F384537

General Info

Members Datasets Scaffolds Average Seq Length
281 214 562 276

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0274846|Ga0496102_0274846_219_1160
Length 313
Sequence MSARNGLPACVGAAVERILCRKSNEEAHLMPSPAAKRQTYRKLHETGCFVIPNPWDIGSARYLQHLGFKALASTSAGYAFTQGLPDNAVGLDLMLAHLRELAAATDVPINADFENGYAHAPDQVAENVRQCVGTGVAGLSIEDSTGDKQNPLYDLDTAVARIRAARAAIDKAGGDVVFTARAECFLVGRPDIDEVMTRLKAYASAGADCLYAPGLRTREHIEAVVKAIAPKPVNLLMPGSLGFTVNDIAAFGVRRISVGGTLARVAWGATIRAAEQIMKDGRFDTFADAAPHPNLNGLFHEDMSKRPDRTMKP

Samples

Sample ID Description Type Environment
1 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
119 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
120 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
121 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
122 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
123 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
124 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
134 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
138 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
142 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
143 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
149 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
150 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
155 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
159 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
160 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
179 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
180 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
181 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
182 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
186 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
187 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
188 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
189 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
190 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
191 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
197 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
198 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
199 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
202 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
203 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
204 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
205 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
206 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
207 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
208 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
209 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
210 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
211 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
212 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
213 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
214 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.73
Metatranscriptomes 0.71
Isolates 3.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.12
