F384406

General Info

Members Datasets Scaffolds Average Seq Length
281 138 277 114

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_101367149|Ga0307416_1013671492
Length 122
Sequence MLDATEVDLFAGVPVADYAAALQWYERLLGSAPSFFPHDTEAVWELAEHRYLYIVQQPEHAGHAMHTLFVDDLDTLVARIAEQGLNPAKQETYSNGVRKITYRDADGNEIGFGGAPLQPAAG

Samples

Sample ID Description Type Environment
1 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
2 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
3 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
4 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
31 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
32 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
42 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
43 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
44 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
45 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
46 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
47 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
48 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
49 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
50 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
51 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
52 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
53 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
54 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
55 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
56 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
57 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
58 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
59 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
60 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
61 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
62 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
63 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
64 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
65 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
66 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
67 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
68 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
69 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
70 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
71 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
74 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
75 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
76 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
77 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
78 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
79 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
80 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
81 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
82 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
83 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
84 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
85 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
86 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
87 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
88 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
89 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
90 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
91 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
92 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
93 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
94 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
95 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
96 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
97 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
98 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
99 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
100 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
101 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
102 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
103 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
104 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
105 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
106 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
107 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
108 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
109 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
110 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
111 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
112 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
113 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
114 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
115 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
116 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
117 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
118 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
119 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
120 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
121 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
122 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
123 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
124 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
125 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
126 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
129 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
130 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
131 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
132 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
133 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
134 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
135 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
136 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
137 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
138 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.58
Metatranscriptomes 0
Isolates 1.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.85
Nodule 0
Rhizoplane 0
Rhizosphere 91.46
Stem 0
Stem Tuber 0
Unclassified 5.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10025715 3300003373 Bacteria 1526
2 Ga0070683_100032222 3300005329 Bacteria 4773
3 Ga0070682_100154302 3300005337 Bacteria 1579
4 Ga0070660_100110945 3300005339 Bacteria 2182
5 Ga0070675_101609653 3300005354 Bacteria 599
6 Ga0070709_10155037 3300005434 Bacteria 1587
7 Ga0070714_100452102 3300005435 Bacteria 1220
8 Ga0070714_101664999 3300005435 Bacteria 623
9 Ga0070713_100031894 3300005436 Bacteria 4202
10 Ga0070713_100430735 3300005436 Bacteria 1236
11 Ga0070713_100631819 3300005436 Bacteria 1019
12 Ga0070713_100998209 3300005436 Bacteria 807
13 Ga0070708_100140970 3300005445 Bacteria 2235
14 Ga0070708_100852402 3300005445 Bacteria 856
15 Ga0070681_10162906 3300005458 Unclassified 2154
16 Ga0070681_11354944 3300005458 Bacteria 635
17 Ga0070706_100001303 3300005467 Bacteria 26606
18 Ga0070706_100008055 3300005467 Bacteria 9832
19 Ga0070706_100592887 3300005467 Unclassified 1030
20 Ga0070707_100156720 3300005468 Bacteria 2218
21 Ga0070707_100280197 3300005468 Bacteria 1620
22 Ga0070707_100945397 3300005468 Unclassified 827
23 Ga0070698_100019679 3300005471 Bacteria 7081
24 Ga0070698_100033884 3300005471 Bacteria 5290
25 Ga0070698_100203256 3300005471 Bacteria 1916
26 Ga0070699_100129141 3300005518 Bacteria 2227
27 Ga0070699_100374544 3300005518 Unclassified 1285
28 Ga0070679_100392483 3300005530 Bacteria 1334
29 Ga0070684_100066784 3300005535 Bacteria 3157
30 Ga0070684_100231314 3300005535 Bacteria 1688
31 Ga0070697_100120892 3300005536 Bacteria 2190
32 Ga0081538_10005771 3300005981 Bacteria 11045
33 Ga0081538_10010106 3300005981 Bacteria 7764
34 Ga0070717_10043387 3300006028 Bacteria 3670
35 Ga0070717_10123962 3300006028 Bacteria 2216
36 Ga0070717_10506046 3300006028 Unclassified 1092
37 Ga0075365_10255889 3300006038 Bacteria 1231
38 Ga0070712_100555458 3300006175 Bacteria 968
39 Ga0070712_100679327 3300006175 Bacteria 876
40 Ga0075367_10183449 3300006178 Bacteria 1305
41 Ga0075370_10644038 3300006353 Unclassified 643
42 Ga0114129_10264737 3300009147 Bacteria 2302
43 Ga0105238_10835173 3300009551 Bacteria 938
44 Ga0163163_11458068 3300014325 Bacteria 746
45 Ga0213876_10018848 3300021384 Bacteria 3644
46 Ga0207699_10590507 3300025906 Bacteria 808
47 Ga0207705_10753146 3300025909 Bacteria 757
48 Ga0207684_10001370 3300025910 Bacteria 26621
49 Ga0207684_10009357 3300025910 Bacteria 8655
50 Ga0207707_10205691 3300025912 Bacteria 1716
51 Ga0207707_10209216 3300025912 Bacteria 1700
52 Ga0207693_10472497 3300025915 Bacteria 979
53 Ga0207646_10001108 3300025922 Bacteria 34362
54 Ga0207646_10335048 3300025922 Bacteria 1367
55 Ga0207700_10017127 3300025928 Bacteria 4832
56 Ga0207700_10323871 3300025928 Bacteria 1336
57 Ga0207700_10386953 3300025928 Bacteria 1224
58 Ga0207664_10551796 3300025929 Bacteria 1034
59 Ga0207661_10056646 3300025944 Bacteria 3147
60 Ga0307517_10109411 3300028786 Bacteria 2114
61 Ga0307515_10078800 3300028794 Bacteria 4326
62 Ga0307512_10053729 3300030522 Bacteria 3200
63 Ga0307513_10028172 3300031456 Bacteria 6427
64 Ga0307513_10035889 3300031456 Bacteria 5540
65 Ga0307513_10061808 3300031456 Bacteria 3962
66 Ga0307513_10107808 3300031456 Bacteria 2788
67 Ga0307408_100666343 3300031548 Bacteria 932
68 Ga0307408_101297296 3300031548 Bacteria 682
69 Ga0307508_10122010 3300031616 Bacteria 2209
70 Ga0307514_10061607 3300031649 Bacteria 2856
71 Ga0307413_10266115 3300031824 Bacteria 1281
