F384204

General Info

Members Datasets Scaffolds Average Seq Length
281 168 562 242

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10019333|Ga0075365_100193332
Length 298
Sequence MLRKRSYRCASRTIAAPKIERSSSDGSLRFAGTFVRQSSEAATTQTXXXXAKVATLQMRVAVISDVHANFHALAAVLEQIDAEGVEAIWCVGDVVGYGPQPNECCEVVRERCDLCLVGNHDLVALGQISVGDFNDEAAAAATWTAGELNHESRTFLEGLQPTGTAEGVDLFHASARDPVWEYILTEEAAQATLDLTKAPVVLVGHSHVALAITTVDSGVAGGLAPGGTDVQLDGRWLLNPGSVGQPRDGDPRAAWLLLDLDRMFAAFQRVPYSIEETQNEMRERGLPRMLAARLARGE

Samples

Sample ID Description Type Environment
1 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
2 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
89 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
93 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
94 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
105 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
106 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
112 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
113 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
114 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
115 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
116 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
117 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
118 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
119 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
120 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
121 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
122 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
123 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
124 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
125 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
126 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
127 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
128 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
129 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
130 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
131 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
132 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
133 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
134 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
135 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
136 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
137 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
138 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
139 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
140 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
157 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
168 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.36
Nodule 0
Rhizoplane 13.88
Rhizosphere 85.41
Stem 0
Stem Tuber 0
Unclassified 11.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_10019333 3300006038 Bacteria 4203
2 Ga0070677_10030597 3300005333 Bacteria 2051
3 Ga0068869_100087137 3300005334 Unclassified 2342
4 Ga0070680_100033103 3300005336 Bacteria 4163
5 Ga0068868_100107724 3300005338 Unclassified 2262
6 Ga0070660_100119428 3300005339 Bacteria 2103
7 Ga0070689_100110153 3300005340 Unclassified 2189
8 Ga0070687_100014434 3300005343 Bacteria 3548