Nodule 3.2
Rhizoplane 3.91
Rhizosphere 83.27
Stem 0
Stem Tuber 0
Unclassified 4.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496102_0274846 3300048905 Bacteria 1588
2 JGI25406J46586_10000047 3300003203 Bacteria 54770
3 Ga0070676_10150368 3300005328 Bacteria 1490
4 Ga0070690_100095083 3300005330 Bacteria 1967
5 Ga0070690_100218983 3300005330 Bacteria 1333
6 Ga0070670_100431992 3300005331 Bacteria 1165
7 Ga0068869_100032132 3300005334 Bacteria 3697
8 Ga0070680_100034709 3300005336 Bacteria 4068
9 Ga0068868_100077803 3300005338 Bacteria 2654
10 Ga0068868_100163824 3300005338 Unclassified 1838
11 Ga0070691_10073419 3300005341 Bacteria 1663
12 Ga0070687_100002611 3300005343 Bacteria 6807
13 Ga0070668_100045920 3300005347 Bacteria 3352
14 Ga0070675_100005596 3300005354 Bacteria 9618
15 Ga0070671_100052514 3300005355 Bacteria 3388
16 Ga0070673_100003748 3300005364 Bacteria 9532
17 Ga0070703_10012021 3300005406 Bacteria 2450
18 Ga0070714_100098462 3300005435 Bacteria 2573
19 Ga0070714_100570632 3300005435 Bacteria 1085
20 Ga0070711_100348792 3300005439 Bacteria 1190
21 Ga0070705_100000010 3300005440 Bacteria 102079
22 Ga0070700_100013553 3300005441 Bacteria 4581
23 Ga0070694_100020105 3300005444 Bacteria 4253
24 Ga0070663_100048014 3300005455 Bacteria 3025
25 Ga0070663_100197187 3300005455 Bacteria 1570
26 Ga0070678_100026924 3300005456 Bacteria 3895
27 Ga0070662_100001808 3300005457 Bacteria 13146
28 Ga0070662_100316324 3300005457 Unclassified 1272
29 Ga0070706_100001257 3300005467 Bacteria 27123
30 Ga0070706_100128222 3300005467 Bacteria 2367
31 Ga0070706_100170406 3300005467 Bacteria 2033
32 Ga0070707_100013676 3300005468 Bacteria 7599
33 Ga0070707_100112645 3300005468 Bacteria 2639
34 Ga0070698_100085639 3300005471 Bacteria 3138
35 Ga0070699_100014187 3300005518 Bacteria 6856
36 Ga0070679_100081294 3300005530 Bacteria 3229
37 Ga0070697_100017620 3300005536 Bacteria 5624
38 Ga0070697_100020828 3300005536 Bacteria 5192
39 Ga0070697_100021508 3300005536 Bacteria 5111
40 Ga0070672_100036504 3300005543 Bacteria 3744
41 Ga0070695_100003318 3300005545 Bacteria 9414
42 Ga0070696_100020740 3300005546 Bacteria 4453
43 Ga0070693_100086406 3300005547 Bacteria 1882
44 Ga0070704_100002486 3300005549 Bacteria 10362
45 Ga0070704_100595490 3300005549 Unclassified 971
46 Ga0068855_100391387 3300005563 Bacteria 1524
47 Ga0068855_100422847 3300005563 Bacteria 1457
48 Ga0068855_100460629 3300005563 Bacteria 1386
49 Ga0068855_100644428 3300005563 Unclassified 1138
50 Ga0068857_100043244 3300005577 Bacteria 3996
51 Ga0068856_100052960 3300005614 Bacteria 4003
52 Ga0068852_100021219 3300005616 Bacteria 5180
53 Ga0068852_100485978 3300005616 Bacteria 1228
54 Ga0068859_100036318 3300005617 Bacteria 4946
55 Ga0068864_100111846 3300005618 Bacteria 2434
56 Ga0068864_100177041 3300005618 Unclassified 1948
57 Ga0068861_100098199 3300005719 Bacteria 2324
58 Ga0068861_100273729 3300005719 Bacteria 1451
59 Ga0068851_10004557 3300005834 Bacteria 6254
60 Ga0068870_10081891 3300005840 Bacteria 1786
61 Ga0068858_100335586 3300005842 Bacteria 1446