72 Ga0307406_10743158 3300031901 Bacteria 823
73 Ga0307409_101176441 3300031995 Bacteria 790
74 Ga0307409_101210830 3300031995 Bacteria 779
75 Ga0307416_100784442 3300032002 Bacteria 1048
76 Ga0307416_101367149 3300032002 Bacteria 814
77 Ga0307416_103825255 3300032002 Bacteria 504
78 Ga0307415_100452404 3300032126 Bacteria 1110
79 Ga0307415_102579613 3300032126 Bacteria 501
80 Ga0373934_0040212 3300035086 Bacteria 1844
81 Ga0373944_0253444 3300035089 Bacteria 650
82 Ga0373949_0017038 3300035090 Bacteria 1635
83 Ga0373923_0064391 3300035111 Bacteria 1563
84 Ga0373923_0110178 3300035111 Bacteria 1222
85 Ga0373936_0123874 3300035113 Bacteria 1106
86 Ga0373936_0179836 3300035113 Bacteria 927
87 Ga0373936_0316725 3300035113 Bacteria 706
88 Ga0373945_0525075 3300035116 Bacteria 529
89 Ga0373953_0005749 3300035117 Bacteria 4046
90 Ga0373953_0098413 3300035117 Bacteria 1229
91 Ga0373954_0034772 3300035118 Bacteria 2335
92 Ga0373954_0326049 3300035118 Bacteria 758
93 Ga0373956_0010898 3300035119 Bacteria 3737
94 Ga0373956_0250677 3300035119 Bacteria 841
95 Ga0373957_0015388 3300035120 Bacteria 2632
96 Ga0373957_0079087 3300035120 Bacteria 1296
97 Ga0373957_0244886 3300035120 Bacteria 754
98 Ga0373957_0285680 3300035120 Bacteria 698
99 Ga0373943_0018345 3300035170 Bacteria 3213
100 Ga0373943_0069454 3300035170 Bacteria 1780
101 Ga0373943_0187646 3300035170 Bacteria 1139
102 Ga0373946_0039492 3300035171 Bacteria 1927
103 Ga0373946_0267059 3300035171 Bacteria 838
104 Ga0373955_0000539 3300035172 Bacteria 16055
105 Ga0373955_0042453 3300035172 Bacteria 2442
106 Ga0373924_0012555 3300035410 Bacteria 3167
107 Ga0373924_0216376 3300035410 Bacteria 846
108 Ga0373935_0091515 3300035692 Bacteria 1992
109 Ga0373935_0184927 3300035692 Bacteria 1432
110 Ga0373935_0597989 3300035692 Bacteria 806
111 Ga0373927_0633742 3300035695 Bacteria 707
112 Ga0373933_0003485 3300035724 Bacteria 8756
113 Ga0373933_0225356 3300035724 Bacteria 1203
114 Ga0373933_0227895 3300035724 Bacteria 1196
115 Ga0373947_0027818 3300035725 Bacteria 3311
116 Ga0373947_0040096 3300035725 Bacteria 2788
117 Ga0373937_0040539 3300036401 Bacteria 4245
118 Ga0373925_0047068 3300037068 Bacteria 3209
119 Ga0373925_0179864 3300037068 Bacteria 1673
120 Ga0373925_0184211 3300037068 Bacteria 1654
121 Ga0373925_0735024 3300037068 Bacteria 813
122 Ga0436364_0985746 3300037853 Bacteria 9877
123 Ga0436364_1240020 3300037853 Bacteria 1031
124 Ga0436362_0258176 3300039453 Bacteria 1058
125 Ga0451853_3889474 3300041512 Bacteria 560
126 Ga0439464_0023419 3300042439 Bacteria 1705
127 Ga0466972_0597476 3300044658 Bacteria 522
128 Ga0466963_0377519 3300044694 Unclassified 999
129 Ga0466957_0403138 3300044842 Bacteria 936
130 Ga0466957_0986589 3300044842 Bacteria 605
131 Ga0466958_0814755 3300045836 Bacteria 609
132 Ga0495592_0059698 3300046454 Bacteria 2807
133 Ga0495592_0135123 3300046454 Bacteria 1721
134 Ga0495592_0436800 3300046454 Bacteria 823
135 Ga0495603_0157931 3300046455 Bacteria 1316
136 Ga0495629_0001680 3300046459 Bacteria 17380
137 Ga0495629_0210730 3300046459 Bacteria 1342
138 Ga0495641_0159300 3300046461 Bacteria 1009
139 Ga0495651_0002530 3300046462 Bacteria 14151
140 Ga0495651_0090877 3300046462 Bacteria 2289
141 Ga0495651_0756357 3300046462 Bacteria 602
142 Ga0495653_0012778 3300046463 Bacteria 6854
143 Ga0495653_0013164 3300046463 Bacteria 6745
144 Ga0495580_0026115 3300046472 Bacteria 4261
145 Ga0495580_0587785 3300046472 Bacteria 737
146 Ga0495582_0071308 3300046473 Bacteria 1922
147 Ga0495582_0079283 3300046473 Bacteria 1823
148 Ga0495639_0084395 3300046475 Bacteria 1483
149 Ga0495639_0298467 3300046475 Bacteria 803
150 Ga0495639_0582868 3300046475 Bacteria 574
151 Ga0495662_0008485 3300046476 Bacteria 5054
152 Ga0495662_0081237 3300046476 Bacteria 1576
153 Ga0495664_0026551 3300046477 Bacteria 3372
154 Ga0495664_0070128 3300046477 Bacteria 2092
155 Ga0495594_0238833 3300046499 Bacteria 1036
156 Ga0495608_0008526 3300046511 Bacteria 7180
157 Ga0495608_0010494 3300046511 Bacteria 6464
158 Ga0495608_0013387 3300046511 Bacteria 5689
159 Ga0495608_0395130 3300046511 Bacteria 846
160 Ga0495618_0046730 3300046514 Bacteria 2732
161 Ga0495618_0169340 3300046514 Bacteria 1390
162 Ga0495618_0264484 3300046514 Bacteria 1076
163 Ga0495618_0326135 3300046514 Bacteria 950
164 Ga0495628_0081193 3300046516 Bacteria 2518
165 Ga0495628_0384813 3300046516 Bacteria 1027
166 Ga0495630_0006547 3300046517 Bacteria 8297
167 Ga0495630_0027354 3300046517 Bacteria 4230
168 Ga0495630_0093771 3300046517 Bacteria 2269
169 Ga0495630_0299564 3300046517 Bacteria 1229
170 Ga0495666_0003867 3300046526 Bacteria 7579
171 Ga0495666_0091428 3300046526 Bacteria 1436
172 Ga0495652_0010789 3300046529 Bacteria 8281
173 Ga0495652_0117519 3300046529 Bacteria 2127