9 Ga0070668_100097753 3300005347 Bacteria 2322
10 Ga0070669_100156089 3300005353 Bacteria 1770
11 Ga0070714_100170630 3300005435 Unclassified 1974
12 Ga0070701_10043072 3300005438 Unclassified 2308
13 Ga0070711_100041474 3300005439 Bacteria 3108
14 Ga0070694_100386410 3300005444 Bacteria 1093
15 Ga0070663_100099781 3300005455 Bacteria 2165
16 Ga0070681_10469244 3300005458 Bacteria 1171
17 Ga0068867_100309647 3300005459 Bacteria 1304
18 Ga0070706_100132016 3300005467 Bacteria 2331
19 Ga0070707_100000611 3300005468 Bacteria 35834
20 Ga0070707_100006812 3300005468 Bacteria 10581
21 Ga0070698_100025901 3300005471 Bacteria 6110
22 Ga0070698_100044206 3300005471 Bacteria 4564
23 Ga0070698_100349550 3300005471 Bacteria 1410
24 Ga0070684_100611767 3300005535 Bacteria 1013
25 Ga0070697_100199526 3300005536 Unclassified 1700
26 Ga0070686_100110294 3300005544 Unclassified 1873
27 Ga0070695_100032111 3300005545 Bacteria 3281
28 Ga0070696_100064013 3300005546 Unclassified 2576
29 Ga0070696_100087867 3300005546 Bacteria 2208
30 Ga0070704_100101199 3300005549 Unclassified 2171
31 Ga0068855_100106310 3300005563 Bacteria 3226
32 Ga0068856_100316257 3300005614 Bacteria 1579
33 Ga0070702_100051751 3300005615 Unclassified 2353
34 Ga0068866_10011122 3300005718 Bacteria 3881
35 Ga0068861_100227891 3300005719 Unclassified 1579
36 Ga0068863_100414875 3300005841 Bacteria 1318
37 Ga0068860_100068674 3300005843 Bacteria 3367
38 Ga0081455_10211357 3300005937 Bacteria 1445
39 Ga0070717_10008736 3300006028 Bacteria 7580
40 Ga0070712_100056637 3300006175 Unclassified 2750
41 Ga0070712_100073357 3300006175 Bacteria 2454
42 Ga0097621_100010989 3300006237 Bacteria 6650
43 Ga0068871_100088740 3300006358 Bacteria 2573
44 Ga0075433_10005202 3300006852 Bacteria 10194
45 Ga0068865_100005160 3300006881 Bacteria 7906
46 Ga0075436_100051893 3300006914 Bacteria 2829
47 Ga0105240_10110181 3300009093 Bacteria 3333
48 Ga0111539_10008241 3300009094 Bacteria 13268
49 Ga0111539_10117074 3300009094 Bacteria 3124
50 Ga0111539_10755558 3300009094 Bacteria 1132
51 Ga0105245_10065069 3300009098 Bacteria 3297
52 Ga0105247_10347709 3300009101 Bacteria 1042
53 Ga0114129_10020505 3300009147 Bacteria 9401
54 Ga0114129_10024279 3300009147 Bacteria 8589
55 Ga0114129_10050101 3300009147 Bacteria 5867
56 Ga0114129_10762234 3300009147 Bacteria 1238
57 Ga0105243_10601521 3300009148 Bacteria 1059
58 Ga0105241_10048093 3300009174 Bacteria 3244
59 Ga0105242_10071603 3300009176 Bacteria 2877
60 Ga0105242_10112100 3300009176 Bacteria 2327
61 Ga0105248_10031633 3300009177 Bacteria 5911
62 Ga0105248_10072420 3300009177 Bacteria 3873
63 Ga0105239_10327477 3300010375 Bacteria 1728
64 Ga0105246_10773321 3300011119 Bacteria 849
65 Ga0157370_10014586 3300013104 Bacteria 8030
66 Ga0157369_10410506 3300013105 Bacteria 1404
67 Ga0163162_10187585 3300013306 Unclassified 2195
68 Ga0157375_10042725 3300013308 Bacteria 4390
69 Ga0157375_10148609 3300013308 Bacteria 2476
70 Ga0157375_10508484 3300013308 Bacteria 1369
71 Ga0157380_10050913 3300014326 Bacteria 3272
72 Ga0157377_10023519 3300014745 Unclassified 3267
73 Ga0157379_10249167 3300014968 Bacteria 1612
74 Ga0157376_10262620 3300014969 Bacteria 1618
75 Ga0197907_11393641 3300020069 Bacteria 1572