62 Ga0068860_100006603 3300005843 Bacteria 11646
63 Ga0068860_100226149 3300005843 Unclassified 1818
64 Ga0068862_100016006 3300005844 Bacteria 6235
65 Ga0068862_100066837 3300005844 Bacteria 3098
66 Ga0075365_10010347 3300006038 Bacteria 5425
67 Ga0075368_10008405 3300006042 Bacteria 3675
68 Ga0075363_100002932 3300006048 Bacteria 7110
69 Ga0075364_10029764 3300006051 Bacteria 3502
70 Ga0075364_10049584 3300006051 Bacteria 2739
71 Ga0070712_100002508 3300006175 Bacteria 11319
72 Ga0070712_100014504 3300006175 Bacteria 5057
73 Ga0070712_100095776 3300006175 Bacteria 2184
74 Ga0075362_10006012 3300006177 Bacteria 4493
75 Ga0075367_10010139 3300006178 Bacteria 4941
76 Ga0075369_10018434 3300006186 Bacteria 2841
77 Ga0075366_10005127 3300006195 Bacteria 7086
78 Ga0068871_100060726 3300006358 Bacteria 3084
79 Ga0075428_100053554 3300006844 Bacteria 4422
80 Ga0075428_100690480 3300006844 Bacteria 1087
81 Ga0075430_100142243 3300006846 Bacteria 1998
82 Ga0075431_100187337 3300006847 Bacteria 2121
83 Ga0075433_10330180 3300006852 Bacteria 1349
84 Ga0075429_100168068 3300006880 Bacteria 1921
85 Ga0075436_100001731 3300006914 Bacteria 14950
86 Ga0075436_100296508 3300006914 Bacteria 1158
87 Ga0097620_100036317 3300006931 Bacteria 4946
88 Ga0105240_10000396 3300009093 Bacteria 81252
89 Ga0111539_10049013 3300009094 Bacteria 5040
90 Ga0111539_10063340 3300009094 Bacteria 4376
91 Ga0114129_10019905 3300009147 Bacteria 9551
92 Ga0114129_10291187 3300009147 Bacteria 2179
93 Ga0114129_10592742 3300009147 Bacteria 1437
94 Ga0105243_10696761 3300009148 Unclassified 990
95 Ga0105242_10140282 3300009176 Bacteria 2096
96 Ga0105248_10119995 3300009177 Bacteria 2966
97 Ga0105237_10000052 3300009545 Bacteria 160459
98 Ga0105249_10004673 3300009553 Bacteria 11824
99 Ga0105249_10005057 3300009553 Bacteria 11361
100 Ga0105239_10015340 3300010375 Bacteria 8489
101 Ga0105239_10276680 3300010375 Bacteria 1889
102 Ga0157378_10190677 3300013297 Bacteria 1933
103 Ga0157378_10296201 3300013297 Bacteria 1564
104 Ga0163162_10028449 3300013306 Bacteria 5531
105 Ga0163162_10076448 3300013306 Bacteria 3410
106 Ga0157375_10014480 3300013308 Bacteria 7036
107 Ga0157375_10274729 3300013308 Bacteria 1847
108 Ga0163163_10367661 3300014325 Unclassified 1495
109 Ga0157380_10179770 3300014326 Bacteria 1857
110 Ga0207697_10002339 3300025315 Bacteria 9872
111 Ga0207656_10002403 3300025321 Bacteria 6302
112 Ga0207645_10004682 3300025907 Bacteria 10068
113 Ga0207643_10076083 3300025908 Bacteria 1938
114 Ga0207643_10175586 3300025908 Unclassified 1295
115 Ga0207684_10000134 3300025910 Bacteria 133720
116 Ga0207707_10143194 3300025912 Bacteria 2090
117 Ga0207671_10006461 3300025914 Bacteria 10437
118 Ga0207693_10004810 3300025915 Bacteria 11361
119 Ga0207693_10012513 3300025915 Bacteria 6854
120 Ga0207693_10116080 3300025915 Bacteria 2102
121 Ga0207663_10130621 3300025916 Bacteria 1735
122 Ga0207660_10027797 3300025917 Bacteria 3864
123 Ga0207660_10113853 3300025917 Bacteria 2039
124 Ga0207662_10002285 3300025918 Bacteria 9594
125 Ga0207662_10069808 3300025918 Bacteria 2124
126 Ga0207646_10195512 3300025922 Bacteria 1826