174 Ga0495652_0147436 3300046529 Bacteria 1842
175 Ga0495665_0004651 3300046531 Bacteria 7404
176 Ga0495665_0022258 3300046531 Bacteria 3407
177 Ga0495665_0038195 3300046531 Bacteria 2561
178 Ga0495640_0010519 3300046533 Bacteria 7143
179 Ga0495640_0012231 3300046533 Bacteria 6568
180 Ga0495640_0017038 3300046533 Bacteria 5422
181 Ga0495640_0508375 3300046533 Bacteria 733
182 Ga0495586_0049009 3300046535 Bacteria 2283
183 Ga0495587_0004440 3300046536 Bacteria 9245
184 Ga0495587_0247274 3300046536 Bacteria 1003
185 Ga0495587_0256520 3300046536 Bacteria 983
186 Ga0495645_0025880 3300046543 Bacteria 4259
187 Ga0495645_0083915 3300046543 Bacteria 2282
188 Ga0495645_0230541 3300046543 Bacteria 1241
189 Ga0495667_0016314 3300046559 Bacteria 5019
190 Ga0495667_0027819 3300046559 Bacteria 3807
191 Ga0495667_0199188 3300046559 Bacteria 1282
192 Ga0495634_0017406 3300046642 Bacteria 5127
193 Ga0495634_0019806 3300046642 Bacteria 4776
194 Ga0495634_0026289 3300046642 Bacteria 4063
195 Ga0495635_0005593 3300046663 Bacteria 8754
196 Ga0495635_0008144 3300046663 Bacteria 7322
197 Ga0495635_0012877 3300046663 Bacteria 5856
198 Ga0495635_0303348 3300046663 Bacteria 1070
199 Ga0495588_0308592 3300046674 Bacteria 833
200 Ga0495657_0007634 3300046675 Bacteria 8330
201 Ga0495657_0062772 3300046675 Bacteria 2453
202 Ga0495657_0848645 3300046675 Bacteria 520
203 Ga0495599_0010620 3300046678 Bacteria 5636
204 Ga0495599_0010693 3300046678 Bacteria 5618
205 Ga0495599_0163790 3300046678 Bacteria 1374
206 Ga0495623_0051483 3300046679 Bacteria 2605
207 Ga0495623_0110965 3300046679 Bacteria 1662
208 Ga0495646_0018725 3300046680 Bacteria 4386
209 Ga0495646_0099675 3300046680 Bacteria 1667
210 Ga0495647_0152785 3300046681 Bacteria 991
211 Ga0495647_0285267 3300046681 Bacteria 741
212 Ga0495658_0039405 3300046683 Bacteria 2621
213 Ga0495613_0031549 3300046689 Bacteria 3936
214 Ga0495613_0092082 3300046689 Bacteria 2195
215 Ga0495624_0039620 3300046690 Bacteria 3020
216 Ga0495624_0115486 3300046690 Bacteria 1650
217 Ga0495624_0133222 3300046690 Bacteria 1523
218 Ga0495624_0192551 3300046690 Bacteria 1240
219 Ga0495600_0016047 3300046809 Bacteria 4748
220 Ga0495600_0146692 3300046809 Bacteria 1529
221 Ga0495600_0407372 3300046809 Bacteria 845
222 Ga0495581_0003352 3300047315 Bacteria 9196
223 Ga0495581_0188587 3300047315 Bacteria 1206
224 Ga0495604_0022884 3300047317 Bacteria 4987
225 Ga0495604_0022983 3300047317 Bacteria 4975
226 Ga0495604_0092527 3300047317 Bacteria 2240
227 Ga0495604_0584793 3300047317 Bacteria 717
228 Ga0495674_0002505 3300047319 Bacteria 17886
229 Ga0495674_0060720 3300047319 Bacteria 3297
230 Ga0495674_0153855 3300047319 Bacteria 1927
231 Ga0495674_0361770 3300047319 Bacteria 1176
232 Ga0495676_0027680 3300047321 Bacteria 4857
233 Ga0495676_0051370 3300047321 Bacteria 3299
234 Ga0495676_0202426 3300047321 Bacteria 1379
235 Ga0495676_0278168 3300047321 Bacteria 1134
236 Ga0495680_0011869 3300047322 Bacteria 7688
237 Ga0495680_0020765 3300047322 Bacteria 5514
238 Ga0495680_0040307 3300047322 Bacteria 3721
239 Ga0495680_0064311 3300047322 Bacteria 2813
240 Ga0495680_0122744 3300047322 Bacteria 1916
241 Ga0495680_0740671 3300047322 Bacteria 646
242 Ga0495675_0050731 3300047444 Bacteria 2637
243 Ga0495675_0182171 3300047444 Bacteria 1285
244 Ga0495675_0801750 3300047444 Bacteria 521
245 Ga0495684_0006502 3300047471 Bacteria 9072
246 Ga0495684_0023445 3300047471 Bacteria 4744
247 Ga0495684_0043659 3300047471 Bacteria 3433
248 Ga0495684_0092991 3300047471 Bacteria 2284
249 Ga0495684_0277865 3300047471 Bacteria 1209
250 Ga0495593_0008628 3300047673 Bacteria 5926
251 Ga0495593_0225754 3300047673 Bacteria 939
252 Ga0495593_0237229 3300047673 Bacteria 914
253 Ga0495602_0017067 3300048088 Bacteria 7282
254 Ga0495602_0077317 3300048088 Bacteria 2816
255 Ga0495614_0115971 3300048089 Bacteria 1178
256 Ga0501034_0309266 3300049571 Bacteria 1515
257 Ga0501067_0066071 3300049583 Unclassified 2002
258 Ga0501072_0041415 3300049588 Bacteria 3618
259 Ga0501074_0833381 3300049590 Bacteria 650
260 nmdc:mga03n38_25802_c1 3300050490 Bacteria 2419
261 nmdc:mga03n38_278407_c1 3300050490 Bacteria 892
262 nmdc:mga00v17_379087_c1 3300050491 Bacteria 919
263 nmdc:mga0sz30_557159_c1 3300050516 Bacteria 517
264 Ga0495601_0022996 3300053077 Bacteria 3830
265 Ga0495601_0067591 3300053077 Bacteria 2277
266 Ga0495601_0252202 3300053077 Bacteria 1152
267 Ga0495601_0966434 3300053077 Bacteria 536
268 Ga0495601_0969851 3300053077 Bacteria 535
269 Ga0495612_0007975 3300053078 Bacteria 4316
270 Ga0495612_0092822 3300053078 Bacteria 1280
271 Ga0495612_0507039 3300053078 Bacteria 554
272 Ga0495595_0003046 3300053084 Bacteria 6625
273 Ga0495595_0035362 3300053084 Bacteria 2263
274 Ga0495619_0019714 3300053085 Bacteria 4290
275 Ga0495619_0074144 3300053085 Bacteria 2281
