667
353 Ga0068860_101169721
354 Ga0068862_100199638
355 Ga0081539_10010273
356 Ga0097621_100003783
357 Ga0097621_100110375
358 Ga0097621_100433217
359 Ga0068871_100002077
360 Ga0068871_100036512
361 Ga0075428_100075004
362 Ga0075428_100288151
363 Ga0075433_10064287
364 Ga0075433_10148375
365 Ga0075433_10506766
366 Ga0075434_100001992
367 Ga0075434_100014912
368 Ga0075434_100032332
369 Ga0075434_100202465
370 Ga0068865_100008189
371 Ga0075436_100003393
372 Ga0075436_100004609
373 Ga0075436_100005416
374 Ga0075436_100012463
375 Ga0075436_100086518
376 Ga0075436_100316660
377 Ga0097620_100004898
378 Ga0097620_100108018
379 Ga0075435_100000194
380 Ga0075435_100002678
381 Ga0075435_100006862
382 Ga0075435_100013513
383 Ga0075435_100028109
384 Ga0075435_100034963
385 Ga0075435_100037179
386 Ga0105240_10061383
387 Ga0105240_10283921
388 Ga0111539_10006401
389 Ga0111539_10017811
390 Ga0111539_10470095
391 Ga0105247_10043617
392 Ga0114129_10000192
393 Ga0114129_10003659
394 Ga0114129_10017742
395 Ga0114129_10389332
396 Ga0105243_10174744
397 Ga0105242_10044359
398 Ga0105242_10205720
399 Ga0105248_10024063
400 Ga0105248_10026415
401 Ga0105248_10119055
402 Ga0105248_10591601
403 Ga0105237_10232141
404 Ga0105238_10408176
405 Ga0157374_10464303
406 Ga0157378_10164871
407 Ga0157378_10916300
408 Ga0163162_10959661
409 Ga0163163_10483037
410 Ga0163163_10777059
411 Ga0157379_10078758
412 Ga0157379_10313029
413 Ga0157379_10812233
414 Ga0157376_10008346
415 Ga0157376_10032099
416 Ga0157376_10250743
417 Ga0207680_10116915
418 Ga0207680_10460677
419 Ga0207685_10114784
420 Ga0207645_10015258
421 Ga0207645_10099603
422 Ga0207645_10102547
423 Ga0207707_10099958
424 Ga0207695_10173858
425 Ga0207695_10632887
426 Ga0207662_10060870
427 Ga0207657_10029966
428 Ga0207652_10032541
429 Ga0207646_10174179
430 Ga0207694_10196538
431 Ga0207650_10022084
432 Ga0207650_10303464
433 Ga0207659_10000250
434 Ga0207690_10121808
435 Ga0207690_10170930
436 Ga0207686_10042198
437 Ga0207686_10579861
438 Ga0207670_10681385
439 Ga0207704_10349605
440 Ga0207665_10186418
441 Ga0207691_10470539
442 Ga0207711_10030615
443 Ga0207711_10073595
444 Ga0207711_10176935
445 Ga0207711_10272157
446 Ga0207711_10395165
447 Ga0207689_10143791
448 Ga0207661_10694588
449 Ga0207667_10024831
450 Ga0207651_10058115
451 Ga0207640_10003402
452 Ga0207640_10281551
453 Ga0207640_10282647
454 Ga0207658_10578011
455 Ga0207677_10036921
456 Ga0207677_10421903
457 Ga0207703_10017649
458 Ga0207639_10143971
459 Ga0207708_10000748
460 Ga0207708_10307874
461 Ga0207702_10950140
462 Ga0207648_10075640
463 Ga0207648_10249224
464 Ga0207676_10023309
465 Ga0207676_10390570
466 Ga0207674_10095454
467 Ga0207675_100006273
468 Ga0207428_10014294
469 Ga0207428_10338656
470 Ga0207428_10471034
471 Ga0268266_10015100
472 Ga0268264_10452189
473 Ga0268264_10572098
474 Ga0268264_10619689
475 Ga0268264_10743832
476 Ga0373930_0001816
477 Ga0373948_0001509
478 Ga0373950_0003986
479 Ga0373959_0004559
480 Ga0373929_0001729
481 Ga0373940_0000138
482 Ga0373952_0006397
483 Ga0373932_0000981
484 Ga0373960_0000993
485 Ga0373946_0089390
486 Ga0373955_0056759
487 Ga0373961_0002729
488 Ga0373962_0061160
489 Ga0373931_0002045
490 Ga0373931_0294822
491 Ga0373933_0067279
492 Ga0373937_0010946
493 Ga0373937_0862211
494 Ga0373925_0057138
495 Ga0451576_0006662
496 Ga0451576_0495696
497 Ga0495653_0160667
498 Ga0495580_0420107
499 Ga0495662_0080616
500 Ga0495664_0054197
501 Ga0495640_0151641
502 Ga0495640_0163342
503 Ga0495645_0006134
504 Ga0495635_0045505
505 Ga0495647_0027396
506 Ga0495658_0163901
507 Ga0495658_0200182
508 Ga0495658_0229649
509 Ga0495674_0746494
510 Ga0495684_0237594
511 Ga0496106_0100684
512 Ga0496109_0072198
513 Ga0496111_0112796
514 Ga0496112_0010798
515 Ga0496112_0258708
516 Ga0496112_0319192
517 Ga0496112_0391169
518 Ga0496113_0065624
519 Ga0496114_0060879
520 Ga0496114_0815828
521 Ga0501047_0017791
522 Ga0501073_0365975
523 Ga0501080_0430381
524 Ga0501081_0373427
525 Ga0501044_0002518
526 nmdc:mga05p37_143331_c1
527 nmdc:mga05p37_186679_c1
528 nmdc:mga05p37_32176_c1
529 nmdc:mga05p37_50871_c1
530 nmdc:mga05p37_68567_c1
531 nmdc:mga05p37_8953_c1
532 nmdc:mga09592_289557_c1
533 nmdc:mga08y16_11800_c1
534 nmdc:mga08y16_149291_c1
535 nmdc:mga08y16_220673_c1
536 nmdc:mga08y16_90684_c1
537 nmdc:mga0n895_280838_c1
538 nmdc:mga0n895_358194_c1
539 nmdc:mga0n895_364335_c1
540 nmdc:mga0n895_399_c1
541 nmdc:mga0n895_4609_c1
542 nmdc:mga0rr50_102551_c1
543 nmdc:mga0rr50_17399_c1
544 nmdc:mga0rr50_207299_c1
545 nmdc:mga0rr50_2_c1
546 nmdc:mga0rr50_52859_c1
547 nmdc:mga0rr50_6226_c1
548 nmdc:mga08x19_103271_c1
549 nmdc:mga08x19_14537_c1
550 nmdc:mga08x19_190597_c1
551 nmdc:mga08x19_230_c1
552 nmdc:mga08x19_28212_c1
553 nmdc:mga08x19_66357_c2
554 nmdc:mga08x19_7602_c1
555 nmdc:mga0a205_130920_c1
556 nmdc:mga0a205_141206_c1
557 nmdc:mga0a205_42759_c1
558 Ga0495601_0109809
559 Ga0495595_0069214
560 Ga0495619_0014491
561 Ga0495619_0171838
562 Ga0495619_0209580