127 Ga0207646_10381102 3300025922 Bacteria 1274
128 Ga0207681_10023298 3300025923 Bacteria 3958
129 Ga0207650_10028546 3300025925 Bacteria 4002
130 Ga0207650_10487525 3300025925 Bacteria 1029
131 Ga0207659_10350407 3300025926 Bacteria 1225
132 Ga0207700_10402999 3300025928 Bacteria 1199
133 Ga0207664_10140691 3300025929 Bacteria 2041
134 Ga0207644_10032780 3300025931 Bacteria 3627
135 Ga0207706_10015447 3300025933 Bacteria 6897
136 Ga0207691_10010561 3300025940 Bacteria 8859
137 Ga0207711_10112494 3300025941 Bacteria 2423
138 Ga0207689_10092161 3300025942 Bacteria 2489
139 Ga0207667_10388294 3300025949 Bacteria 1422
140 Ga0207667_10512287 3300025949 Bacteria 1216
141 Ga0207651_10000256 3300025960 Bacteria 22904
142 Ga0207712_10005523 3300025961 Bacteria 7976
143 Ga0207712_10071957 3300025961 Bacteria 2488
144 Ga0207658_10325019 3300025986 Unclassified 1332
145 Ga0207658_10343892 3300025986 Bacteria 1297
146 Ga0207677_10137202 3300026023 Unclassified 1867
147 Ga0207677_10457197 3300026023 Unclassified 1095
148 Ga0207703_10307907 3300026035 Bacteria 1447
149 Ga0207678_10072620 3300026067 Bacteria 2948
150 Ga0207678_10107279 3300026067 Bacteria 2382
151 Ga0207708_10004266 3300026075 Bacteria 10528
152 Ga0207641_10088104 3300026088 Bacteria 2710
153 Ga0207648_10138342 3300026089 Bacteria 2146
154 Ga0207676_10096945 3300026095 Bacteria 2435
155 Ga0207676_10138912 3300026095 Bacteria 2077
156 Ga0207674_10061949 3300026116 Bacteria 3779
157 Ga0207683_10051656 3300026121 Bacteria 3602
158 Ga0207698_10000704 3300026142 Bacteria 19424
159 Ga0209813_10003714 3300027866 Bacteria 3596
160 Ga0268265_10008732 3300028380 Bacteria 6851
161 Ga0268265_10076565 3300028380 Bacteria 2624
162 Ga0268264_10023621 3300028381 Bacteria 5014
163 Ga0265760_10015759 3300031090 Bacteria 2168
164 Ga0265339_10000091 3300031249 Bacteria 75937
165 Ga0265327_10018777 3300031251 Bacteria 4274
166 Ga0265316_10194060 3300031344 Bacteria 1507
167 Ga0265313_10000260 3300031595 Bacteria 57581
168 Ga0315911_1000009 3300033442 Bacteria 379354
169 Ga0373926_0008286 3300035083 Bacteria 3458
170 Ga0373926_0012095 3300035083 Bacteria 2914
171 Ga0373945_0007196 3300035116 Bacteria 3602
172 Ga0373943_0000716 3300035170 Bacteria 14508
173 Ga0373935_0035421 3300035692 Bacteria 3115
174 Ga0373935_0129814 3300035692 Bacteria 1692
175 Ga0373927_0398418 3300035695 Bacteria 908
176 Ga0373947_0002242 3300035725 Bacteria 11693
177 Ga0373937_0005017 3300036401 Bacteria 11266
178 Ga0373937_0070516 3300036401 Bacteria 3224
179 Ga0372808_010078 3300036459 Bacteria 1325
180 Ga0373925_0000957 3300037068 Bacteria 26248
181 Ga0436365_0718892 3300039437 Bacteria 3335
182 Ga0439452_024338 3300042010 Bacteria 1549
183 Ga0466966_0044969 3300044684 Bacteria 2824
184 Ga0466957_0061030 3300044842 Bacteria 2313
185 Ga0466959_0021191 3300045049 Bacteria 4792
186 Ga0466958_0076758 3300045836 Bacteria 2051
187 Ga0495592_0066979 3300046454 Bacteria 2626
188 Ga0495653_0184718 3300046463 Bacteria 1427
189 Ga0495582_0085362 3300046473 Bacteria 1756
190 Ga0495662_0014128 3300046476 Bacteria 3885