76 Ga0207653_10057229 3300025885 Bacteria 1308
77 Ga0207692_10018816 3300025898 Bacteria 3108
78 Ga0207647_10084940 3300025904 Bacteria 1894
79 Ga0207705_10150588 3300025909 Bacteria 1743
80 Ga0207695_10143052 3300025913 Bacteria 2338
81 Ga0207693_10002581 3300025915 Bacteria 15741
82 Ga0207693_10113618 3300025915 Bacteria 2124
83 Ga0207663_10059498 3300025916 Bacteria 2417
84 Ga0207663_10394904 3300025916 Bacteria 1056
85 Ga0207657_10048093 3300025919 Bacteria 3725
86 Ga0207657_10422991 3300025919 Bacteria 1047
87 Ga0207646_10277020 3300025922 Bacteria 1516
88 Ga0207687_10336814 3300025927 Bacteria 1225
89 Ga0207690_10233249 3300025932 Bacteria 1414
90 Ga0207665_10086661 3300025939 Bacteria 2163
91 Ga0207665_10437850 3300025939 Bacteria 1001
92 Ga0207691_10043473 3300025940 Bacteria 4141
93 Ga0207711_10066060 3300025941 Bacteria 3128
94 Ga0207689_10382292 3300025942 Bacteria 1172
95 Ga0207668_10100388 3300025972 Unclassified 2149
96 Ga0207677_10500523 3300026023 Bacteria 1050
97 Ga0207678_10139726 3300026067 Bacteria 2067
98 Ga0207678_10563443 3300026067 Bacteria 997
99 Ga0207648_10001302 3300026089 Bacteria 27791
100 Ga0207675_100275970 3300026118 Bacteria 1632
101 Ga0207683_10008779 3300026121 Bacteria 8628
102 Ga0207428_10244520 3300027907 Bacteria 1340
103 Ga0268266_10266454 3300028379 Bacteria 1589
104 Ga0268264_10216087 3300028381 Bacteria 1762
105 Ga0265338_10272595 3300028800 Bacteria 1240
106 Ga0265331_10213875 3300031250 Bacteria 867
107 Ga0265316_10018973 3300031344 Bacteria 5901
108 Ga0265313_10099196 3300031595 Bacteria 1295
109 Ga0307409_100081104 3300031995 Bacteria 2621
110 Ga0307409_100431508 3300031995 Bacteria 1267
111 Ga0307415_100385713 3300032126 Bacteria 1191
112 Ga0373943_0080816 3300035170 Bacteria 1666
113 Ga0373943_0159046 3300035170 Bacteria 1229
114 Ga0373946_0026542 3300035171 Bacteria 2286
115 Ga0373935_0054122 3300035692 Bacteria 2554
116 Ga0373927_0332636 3300035695 Bacteria 1001
117 Ga0373947_0091858 3300035725 Bacteria 1894
118 Ga0373925_0022287 3300037068 Bacteria 4619
119 Ga0373925_0287664 3300037068 Bacteria 1325
120 Ga0395899_0001246 3300037312 Bacteria 22131
121 Ga0395899_0003455 3300037312 Bacteria 12522
122 Ga0395899_0017782 3300037312 Bacteria 5413
123 Ga0395899_0022351 3300037312 Bacteria 4796
124 Ga0395899_0203262 3300037312 Unclassified 1380
125 Ga0395899_0265595 3300037312 Bacteria 1172
126 Ga0395900_0004509 3300037418 Bacteria 14733
127 Ga0395900_0009992 3300037418 Bacteria 9712
128 Ga0395900_0011495 3300037418 Bacteria 9062
129 Ga0395900_0019229 3300037418 Bacteria 6965
130 Ga0395900_0102224 3300037418 Bacteria 2944
131 Ga0395900_0151103 3300037418 Unclassified 2372
132 Ga0395900_0197479 3300037418 Unclassified 2037
133 Ga0395900_0202130 3300037418 Bacteria 2010
134 Ga0395900_0244419 3300037418 Bacteria 1799
135 Ga0395900_0274826 3300037418 Bacteria 1678
136 Ga0395900_0410076 3300037418 Bacteria 1317
137 Ga0395900_0687825 3300037418 Bacteria 957
138 Ga0395900_0701523 3300037418 Unclassified 945
139 Ga0395898_0003606 3300037466 Bacteria 17242
140 Ga0395898_0016199 3300037466 Bacteria 7634
141 Ga0395898_0016520 3300037466 Bacteria 7549
142 Ga0395898_0018915 3300037466 Bacteria 7018
143 Ga0395898_0021374 3300037466 Bacteria 6562