276 Ga0495619_0215030 3300053085 Bacteria 1331
277 Ga0500568_0000136 3300053139 Bacteria 65902

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005436 Ga0070713_100430735 Ga0070713_1004307352 97
2 3300005468 Ga0070707_100280197 Ga0070707_1002801972 101
3 3300025922 Ga0207646_10335048 Ga0207646_103350482 101
4 3300035090 Ga0373949_0017038 Ga0373949_0017038_584_925 107
5 iso_pu_bacteria 2862507626 2862509830 109
6 iso_pu_bacteria 2990059506 2990066597 109
7 3300005354 Ga0070675_101609653 Ga0070675_1016096532 110
8 3300014325 Ga0163163_11458068 Ga0163163_114580682 110
9 3300041512 Ga0451853_3889474 Ga0451853_3889474_195_530 110
10 3300049583 Ga0501067_0066071 Ga0501067_0066071_369_716 110
11 3300021384 Ga0213876_10018848 Ga0213876_100188483 111
12 3300031456 Ga0307513_10107808 Ga0307513_101078081 111
13 3300049588 Ga0501072_0041415 Ga0501072_0041415_1559_1909 111
14 3300049590 Ga0501074_0833381 Ga0501074_0833381_58_408 111
15 3300050490 nmdc:mga03n38_278407_c1 nmdc:mga03n38_278407_c1_167_505 111
16 iso_pu_bacteria 2675903058 2676476603 111
17 iso_pu_bacteria 2867346516 2867346584 111
18 3300005329 Ga0070683_100032222 Ga0070683_1000322225 112
19 3300005339 Ga0070660_100110945 Ga0070660_1001109452 112
20 3300005435 Ga0070714_101664999 Ga0070714_1016649991 112
21 3300005436 Ga0070713_100031894 Ga0070713_1000318944 112
22 3300005445 Ga0070708_100140970 Ga0070708_1001409705 112
23 3300005445 Ga0070708_100852402 Ga0070708_1008524021 112
24 3300005458 Ga0070681_10162906 Ga0070681_101629063 112
25 3300005467 Ga0070706_100001303 Ga0070706_10000130310 112
26 3300005467 Ga0070706_100008055 Ga0070706_1000080558 112
27 3300005467 Ga0070706_100592887 Ga0070706_1005928872 112
28 3300005468 Ga0070707_100156720 Ga0070707_1001567201 112
29 3300005468 Ga0070707_100945397 Ga0070707_1009453972 112
30 3300005471 Ga0070698_100019679 Ga0070698_1000196796 112
31 3300005471 Ga0070698_100033884 Ga0070698_1000338843 112
32 3300005471 Ga0070698_100203256 Ga0070698_1002032565 112
33 3300005518 Ga0070699_100129141 Ga0070699_1001291415 112
34 3300005518 Ga0070699_100374544 Ga0070699_1003745441 112
35 3300005530 Ga0070679_100392483 Ga0070679_1003924832 112
36 3300005535 Ga0070684_100066784 Ga0070684_1000667843 112
37 3300005535 Ga0070684_100231314 Ga0070684_1002313142 112
38 3300005536 Ga0070697_100120892 Ga0070697_1001208925 112
39 3300006028 Ga0070717_10123962 Ga0070717_101239622 112
40 3300006028 Ga0070717_10506046 Ga0070717_105060462 112
41 3300006038 Ga0075365_10255889 Ga0075365_102558893 112
42 3300006175 Ga0070712_100555458 Ga0070712_1005554582 112
43 3300009147 Ga0114129_10264737 Ga0114129_102647372 112
44 3300009551 Ga0105238_10835173 Ga0105238_108351732 112
45 3300025909 Ga0207705_10753146 Ga0207705_107531461 112
46 3300025910 Ga0207684_10001370 Ga0207684_1000137023 112
47 3300025910 Ga0207684_10009357 Ga0207684_100093578 112
48 3300025912 Ga0207707_10205691 Ga0207707_102056911 112
49 3300025912 Ga0207707_10209216 Ga0207707_102092162 112
50 3300025915 Ga0207693_10472497 Ga0207693_104724971 112
51 3300025922 Ga0207646_10001108 Ga0207646_100011081 112
52 3300025928 Ga0207700_10017127 Ga0207700_100171276 112
53 3300025929 Ga0207664_10551796 Ga0207664_105517962 112
54 3300025944 Ga0207661_10056646 Ga0207661_100566464 112
55 3300030522 Ga0307512_10053729 Ga0307512_100537292 112
56 3300031456 Ga0307513_10061808 Ga0307513_100618084 112
57 3300031548 Ga0307408_101297296 Ga0307408_1012972961 112
58 3300031649 Ga0307514_10061607 Ga0307514_100616075 112
59 3300032126 Ga0307415_102579613 Ga0307415_1025796131 112
60 3300035086 Ga0373934_0040212 Ga0373934_0040212_376_717 112
61 3300035089 Ga0373944_0253444 Ga0373944_0253444_144_485 112
62 3300035111 Ga0373923_0064391 Ga0373923_0064391_1147_1488 112
63 3300035113 Ga0373936_0123874 Ga0373936_0123874_751_1092 112
64 3300035113 Ga0373936_0179836 Ga0373936_0179836_213_554 112
65 3300035117 Ga0373953_0005749 Ga0373953_0005749_2250_2591 112
66 3300035117 Ga0373953_0098413 Ga0373953_0098413_61_402 112
67 3300035118 Ga0373954_0034772 Ga0373954_0034772_215_556 112
68 3300035118 Ga0373954_0326049 Ga0373954_0326049_38_379 112
69 3300035119 Ga0373956_0010898 Ga0373956_0010898_2948_3289 112
70 3300035119 Ga0373956_0250677 Ga0373956_0250677_57_398 112
71 3300035120 Ga0373957_0015388 Ga0373957_0015388_579_920 112
72 3300035120 Ga0373957_0285680 Ga0373957_0285680_57_398 112
73 3300035170 Ga0373943_0018345 Ga0373943_0018345_2368_2709 112
74 3300035170 Ga0373943_0069454 Ga0373943_0069454_161_502 112
75 3300035171 Ga0373946_0039492 Ga0373946_0039492_1034_1375 112
76 3300035171 Ga0373946_0267059 Ga0373946_0267059_62_403 112
77 3300035172 Ga0373955_0000539 Ga0373955_0000539_3162_3503 112
78 3300035172 Ga0373955_0042453 Ga0373955_0042453_1696_2037 112
79 3300035410 Ga0373924_0012555 Ga0373924_0012555_2786_3127 112