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07722

Peptidase_C26

Peptidase C26

10

221

0.92

PF00117

GATase

Glutamine amidotransferase class-I

28

239

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fij-assembly1.cif.gz_B crystal structure of a uncharacterized protein lin1909 0.914 2 229
3fij-assembly1.cif.gz_F crystal structure of a uncharacterized protein lin1909 0.9107 2 229
3fij-assembly1.cif.gz_G crystal structure of a uncharacterized protein lin1909 0.9062 2 228
3fij-assembly1.cif.gz_B crystal structure of a uncharacterized protein lin1909 0.8982 2 229
3fij-assembly1.cif.gz_F crystal structure of a uncharacterized protein lin1909 0.895 2 229
ID Description Score Start End Superfamily
3fijG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9133 2 228 3.40.50.880
3fijG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8972 2 228 3.40.50.880
af_Q9HDV0_3_233_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8912 1 229 3.40.50.880
af_P76038_5_253_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8732 2 229 3.40.50.880
af_Q4D6X8_172_370_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8696 1 230 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A2V8C5N2-F1-model_v4 Uncharacterized protein 0.9742 1 197 GO:0005829
GO:0006598
GO:0033969
AF-A0A2V8C5N2-F1-model_v4 Uncharacterized protein 0.9694 1 197 GO:0005829
GO:0006598
GO:0033969
AF-A0A2V8DWA9-F1-model_v4 Uncharacterized protein 0.962 20 229 GO:0005829
GO:0006541
GO:0006598
GO:0033969
AF-A0A380F1S2-F1-model_v4 deleted 0.9548 35 229
AF-A0A3N5GEI3-F1-model_v4 Gamma-glutamyl-gamma-aminobutyrate hydrolase family protein 0.9536 2 234 GO:0005829
GO:0006541
GO:0006598
GO:0033969

Map