144 Ga0395898_0026774 3300037466 Bacteria 5796
145 Ga0395898_0042917 3300037466 Bacteria 4460
146 Ga0395898_0044309 3300037466 Bacteria 4381
147 Ga0395898_0067621 3300037466 Bacteria 3459
148 Ga0395898_0084367 3300037466 Bacteria 3062
149 Ga0395898_0122507 3300037466 Bacteria 2491
150 Ga0395898_0400689 3300037466 Bacteria 1308
151 Ga0395898_0470849 3300037466 Bacteria 1196
152 Ga0395905_0003649 3300037471 Bacteria 16325
153 Ga0395905_0005339 3300037471 Bacteria 13132
154 Ga0395905_0005662 3300037471 Bacteria 12705
155 Ga0395905_0009673 3300037471 Bacteria 9411
156 Ga0395905_0033253 3300037471 Bacteria 4845
157 Ga0395905_0033421 3300037471 Bacteria 4831
158 Ga0395905_0036333 3300037471 Bacteria 4626
159 Ga0395905_0126728 3300037471 Bacteria 2401
160 Ga0395905_0206136 3300037471 Bacteria 1843
161 Ga0395905_0328494 3300037471 Bacteria 1419
162 Ga0395905_0609262 3300037471 Bacteria 994
163 Ga0436364_0554369 3300037853 Bacteria 2704
164 Ga0395901_0011777 3300038443 Bacteria 8868
165 Ga0395901_0015088 3300038443 Bacteria 7857
166 Ga0395901_0019479 3300038443 Bacteria 6938
167 Ga0395901_0027255 3300038443 Bacteria 5869
168 Ga0395901_0029249 3300038443 Bacteria 5670
169 Ga0395901_0036024 3300038443 Bacteria 5113
170 Ga0395901_0040853 3300038443 Bacteria 4805
171 Ga0395901_0113116 3300038443 Bacteria 2850
172 Ga0395901_0234668 3300038443 Bacteria 1914
173 Ga0395901_0380162 3300038443 Bacteria 1453
174 Ga0395901_0434125 3300038443 Bacteria 1345
175 Ga0395901_0515547 3300038443 Unclassified 1215
176 Ga0395901_0550388 3300038443 Bacteria 1169
177 Ga0395901_0828161 3300038443 Archaea 912
178 Ga0466969_0052608 3300044656 Bacteria 2001
179 Ga0466966_0353440 3300044684 Bacteria 883
180 Ga0466961_0004465 3300044693 Bacteria 8764
181 Ga0466963_0001768 3300044694 Bacteria 11789
182 Ga0466963_0105326 3300044694 Bacteria 1933
183 Ga0466963_0240282 3300044694 Bacteria 1270
184 Ga0466964_0044733 3300044706 Bacteria 1800
185 Ga0466964_0066473 3300044706 Bacteria 1513
186 Ga0466957_0052139 3300044842 Bacteria 2491
187 Ga0466957_0083401 3300044842 Bacteria 1994
188 Ga0466959_0043904 3300045049 Bacteria 3294
189 Ga0466959_0208371 3300045049 Bacteria 1359
190 Ga0466958_0108323 3300045836 Bacteria 1733
191 Ga0466958_0310511 3300045836 Bacteria 1013
192 Ga0466967_0082056 3300045976 Bacteria 2913
193 Ga0466967_0217211 3300045976 Bacteria 1815
194 Ga0466967_0279495 3300045976 Bacteria 1601
195 Ga0495603_0023931 3300046455 Bacteria 3694
196 Ga0495603_0230673 3300046455 Bacteria 1067
197 Ga0495629_0067143 3300046459 Bacteria 2503
198 Ga0495641_0045299 3300046461 Bacteria 2026
199 Ga0495582_0106923 3300046473 Bacteria 1570
200 Ga0495662_0030914 3300046476 Bacteria 2586
201 Ga0495584_0004261 3300046491 Bacteria 7711
202 Ga0495584_0083038 3300046491 Bacteria 1613
203 Ga0495585_0045039 3300046492 Bacteria 2464
204 Ga0495594_0040350 3300046499 Bacteria 2554
205 Ga0495596_0055290 3300046500 Bacteria 1551
206 Ga0495630_0020359 3300046517 Bacteria 4891
207 Ga0495637_0065578 3300046520 Bacteria 1478
208 Ga0495644_0037597 3300046523 Unclassified 1827
209 Ga0495663_0043382 3300046525 Bacteria 1373
210 Ga0495642_0041135 3300046528 Unclassified 1879
211 Ga0495586_0007419 3300046535 Bacteria 5849
212 Ga0495598_0096209 3300046537 Unclassified 973