80 3300035410 Ga0373924_0216376 Ga0373924_0216376_444_785 112
81 3300035692 Ga0373935_0091515 Ga0373935_0091515_751_1092 112
82 3300035692 Ga0373935_0597989 Ga0373935_0597989_47_388 112
83 3300035695 Ga0373927_0633742 Ga0373927_0633742_270_611 112
84 3300035724 Ga0373933_0003485 Ga0373933_0003485_7134_7475 112
85 3300035724 Ga0373933_0227895 Ga0373933_0227895_238_579 112
86 3300035725 Ga0373947_0027818 Ga0373947_0027818_468_809 112
87 3300035725 Ga0373947_0040096 Ga0373947_0040096_2382_2723 112
88 3300036401 Ga0373937_0040539 Ga0373937_0040539_870_1211 112
89 3300037068 Ga0373925_0047068 Ga0373925_0047068_513_854 112
90 3300037068 Ga0373925_0179864 Ga0373925_0179864_173_514 112
91 3300037068 Ga0373925_0735024 Ga0373925_0735024_25_366 112
92 3300037853 Ga0436364_0985746 Ga0436364_0985746_7295_7648 112
93 3300039453 Ga0436362_0258176 Ga0436362_0258176_155_508 112
94 3300042439 Ga0439464_0023419 Ga0439464_0023419_165_506 112
95 3300044658 Ga0466972_0597476 Ga0466972_0597476_74_427 112
96 3300044694 Ga0466963_0377519 Ga0466963_0377519_525_878 112
97 3300044842 Ga0466957_0403138 Ga0466957_0403138_131_472 112
98 3300044842 Ga0466957_0986589 Ga0466957_0986589_32_385 112
99 3300045836 Ga0466958_0814755 Ga0466958_0814755_221_574 112
100 3300046454 Ga0495592_0135123 Ga0495592_0135123_1217_1558 112
101 3300046454 Ga0495592_0436800 Ga0495592_0436800_353_694 112
102 3300046459 Ga0495629_0001680 Ga0495629_0001680_690_1031 112
103 3300046461 Ga0495641_0159300 Ga0495641_0159300_331_672 112
104 3300046462 Ga0495651_0090877 Ga0495651_0090877_1063_1404 112
105 3300046463 Ga0495653_0012778 Ga0495653_0012778_5436_5777 112
106 3300046472 Ga0495580_0026115 Ga0495580_0026115_48_389 112
107 3300046472 Ga0495580_0587785 Ga0495580_0587785_284_625 112
108 3300046473 Ga0495582_0071308 Ga0495582_0071308_981_1322 112
109 3300046475 Ga0495639_0084395 Ga0495639_0084395_1053_1394 112
110 3300046475 Ga0495639_0582868 Ga0495639_0582868_220_561 112
111 3300046476 Ga0495662_0081237 Ga0495662_0081237_883_1224 112
112 3300046477 Ga0495664_0070128 Ga0495664_0070128_154_495 112
113 3300046499 Ga0495594_0238833 Ga0495594_0238833_475_816 112
114 3300046511 Ga0495608_0008526 Ga0495608_0008526_3204_3545 112
115 3300046511 Ga0495608_0013387 Ga0495608_0013387_304_645 112
116 3300046511 Ga0495608_0395130 Ga0495608_0395130_85_426 112
117 3300046514 Ga0495618_0169340 Ga0495618_0169340_1026_1367 112
118 3300046514 Ga0495618_0264484 Ga0495618_0264484_705_1046 112
119 3300046514 Ga0495618_0326135 Ga0495618_0326135_23_364 112
120 3300046516 Ga0495628_0384813 Ga0495628_0384813_327_668 112
121 3300046517 Ga0495630_0006547 Ga0495630_0006547_7095_7436 112
122 3300046517 Ga0495630_0027354 Ga0495630_0027354_2941_3282 112
123 3300046517 Ga0495630_0299564 Ga0495630_0299564_552_893 112
124 3300046526 Ga0495666_0003867 Ga0495666_0003867_6597_6938 112
125 3300046529 Ga0495652_0117519 Ga0495652_0117519_1432_1773 112
126 3300046529 Ga0495652_0147436 Ga0495652_0147436_1282_1623 112
127 3300046531 Ga0495665_0004651 Ga0495665_0004651_6675_7016 112
128 3300046531 Ga0495665_0022258 Ga0495665_0022258_3017_3358 112
129 3300046533 Ga0495640_0012231 Ga0495640_0012231_3407_3748 112
130 3300046533 Ga0495640_0017038 Ga0495640_0017038_19_360 112
131 3300046533 Ga0495640_0508375 Ga0495640_0508375_179_520 112
132 3300046535 Ga0495586_0049009 Ga0495586_0049009_1905_2246 112
133 3300046536 Ga0495587_0247274 Ga0495587_0247274_105_446 112
134 3300046536 Ga0495587_0256520 Ga0495587_0256520_274_615 112
135 3300046543 Ga0495645_0083915 Ga0495645_0083915_11_352 112
136 3300046543 Ga0495645_0230541 Ga0495645_0230541_549_890 112
137 3300046559 Ga0495667_0027819 Ga0495667_0027819_369_710 112
138 3300046559 Ga0495667_0199188 Ga0495667_0199188_685_1026 112
139 3300046642 Ga0495634_0019806 Ga0495634_0019806_4063_4404 112
140 3300046642 Ga0495634_0026289 Ga0495634_0026289_1461_1802 112
141 3300046663 Ga0495635_0005593 Ga0495635_0005593_2460_2801 112
142 3300046663 Ga0495635_0008144 Ga0495635_0008144_6935_7276 112
143 3300046663 Ga0495635_0303348 Ga0495635_0303348_287_628 112
144 3300046675 Ga0495657_0062772 Ga0495657_0062772_327_668 112
145 3300046675 Ga0495657_0848645 Ga0495657_0848645_127_468 112
146 3300046678 Ga0495599_0010620 Ga0495599_0010620_969_1310 112
147 3300046678 Ga0495599_0163790 Ga0495599_0163790_34_375 112
148 3300046679 Ga0495623_0110965 Ga0495623_0110965_770_1111 112
149 3300046680 Ga0495646_0018725 Ga0495646_0018725_1747_2088 112
150 3300046681 Ga0495647_0285267 Ga0495647_0285267_52_393 112
151 3300046683 Ga0495658_0039405 Ga0495658_0039405_1920_2261 112
152 3300046689 Ga0495613_0031549 Ga0495613_0031549_893_1234 112
153 3300046689 Ga0495613_0092082 Ga0495613_0092082_165_506 112
154 3300046690 Ga0495624_0039620 Ga0495624_0039620_1154_1495 112
155 3300046690 Ga0495624_0115486 Ga0495624_0115486_223_564 112