191 Ga0495662_0196387 3300046476 Bacteria 994
192 Ga0495664_0005349 3300046477 Bacteria 7045
193 Ga0495606_0002520 3300046507 Bacteria 21082
194 Ga0495618_0001619 3300046514 Bacteria 15047
195 Ga0495630_0008748 3300046517 Bacteria 7273
196 Ga0495630_0022631 3300046517 Bacteria 4643
197 Ga0495630_0152509 3300046517 Bacteria 1758
198 Ga0495666_0040017 3300046526 Bacteria 2274
199 Ga0495652_0024740 3300046529 Bacteria 5314
200 Ga0495652_0050113 3300046529 Bacteria 3572
201 Ga0495665_0044494 3300046531 Bacteria 2359
202 Ga0495640_0121122 3300046533 Bacteria 1701
203 Ga0495587_0215698 3300046536 Bacteria 1083
204 Ga0495645_0010106 3300046543 Bacteria 6612
205 Ga0495634_0034378 3300046642 Bacteria 3479
206 Ga0495634_0165764 3300046642 Bacteria 1391
207 Ga0495635_0000394 3300046663 Bacteria 27871
208 Ga0495635_0214682 3300046663 Bacteria 1302
209 Ga0495657_0202355 3300046675 Bacteria 1210
210 Ga0495646_0034564 3300046680 Bacteria 3139
211 Ga0495658_0228473 3300046683 Bacteria 1166
212 Ga0495613_0047924 3300046689 Bacteria 3156
213 Ga0495624_0029081 3300046690 Bacteria 3607
214 Ga0495600_0068691 3300046809 Bacteria 2316
215 Ga0495581_0077734 3300047315 Bacteria 1920
216 Ga0495674_0040811 3300047319 Bacteria 4148
217 Ga0495674_0119325 3300047319 Bacteria 2229
218 Ga0495676_0039309 3300047321 Bacteria 3919
219 Ga0495684_0007879 3300047471 Bacteria 8244
220 Ga0495684_0134936 3300047471 Bacteria 1852
221 Ga0495686_0148410 3300047472 Bacteria 1378
222 Ga0495602_0100118 3300048088 Bacteria 2381
223 Ga0496102_0240513 3300048905 Bacteria 1707
224 Ga0496103_0026067 3300048906 Bacteria 3537
225 Ga0496104_0114369 3300048907 Bacteria 2588
226 Ga0496105_0049721 3300048908 Bacteria 3462
227 Ga0496106_0069519 3300048909 Bacteria 2688
228 Ga0496106_0138841 3300048909 Bacteria 1911
229 Ga0496107_0003084 3300048910 Bacteria 11064
230 Ga0496108_0637648 3300048911 Unclassified 927
231 Ga0496112_0000004 3300048915 Bacteria 553294
232 Ga0496114_0111751 3300048917 Bacteria 2342
233 Ga0496121_0089214 3300048924 Bacteria 2415
234 Ga0496126_0046716 3300048929 Bacteria 3968
235 Ga0496126_0465014 3300048929 Bacteria 1016
236 Ga0501033_0053337 3300049570 Bacteria 2995
237 Ga0501073_0233334 3300049589 Bacteria 1271
238 Ga0501216_000416 3300049660 Bacteria 4979
239 Ga0501227_002360 3300049665 Bacteria 4177
240 Ga0501230_001501 3300049667 Bacteria 2799
241 Ga0501236_003688 3300049670 Unclassified 1794
242 Ga0501225_0000546 3300049705 Bacteria 11751
243 Ga0501035_0107298 3300049822 Bacteria 2448
244 Ga0501044_0153008 3300049823 Bacteria 2288
245 nmdc:mga03683_10322_c1 3300050489 Bacteria 3347
246 nmdc:mga03n38_6092_c1 3300050490 Bacteria 4165
247 nmdc:mga00v17_12903_c1 3300050491 Bacteria 4624
248 nmdc:mga00v17_177144_c1 3300050491 Bacteria 1376
249 nmdc:mga0yw44_92230_c1 3300050492 Bacteria 1917
250 nmdc:mga0k408_2359_c1 3300050493 Bacteria 10046
251 nmdc:mga06z11_55246_c1 3300050494 Bacteria 2050
252 nmdc:mga04h51_4091_c1 3300050495 Bacteria 3595
253 nmdc:mga05p37_16013_c1 3300050507 Bacteria 9023
254 nmdc:mga09592_109281_c1 3300050508 Bacteria 2372
255 nmdc:mga0qj67_116468_c1 3300050509 Bacteria 2159