213 Ga0495656_0073331 3300046615 Unclassified 1526
214 Ga0495668_0048580 3300046616 Unclassified 2354
215 Ga0495611_0126499 3300046648 Unclassified 1192
216 Ga0495661_0045467 3300046665 Unclassified 2685
217 Ga0495588_0026857 3300046674 Bacteria 2876
218 Ga0495647_0003928 3300046681 Bacteria 4798
219 Ga0495658_0063071 3300046683 Unclassified 2132
220 Ga0495671_0112463 3300046692 Bacteria 1330
221 Ga0495589_0069390 3300046794 Unclassified 1724
222 Ga0495589_0096881 3300046794 Unclassified 1429
223 Ga0495676_0021716 3300047321 Bacteria 5599
224 Ga0495676_0451807 3300047321 Bacteria 848
225 Ga0495677_0037635 3300047445 Bacteria 1767
226 Ga0496100_0290454 3300048903 Bacteria 1221
227 Ga0496100_0332561 3300048903 Bacteria 1144
228 Ga0496101_0138605 3300048904 Bacteria 1853
229 Ga0496102_0020401 3300048905 Bacteria 5856
230 Ga0496102_0101229 3300048905 Bacteria 2676
231 Ga0496103_0025403 3300048906 Bacteria 3580
232 Ga0496103_0313839 3300048906 Bacteria 1008
233 Ga0496103_0407462 3300048906 Bacteria 873
234 Ga0496104_0012022 3300048907 Bacteria 7769
235 Ga0496104_0307867 3300048907 Bacteria 1497
236 Ga0496104_0536830 3300048907 Bacteria 1080
237 Ga0496106_0031580 3300048909 Bacteria 3947
238 Ga0496107_0061388 3300048910 Bacteria 2721
239 Ga0496108_0002230 3300048911 Bacteria 15527
240 Ga0496108_0062333 3300048911 Bacteria 3140
241 Ga0496108_0393248 3300048911 Bacteria 1211
242 Ga0496109_0000373 3300048912 Bacteria 40776
243 Ga0496109_0001880 3300048912 Bacteria 17399
244 Ga0496109_0085656 3300048912 Bacteria 2909
245 Ga0496109_0351800 3300048912 Bacteria 1392
246 Ga0496109_0458462 3300048912 Bacteria 1204
247 Ga0496110_0136719 3300048913 Bacteria 2215
248 Ga0496110_0170734 3300048913 Bacteria 1973
249 Ga0496110_0222076 3300048913 Bacteria 1718
250 Ga0496110_0319720 3300048913 Bacteria 1414
251 Ga0496110_0399447 3300048913 Bacteria 1253
252 Ga0496111_0014921 3300048914 Bacteria 5320
253 Ga0496111_0278622 3300048914 Bacteria 1240
254 Ga0496112_0001750 3300048915 Bacteria 17019
255 Ga0496112_0112422 3300048915 Bacteria 2694
256 Ga0496112_0203392 3300048915 Bacteria 1939
257 Ga0496112_0289113 3300048915 Bacteria 1585
258 Ga0496113_0014704 3300048916 Bacteria 5350
259 Ga0496113_0047853 3300048916 Bacteria 3180
260 Ga0496113_0474328 3300048916 Bacteria 1005
261 Ga0496114_0015789 3300048917 Bacteria 6077
262 Ga0496114_0048588 3300048917 Bacteria 3529
263 Ga0496115_0043589 3300048918 Bacteria 3579
264 Ga0496115_0079812 3300048918 Unclassified 2663
265 Ga0501048_0342556 3300049582 Bacteria 1066
266 Ga0501074_0289626 3300049590 Bacteria 1164
267 Ga0501077_0011192 3300049593 Bacteria 5597
268 Ga0501079_0073523 3300049741 Bacteria 2642
269 Ga0501081_0593756 3300049743 Bacteria 829
270 nmdc:mga05p37_21167_c2 3300050507 Bacteria 7331
271 nmdc:mga05p37_722513_c1 3300050507 Bacteria 1103
272 nmdc:mga05p37_97707_c1 3300050507 Bacteria 3617
273 nmdc:mga08y16_559754_c1 3300050511 Bacteria 1156
274 nmdc:mga0n895_522414_c1 3300050512 Bacteria 1195
275 nmdc:mga0rr50_146759_c1 3300050513 Bacteria 1903
276 nmdc:mga0a205_56658_c1 3300050515 Bacteria 3784
277 Ga0495655_0122931 3300053083 Unclassified 792
278 Ga0501084_0028224 3300054114 Bacteria 4690
279 Ga0501084_0366291 3300054114 Bacteria 1218