156 3300046690 Ga0495624_0192551 Ga0495624_0192551_749_1090 112
157 3300046809 Ga0495600_0146692 Ga0495600_0146692_1138_1479 112
158 3300046809 Ga0495600_0407372 Ga0495600_0407372_290_631 112
159 3300047315 Ga0495581_0003352 Ga0495581_0003352_8079_8420 112
160 3300047315 Ga0495581_0188587 Ga0495581_0188587_200_541 112
161 3300047317 Ga0495604_0022884 Ga0495604_0022884_3371_3712 112
162 3300047317 Ga0495604_0092527 Ga0495604_0092527_183_524 112
163 3300047317 Ga0495604_0584793 Ga0495604_0584793_211_552 112
164 3300047319 Ga0495674_0002505 Ga0495674_0002505_1437_1778 112
165 3300047319 Ga0495674_0153855 Ga0495674_0153855_346_687 112
166 3300047321 Ga0495676_0027680 Ga0495676_0027680_3244_3585 112
167 3300047321 Ga0495676_0051370 Ga0495676_0051370_1053_1394 112
168 3300047321 Ga0495676_0202426 Ga0495676_0202426_871_1212 112
169 3300047322 Ga0495680_0011869 Ga0495680_0011869_7005_7346 112
170 3300047322 Ga0495680_0020765 Ga0495680_0020765_3990_4331 112
171 3300047322 Ga0495680_0064311 Ga0495680_0064311_151_492 112
172 3300047322 Ga0495680_0122744 Ga0495680_0122744_477_818 112
173 3300047322 Ga0495680_0740671 Ga0495680_0740671_89_436 112
174 3300047444 Ga0495675_0182171 Ga0495675_0182171_155_496 112
175 3300047444 Ga0495675_0801750 Ga0495675_0801750_102_443 112
176 3300047471 Ga0495684_0023445 Ga0495684_0023445_4378_4719 112
177 3300047471 Ga0495684_0043659 Ga0495684_0043659_1598_1939 112
178 3300047471 Ga0495684_0092991 Ga0495684_0092991_623_964 112
179 3300047471 Ga0495684_0277865 Ga0495684_0277865_253_594 112
180 3300047673 Ga0495593_0008628 Ga0495593_0008628_1044_1385 112
181 3300047673 Ga0495593_0225754 Ga0495593_0225754_73_414 112
182 3300047673 Ga0495593_0237229 Ga0495593_0237229_283_624 112
183 3300048088 Ga0495602_0017067 Ga0495602_0017067_364_705 112
184 3300048089 Ga0495614_0115971 Ga0495614_0115971_493_834 112
185 3300053077 Ga0495601_0067591 Ga0495601_0067591_1913_2266 112
186 3300053077 Ga0495601_0252202 Ga0495601_0252202_465_806 112
187 3300053078 Ga0495612_0092822 Ga0495612_0092822_643_984 112
188 3300053078 Ga0495612_0507039 Ga0495612_0507039_71_412 112
189 3300053084 Ga0495595_0035362 Ga0495595_0035362_783_1124 112
190 3300053085 Ga0495619_0074144 Ga0495619_0074144_927_1268 112
191 3300053085 Ga0495619_0215030 Ga0495619_0215030_138_479 112
192 3300005434 Ga0070709_10155037 Ga0070709_101550372 113
193 3300005435 Ga0070714_100452102 Ga0070714_1004521022 113
194 3300005436 Ga0070713_100998209 Ga0070713_1009982092 113
195 3300005458 Ga0070681_11354944 Ga0070681_113549442 113
196 3300006028 Ga0070717_10043387 Ga0070717_100433875 113
197 3300006175 Ga0070712_100679327 Ga0070712_1006793272 113
198 3300006353 Ga0075370_10644038 Ga0075370_106440381 113
199 3300025906 Ga0207699_10590507 Ga0207699_105905072 113
200 3300025928 Ga0207700_10323871 Ga0207700_103238713 113
201 3300031995 Ga0307409_101176441 Ga0307409_1011764412 113
202 3300032002 Ga0307416_103825255 Ga0307416_1038252551 113
203 3300035111 Ga0373923_0110178 Ga0373923_0110178_422_766 113
204 3300035113 Ga0373936_0316725 Ga0373936_0316725_81_425 113
205 3300035116 Ga0373945_0525075 Ga0373945_0525075_36_380 113
206 3300035120 Ga0373957_0079087 Ga0373957_0079087_436_780 113
207 3300035120 Ga0373957_0244886 Ga0373957_0244886_15_359 113
208 3300035170 Ga0373943_0187646 Ga0373943_0187646_593_937 113
209 3300035692 Ga0373935_0184927 Ga0373935_0184927_283_627 113
210 3300035724 Ga0373933_0225356 Ga0373933_0225356_526_870 113
211 3300037068 Ga0373925_0184211 Ga0373925_0184211_1285_1629 113
212 3300046454 Ga0495592_0059698 Ga0495592_0059698_1183_1527 113
213 3300046455 Ga0495603_0157931 Ga0495603_0157931_247_591 113
214 3300046459 Ga0495629_0210730 Ga0495629_0210730_311_655 113
215 3300046462 Ga0495651_0002530 Ga0495651_0002530_9070_9414 113
216 3300046462 Ga0495651_0756357 Ga0495651_0756357_92_436 113
217 3300046463 Ga0495653_0013164 Ga0495653_0013164_4734_5078 113
218 3300046473 Ga0495582_0079283 Ga0495582_0079283_182_526 113
219 3300046475 Ga0495639_0298467 Ga0495639_0298467_258_602 113
220 3300046476 Ga0495662_0008485 Ga0495662_0008485_3105_3449 113
221 3300046477 Ga0495664_0026551 Ga0495664_0026551_3002_3346 113
222 3300046511 Ga0495608_0010494 Ga0495608_0010494_1590_1934 113
223 3300046514 Ga0495618_0046730 Ga0495618_0046730_1298_1642 113
224 3300046516 Ga0495628_0081193 Ga0495628_0081193_1141_1485 113
225 3300046517 Ga0495630_0093771 Ga0495630_0093771_776_1120 113
226 3300046526 Ga0495666_0091428 Ga0495666_0091428_693_1037 113
227 3300046529 Ga0495652_0010789 Ga0495652_0010789_2883_3227 113
228 3300046531 Ga0495665_0038195 Ga0495665_0038195_2167_2511 113
229 3300046533 Ga0495640_0010519 Ga0495640_0010519_754_1098 113
230 3300046536 Ga0495587_0004440 Ga0495587_0004440_7493_7837 113
231 3300046543 Ga0495645_0025880 Ga0495645_0025880_2228_2572 113