256 nmdc:mga0qj67_172641_c1 3300050509 Bacteria 1756
257 nmdc:mga06r32_198609_c1 3300050510 Bacteria 1993
258 nmdc:mga0rr50_29929_c1 3300050513 Bacteria 3847
259 nmdc:mga08x19_170020_c1 3300050514 Bacteria 1484
260 nmdc:mga08x19_6_c1 3300050514 Bacteria 405679
261 nmdc:mga0a205_146083_c1 3300050515 Bacteria 2265
262 nmdc:mga0sz30_136387_c1 3300050516 Bacteria 1083
263 Ga0495601_0188690 3300053077 Bacteria 1347
264 Ga0495601_0238762 3300053077 Bacteria 1186
265 Ga0495612_0000175 3300053078 Bacteria 26975
266 Ga0495612_0070288 3300053078 Bacteria 1459
267 Ga0495595_0004596 3300053084 Bacteria 5551
268 Ga0495619_0005097 3300053085 Bacteria 8345
269 Ga0495619_0008018 3300053085 Bacteria 6683
270 Ga0495619_0023782 3300053085 Bacteria 3927
271 Ga0500641_0032053 3300053096 Bacteria 2076
272 2513661909 2513237096 Bacteria 8722461
273 2513857464 2513237137 Bacteria 9558895
274 2513923500 2513237145 Bacteria 8979722
275 2517893422 2517572143 Bacteria 9484767
276 2728747809 2728368998 Bacteria 8720350
277 2903755586 2903748898 Bacteria 9972761
278 2904696741 2904690495 Bacteria 9412302
279 2906640640 2906635258 Bacteria 8601019
280 2906665859 2906660503 Bacteria 8595048
281 2908761528 2908756301 Bacteria 8864324
282 Ga0496102_0274846
283 JGI25406J46586_10000047
284 Ga0070676_10150368
285 Ga0070690_100095083
286 Ga0070690_100218983
287 Ga0070670_100431992
288 Ga0068869_100032132
289 Ga0070680_100034709
290 Ga0068868_100077803
291 Ga0068868_100163824
292 Ga0070691_10073419
293 Ga0070687_100002611
294 Ga0070668_100045920
295 Ga0070675_100005596
296 Ga0070671_100052514
297 Ga0070673_100003748
298 Ga0070703_10012021
299 Ga0070714_100098462
300 Ga0070714_100570632
301 Ga0070711_100348792
302 Ga0070705_100000010
303 Ga0070700_100013553
304 Ga0070694_100020105
305 Ga0070663_100048014
306 Ga0070663_100197187
307 Ga0070678_100026924
308 Ga0070662_100001808
309 Ga0070662_100316324
310 Ga0070706_100001257
311 Ga0070706_100128222
312 Ga0070706_100170406
313 Ga0070707_100013676
314 Ga0070707_100112645
315 Ga0070698_100085639
316 Ga0070699_100014187
317 Ga0070679_100081294
318 Ga0070697_100017620
319 Ga0070697_100020828
320 Ga0070697_100021508
321 Ga0070672_100036504
322 Ga0070695_100003318
323 Ga0070696_100020740
324 Ga0070693_100086406
325 Ga0070704_100002486
326 Ga0070704_100595490
327 Ga0068855_100391387
328 Ga0068855_100422847
329 Ga0068855_100460629
330 Ga0068855_100644428
331 Ga0068857_100043244
332 Ga0068856_100052960
333 Ga0068852_100021219
334 Ga0068852_100485978
335 Ga0068859_100036318
336 Ga0068864_100111846
337 Ga0068864_100177041
338 Ga0068861_100098199
339 Ga0068861_100273729
340 Ga0068851_10004557
341 Ga0068870_10081891
342 Ga0068858_100335586
343 Ga0068860_100006603
344 Ga0068860_100226149
345 Ga0068862_100016006
346 Ga0068862_100066837
347 Ga0075365_10010347
348 Ga0075368_10008405
349 Ga0075363_100002932
350 Ga0075364_10029764
351 Ga0075364_10049584
352 Ga0070712_100002508
353 Ga0070712_100014504
354 Ga0070712_100095776
355 Ga0075362_10006012
356 Ga0075367_10010139
357 Ga0075369_10018434
358 Ga0075366_10005127