280 Ga0501082_0179658 3300060353 Bacteria 1840
281 Ga0530510_0354731 3300061734 Bacteria 1102
282 Ga0075365_10019333
283 Ga0070677_10030597
284 Ga0068869_100087137
285 Ga0070680_100033103
286 Ga0068868_100107724
287 Ga0070660_100119428
288 Ga0070689_100110153
289 Ga0070687_100014434
290 Ga0070668_100097753
291 Ga0070669_100156089
292 Ga0070714_100170630
293 Ga0070701_10043072
294 Ga0070711_100041474
295 Ga0070694_100386410
296 Ga0070663_100099781
297 Ga0070681_10469244
298 Ga0068867_100309647
299 Ga0070706_100132016
300 Ga0070707_100000611
301 Ga0070707_100006812
302 Ga0070698_100025901
303 Ga0070698_100044206
304 Ga0070698_100349550
305 Ga0070684_100611767
306 Ga0070697_100199526
307 Ga0070686_100110294
308 Ga0070695_100032111
309 Ga0070696_100064013
310 Ga0070696_100087867
311 Ga0070704_100101199
312 Ga0068855_100106310
313 Ga0068856_100316257
314 Ga0070702_100051751
315 Ga0068866_10011122
316 Ga0068861_100227891
317 Ga0068863_100414875
318 Ga0068860_100068674
319 Ga0081455_10211357
320 Ga0070717_10008736
321 Ga0070712_100056637
322 Ga0070712_100073357
323 Ga0097621_100010989
324 Ga0068871_100088740
325 Ga0075433_10005202
326 Ga0068865_100005160
327 Ga0075436_100051893
328 Ga0105240_10110181
329 Ga0111539_10008241
330 Ga0111539_10117074
331 Ga0111539_10755558
332 Ga0105245_10065069
333 Ga0105247_10347709
334 Ga0114129_10020505
335 Ga0114129_10024279
336 Ga0114129_10050101
337 Ga0114129_10762234
338 Ga0105243_10601521
339 Ga0105241_10048093
340 Ga0105242_10071603
341 Ga0105242_10112100
342 Ga0105248_10031633
343 Ga0105248_10072420
344 Ga0105239_10327477
345 Ga0105246_10773321
346 Ga0157370_10014586
347 Ga0157369_10410506
348 Ga0163162_10187585
349 Ga0157375_10042725
350 Ga0157375_10148609
351 Ga0157375_10508484
352 Ga0157380_10050913
353 Ga0157377_10023519
354 Ga0157379_10249167
355 Ga0157376_10262620
356 Ga0197907_11393641
357 Ga0207653_10057229
358 Ga0207692_10018816
359 Ga0207647_10084940
360 Ga0207705_10150588
361 Ga0207695_10143052
362 Ga0207693_10002581
363 Ga0207693_10113618
364 Ga0207663_10059498
365 Ga0207663_10394904
366 Ga0207657_10048093
367 Ga0207657_10422991
368 Ga0207646_10277020
369 Ga0207687_10336814
370 Ga0207690_10233249
371 Ga0207665_10086661
372 Ga0207665_10437850
373 Ga0207691_10043473
374 Ga0207711_10066060
375 Ga0207689_10382292
376 Ga0207668_10100388
377 Ga0207677_10500523
378 Ga0207678_10139726
379 Ga0207678_10563443
380 Ga0207648_10001302
381 Ga0207675_100275970
382 Ga0207683_10008779
383 Ga0207428_10244520
384 Ga0268266_10266454
385 Ga0268264_10216087
386 Ga0265338_10272595
387 Ga0265331_10213875
388 Ga0265316_10018973
389 Ga0265313_10099196
390 Ga0307409_100081104
391 Ga0307409_100431508
392 Ga0307415_100385713
393 Ga0373943_0080816
394 Ga0373943_0159046
395 Ga0373946_0026542
396 Ga0373935_0054122
397 Ga0373927_0332636
398 Ga0373947_0091858
399 Ga0373925_0022287
400 Ga0373925_0287664
401 Ga0395899_0001246
402 Ga0395899_0003455
403 Ga0395899_0017782
404 Ga0395899_0022351
405 Ga0395899_0203262
406 Ga0395899_0265595
407 Ga0395900_0004509
408 Ga0395900_0009992
409 Ga0395900_0011495
410 Ga0395900_0019229
411 Ga0395900_0102224
412 Ga0395900_0151103
413 Ga0395900_0197479
414 Ga0395900_0202130
415 Ga0395900_0244419
416 Ga0395900_0274826
417 Ga0395900_0410076