232 3300046559 Ga0495667_0016314 Ga0495667_0016314_3623_3967 113
233 3300046642 Ga0495634_0017406 Ga0495634_0017406_1165_1509 113
234 3300046663 Ga0495635_0012877 Ga0495635_0012877_146_490 113
235 3300046674 Ga0495588_0308592 Ga0495588_0308592_423_767 113
236 3300046675 Ga0495657_0007634 Ga0495657_0007634_5927_6271 113
237 3300046678 Ga0495599_0010693 Ga0495599_0010693_3606_3950 113
238 3300046679 Ga0495623_0051483 Ga0495623_0051483_1739_2083 113
239 3300046680 Ga0495646_0099675 Ga0495646_0099675_1070_1414 113
240 3300046681 Ga0495647_0152785 Ga0495647_0152785_265_609 113
241 3300046690 Ga0495624_0133222 Ga0495624_0133222_1089_1433 113
242 3300046809 Ga0495600_0016047 Ga0495600_0016047_2356_2700 113
243 3300047317 Ga0495604_0022983 Ga0495604_0022983_3620_3964 113
244 3300047319 Ga0495674_0060720 Ga0495674_0060720_894_1238 113
245 3300047319 Ga0495674_0361770 Ga0495674_0361770_403_747 113
246 3300047321 Ga0495676_0278168 Ga0495676_0278168_215_559 113
247 3300047322 Ga0495680_0040307 Ga0495680_0040307_2345_2689 113
248 3300047444 Ga0495675_0050731 Ga0495675_0050731_166_510 113
249 3300047471 Ga0495684_0006502 Ga0495684_0006502_8123_8467 113
250 3300048088 Ga0495602_0077317 Ga0495602_0077317_1308_1652 113
251 3300049571 Ga0501034_0309266 Ga0501034_0309266_833_1177 113
252 3300053077 Ga0495601_0022996 Ga0495601_0022996_2721_3065 113
253 3300053077 Ga0495601_0966434 Ga0495601_0966434_90_434 113
254 3300053077 Ga0495601_0969851 Ga0495601_0969851_176_520 113
255 3300053078 Ga0495612_0007975 Ga0495612_0007975_3700_4044 113
256 3300053084 Ga0495595_0003046 Ga0495595_0003046_4522_4866 113
257 3300053085 Ga0495619_0019714 Ga0495619_0019714_505_849 113
258 3300053139 Ga0500568_0000136 Ga0500568_0000136_50437_50781 113
259 3300006178 Ga0075367_10183449 Ga0075367_101834492 114
260 3300031456 Ga0307513_10028172 Ga0307513_100281724 114
261 3300031548 Ga0307408_100666343 Ga0307408_1006663431 114
262 3300031901 Ga0307406_10743158 Ga0307406_107431582 114
263 3300031995 Ga0307409_101210830 Ga0307409_1012108301 114
264 3300032002 Ga0307416_100784442 Ga0307416_1007844422 114
265 3300050490 nmdc:mga03n38_25802_c1 nmdc:mga03n38_25802_c1_39_386 114
266 3300050491 nmdc:mga00v17_379087_c1 nmdc:mga00v17_379087_c1_545_892 114
267 3300005436 Ga0070713_100631819 Ga0070713_1006318192 115
268 3300025928 Ga0207700_10386953 Ga0207700_103869532 115
269 3300028786 Ga0307517_10109411 Ga0307517_101094111 115
270 3300028794 Ga0307515_10078800 Ga0307515_100788004 115
271 3300031456 Ga0307513_10035889 Ga0307513_100358894 115
272 3300031616 Ga0307508_10122010 Ga0307508_101220102 115
273 3300003373 JGI25407J50210_10025715 JGI25407J50210_100257152 116
274 3300005337 Ga0070682_100154302 Ga0070682_1001543022 116
275 3300005981 Ga0081538_10005771 Ga0081538_100057712 116
276 3300005981 Ga0081538_10010106 Ga0081538_1001010611 116
277 3300031824 Ga0307413_10266115 Ga0307413_102661152 116
278 3300032002 Ga0307416_101367149 Ga0307416_1013671492 116
279 3300032126 Ga0307415_100452404 Ga0307415_1004524042 116
280 3300037853 Ga0436364_1240020 Ga0436364_1240020_578_946 116
281 3300050516 nmdc:mga0sz30_557159_c1 nmdc:mga0sz30_557159_c1_145_501 116

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

7

112

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n04-assembly1.cif.gz_A the crystal structure of glyoxalase / bleomycin resistance protein from catenulispora acidiphila dsm 44928 0.9792 1 111
4n04-assembly1.cif.gz_A the crystal structure of glyoxalase / bleomycin resistance protein from catenulispora acidiphila dsm 44928 0.9706 1 111
3r4q-assembly2.cif.gz_D crystal structure of lactoylglutathione lyase from agrobacterium tumefaciens 0.8272 4 109
3r4q-assembly3.cif.gz_E-2 crystal structure of lactoylglutathione lyase from agrobacterium tumefaciens 0.8068 4 109
3itw-assembly1.cif.gz_A-2 crystal structure of tiox from micromonospora sp. ml1 0.8046 1 108
ID Description Score Start End Superfamily
4n04B00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9806 1 109 3.10.180.10
4n04B00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.963 1 109 3.10.180.10
af_F4J9Q6_344_499_3.10.50.40 Alpha Beta;Roll;Chitinase A; domain 3; 0.9187 81 96 3.10.50.40
af_Q9Y2X0_149_877_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9022 84 108 2.130.10.10
3sk1C01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8692 1 52 3.30.720.120
ID Description Score Start End GO Terms
AF-A0A7C9NIU7-F1-model_v4 VOC family protein 1.001 2 112
AF-A0A1H1BZE7-F1-model_v4 VOC domain-containing protein 0.9976 2 111
AF-A0A2D1IB09-F1-model_v4 deleted 0.9945 1 112
AF-A0A1G8HUJ7-F1-model_v4 Glyoxalase-like domain-containing protein 0.9925 1 109
AF-A0A7C9NIU7-F1-model_v4 VOC family protein 0.9919 2 112

Feature Viewer

pLDDT pTM Quality
94.76 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map