359 Ga0068871_100060726
360 Ga0075428_100053554
361 Ga0075428_100690480
362 Ga0075430_100142243
363 Ga0075431_100187337
364 Ga0075433_10330180
365 Ga0075429_100168068
366 Ga0075436_100001731
367 Ga0075436_100296508
368 Ga0097620_100036317
369 Ga0105240_10000396
370 Ga0111539_10049013
371 Ga0111539_10063340
372 Ga0114129_10019905
373 Ga0114129_10291187
374 Ga0114129_10592742
375 Ga0105243_10696761
376 Ga0105242_10140282
377 Ga0105248_10119995
378 Ga0105237_10000052
379 Ga0105249_10004673
380 Ga0105249_10005057
381 Ga0105239_10015340
382 Ga0105239_10276680
383 Ga0157378_10190677
384 Ga0157378_10296201
385 Ga0163162_10028449
386 Ga0163162_10076448
387 Ga0157375_10014480
388 Ga0157375_10274729
389 Ga0163163_10367661
390 Ga0157380_10179770
391 Ga0207697_10002339
392 Ga0207656_10002403
393 Ga0207645_10004682
394 Ga0207643_10076083
395 Ga0207643_10175586
396 Ga0207684_10000134
397 Ga0207707_10143194
398 Ga0207671_10006461
399 Ga0207693_10004810
400 Ga0207693_10012513
401 Ga0207693_10116080
402 Ga0207663_10130621
403 Ga0207660_10027797
404 Ga0207660_10113853
405 Ga0207662_10002285
406 Ga0207662_10069808
407 Ga0207646_10195512
408 Ga0207646_10381102
409 Ga0207681_10023298
410 Ga0207650_10028546
411 Ga0207650_10487525
412 Ga0207659_10350407
413 Ga0207700_10402999
414 Ga0207664_10140691
415 Ga0207644_10032780
416 Ga0207706_10015447
417 Ga0207691_10010561
418 Ga0207711_10112494
419 Ga0207689_10092161
420 Ga0207667_10388294
421 Ga0207667_10512287
422 Ga0207651_10000256
423 Ga0207712_10005523
424 Ga0207712_10071957
425 Ga0207658_10325019
426 Ga0207658_10343892
427 Ga0207677_10137202
428 Ga0207677_10457197
429 Ga0207703_10307907
430 Ga0207678_10072620
431 Ga0207678_10107279
432 Ga0207708_10004266
433 Ga0207641_10088104
434 Ga0207648_10138342
435 Ga0207676_10096945
436 Ga0207676_10138912
437 Ga0207674_10061949
438 Ga0207683_10051656
439 Ga0207698_10000704
440 Ga0209813_10003714
441 Ga0268265_10008732
442 Ga0268265_10076565
443 Ga0268264_10023621
444 Ga0265760_10015759
445 Ga0265339_10000091
446 Ga0265327_10018777
447 Ga0265316_10194060
448 Ga0265313_10000260
449 Ga0315911_1000009
450 Ga0373926_0008286
451 Ga0373926_0012095
452 Ga0373945_0007196
453 Ga0373943_0000716
454 Ga0373935_0035421
455 Ga0373935_0129814
456 Ga0373927_0398418
457 Ga0373947_0002242
458 Ga0373937_0005017
459 Ga0373937_0070516
460 Ga0372808_010078
461 Ga0373925_0000957
462 Ga0436365_0718892
463 Ga0439452_024338
464 Ga0466966_0044969
465 Ga0466957_0061030
466 Ga0466959_0021191
467 Ga0466958_0076758
468 Ga0495592_0066979
469 Ga0495653_0184718
470 Ga0495582_0085362
471 Ga0495662_0014128
472 Ga0495662_0196387
473 Ga0495664_0005349
474 Ga0495606_0002520
475 Ga0495618_0001619
476 Ga0495630_0008748
477 Ga0495630_0022631
478 Ga0495630_0152509
479 Ga0495666_0040017
480 Ga0495652_0024740
481 Ga0495652_0050113
482 Ga0495665_0044494
483 Ga0495640_0121122
484 Ga0495587_0215698
485 Ga0495645_0010106
486 Ga0495634_0034378
487 Ga0495634_0165764
488 Ga0495635_0000394
489 Ga0495635_0214682
490 Ga0495657_0202355
491 Ga0495646_0034564
492 Ga0495658_0228473
493 Ga0495613_0047924
494 Ga0495624_0029081