418 Ga0395900_0687825
419 Ga0395900_0701523
420 Ga0395898_0003606
421 Ga0395898_0016199
422 Ga0395898_0016520
423 Ga0395898_0018915
424 Ga0395898_0021374
425 Ga0395898_0026774
426 Ga0395898_0042917
427 Ga0395898_0044309
428 Ga0395898_0067621
429 Ga0395898_0084367
430 Ga0395898_0122507
431 Ga0395898_0400689
432 Ga0395898_0470849
433 Ga0395905_0003649
434 Ga0395905_0005339
435 Ga0395905_0005662
436 Ga0395905_0009673
437 Ga0395905_0033253
438 Ga0395905_0033421
439 Ga0395905_0036333
440 Ga0395905_0126728
441 Ga0395905_0206136
442 Ga0395905_0328494
443 Ga0395905_0609262
444 Ga0436364_0554369
445 Ga0395901_0011777
446 Ga0395901_0015088
447 Ga0395901_0019479
448 Ga0395901_0027255
449 Ga0395901_0029249
450 Ga0395901_0036024
451 Ga0395901_0040853
452 Ga0395901_0113116
453 Ga0395901_0234668
454 Ga0395901_0380162
455 Ga0395901_0434125
456 Ga0395901_0515547
457 Ga0395901_0550388
458 Ga0395901_0828161
459 Ga0466969_0052608
460 Ga0466966_0353440
461 Ga0466961_0004465
462 Ga0466963_0001768
463 Ga0466963_0105326
464 Ga0466963_0240282
465 Ga0466964_0044733
466 Ga0466964_0066473
467 Ga0466957_0052139
468 Ga0466957_0083401
469 Ga0466959_0043904
470 Ga0466959_0208371
471 Ga0466958_0108323
472 Ga0466958_0310511
473 Ga0466967_0082056
474 Ga0466967_0217211
475 Ga0466967_0279495
476 Ga0495603_0023931
477 Ga0495603_0230673
478 Ga0495629_0067143
479 Ga0495641_0045299
480 Ga0495582_0106923
481 Ga0495662_0030914
482 Ga0495584_0004261
483 Ga0495584_0083038
484 Ga0495585_0045039
485 Ga0495594_0040350
486 Ga0495596_0055290
487 Ga0495630_0020359
488 Ga0495637_0065578
489 Ga0495644_0037597
490 Ga0495663_0043382
491 Ga0495642_0041135
492 Ga0495586_0007419
493 Ga0495598_0096209
494 Ga0495656_0073331
495 Ga0495668_0048580
496 Ga0495611_0126499
497 Ga0495661_0045467
498 Ga0495588_0026857
499 Ga0495647_0003928
500 Ga0495658_0063071
501 Ga0495671_0112463
502 Ga0495589_0069390
503 Ga0495589_0096881
504 Ga0495676_0021716
505 Ga0495676_0451807
506 Ga0495677_0037635
507 Ga0496100_0290454
508 Ga0496100_0332561
509 Ga0496101_0138605
510 Ga0496102_0020401
511 Ga0496102_0101229
512 Ga0496103_0025403
513 Ga0496103_0313839
514 Ga0496103_0407462
515 Ga0496104_0012022
516 Ga0496104_0307867
517 Ga0496104_0536830
518 Ga0496106_0031580
519 Ga0496107_0061388
520 Ga0496108_0002230
521 Ga0496108_0062333
522 Ga0496108_0393248
523 Ga0496109_0000373
524 Ga0496109_0001880
525 Ga0496109_0085656
526 Ga0496109_0351800
527 Ga0496109_0458462
528 Ga0496110_0136719
529 Ga0496110_0170734
530 Ga0496110_0222076
531 Ga0496110_0319720
532 Ga0496110_0399447
533 Ga0496111_0014921
534 Ga0496111_0278622
535 Ga0496112_0001750
536 Ga0496112_0112422
537 Ga0496112_0203392
538 Ga0496112_0289113
539 Ga0496113_0014704
540 Ga0496113_0047853
541 Ga0496113_0474328
542 Ga0496114_0015789
543 Ga0496114_0048588
544 Ga0496115_0043589
545 Ga0496115_0079812
546 Ga0501048_0342556
547 Ga0501074_0289626
548 Ga0501077_0011192
549 Ga0501079_0073523
550 Ga0501081_0593756
551 nmdc:mga05p37_21167_c2
552 nmdc:mga05p37_722513_c1
553 nmdc:mga05p37_97707_c1
554 nmdc:mga08y16_559754_c1
555 nmdc:mga0n895_522414_c1
556 nmdc:mga0rr50_146759_c1
557 nmdc:mga0a205_56658_c1
558 Ga0495655_0122931
559 Ga0501084_0028224
560 Ga0501084_0366291
561 Ga0501082_0179658
562 Ga0530510_0354731

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

58

263

0.72

PF00149

Metallophos

Calcineurin-like phosphoesterase

58

209

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rqz-assembly2.cif.gz_B crystal structure of metallophosphoesterase from sphaerobacter thermophilus 0.9211 1 241
3rqz-assembly2.cif.gz_B crystal structure of metallophosphoesterase from sphaerobacter thermophilus 0.9173 1 241
3rqz-assembly1.cif.gz_A crystal structure of metallophosphoesterase from sphaerobacter thermophilus 0.9141 1 241
3rqz-assembly1.cif.gz_A crystal structure of metallophosphoesterase from sphaerobacter thermophilus 0.9104 1 241
3rqz-assembly3.cif.gz_C crystal structure of metallophosphoesterase from sphaerobacter thermophilus 0.9018 1 241
ID Description Score Start End Superfamily
3rqzB00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9171 3 241 3.60.21.10
3rqzB00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9095 3 241 3.60.21.10
af_Q58322_5_243_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9084 3 241 3.60.21.10
af_Q58322_5_243_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9011 3 241 3.60.21.10
2gjuC00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.797 2 241 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A538K407-F1-model_v4 Metallophosphoesterase family protein 0.9989 1 241 GO:0005737
GO:0016791
AF-A0A538ACU0-F1-model_v4 Metallophosphoesterase family protein 0.9924 2 241 GO:0005737
GO:0016791
AF-A0A538HG05-F1-model_v4 Metallophosphoesterase family protein 0.9911 1 241 GO:0005737
GO:0016791
AF-A0A538FCW8-F1-model_v4 Metallophosphoesterase family protein 0.9906 2 241 GO:0005737
GO:0016791
AF-A0A7K0QM00-F1-model_v4 Metallophosphoesterase 0.9875 1 241 GO:0005737
GO:0016791

Map