495 Ga0495600_0068691
496 Ga0495581_0077734
497 Ga0495674_0040811
498 Ga0495674_0119325
499 Ga0495676_0039309
500 Ga0495684_0007879
501 Ga0495684_0134936
502 Ga0495686_0148410
503 Ga0495602_0100118
504 Ga0496102_0240513
505 Ga0496103_0026067
506 Ga0496104_0114369
507 Ga0496105_0049721
508 Ga0496106_0069519
509 Ga0496106_0138841
510 Ga0496107_0003084
511 Ga0496108_0637648
512 Ga0496112_0000004
513 Ga0496114_0111751
514 Ga0496121_0089214
515 Ga0496126_0046716
516 Ga0496126_0465014
517 Ga0501033_0053337
518 Ga0501073_0233334
519 Ga0501216_000416
520 Ga0501227_002360
521 Ga0501230_001501
522 Ga0501236_003688
523 Ga0501225_0000546
524 Ga0501035_0107298
525 Ga0501044_0153008
526 nmdc:mga03683_10322_c1
527 nmdc:mga03n38_6092_c1
528 nmdc:mga00v17_12903_c1
529 nmdc:mga00v17_177144_c1
530 nmdc:mga0yw44_92230_c1
531 nmdc:mga0k408_2359_c1
532 nmdc:mga06z11_55246_c1
533 nmdc:mga04h51_4091_c1
534 nmdc:mga05p37_16013_c1
535 nmdc:mga09592_109281_c1
536 nmdc:mga0qj67_116468_c1
537 nmdc:mga0qj67_172641_c1
538 nmdc:mga06r32_198609_c1
539 nmdc:mga0rr50_29929_c1
540 nmdc:mga08x19_170020_c1
541 nmdc:mga08x19_6_c1
542 nmdc:mga0a205_146083_c1
543 nmdc:mga0sz30_136387_c1
544 Ga0495601_0188690
545 Ga0495601_0238762
546 Ga0495612_0000175
547 Ga0495612_0070288
548 Ga0495595_0004596
549 Ga0495619_0005097
550 Ga0495619_0008018
551 Ga0495619_0023782
552 Ga0500641_0032053
553 2513661909
554 2513857464
555 2513923500
556 2517893422
557 2728747809
558 2903755586
559 2904696741
560 2906640640
561 2906665859
562 2908761528

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13714

PEP_mutase

Phosphoenolpyruvate phosphomutase

40

278

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lsb-assembly1.cif.gz_A crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.97 5 272
4lsb-assembly1.cif.gz_B crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.959 5 272
4lsb-assembly1.cif.gz_A crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.9525 5 272
4lsb-assembly1.cif.gz_B crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.9418 5 272
2ze3-assembly1.cif.gz_A-2 crystal structure of dfa0005 complexed with alpha-ketoglutarate: a novel member of the icl/pepm superfamily from alkali-tolerant deinococcus ficus 0.9217 5 272
ID Description Score Start End Superfamily
4lsbB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9676 5 230 3.20.20.60
4lsbB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.947 5 230 3.20.20.60
2ze3A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9469 5 230 3.20.20.60
2ze3A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9192 5 230 3.20.20.60
af_P9WLN9_1_257_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9014 12 272 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A0R3KHZ2-F1-model_v4 2-methylisocitrate lyase 0.9975 4 270 GO:0016829
AF-A0A5S4YTZ3-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9969 1 270 GO:0016829
AF-A0A023XCN6-F1-model_v4 deleted 0.9969 1 270
AF-A0A7S7TBV2-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9968 1 270 GO:0016829
AF-A0A4Q0S370-F1-model_v4 2-methylisocitrate lyase 0.9964 1 270 GO:0016829

Map