F384152

General Info

Members Datasets Scaffolds Average Seq Length
281 181 562 182

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100463416|Ga0070679_1004634162
Length 190
Sequence MGRAKMADMALRFTTSYLSDSLELFRYYKNLAERAMAQVSEQQLATVLDGEANSISVIVKHMAGNMRSRWTEFLTSDGEKPDRNRDTEFEDAPATRDAVLALWEQGWQCLFSALEPLSEQDLERTVTIRGEAHSVMQAINRQMAHYSYHCGQIVLLAKHFKHDDWKSLSVPRKQSAEFNRRVSAGEASQR

Samples

Sample ID Description Type Environment
1 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
137 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
139 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
140 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
141 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
142 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
143 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
153 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
154 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
155 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
156 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
157 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
164 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
165 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
178 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
179 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
180 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
181 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.42
Rhizosphere 96.8
Stem 0
Stem Tuber 0
Unclassified 24.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070679_100463416 3300005530 Bacteria 1212
2 MBSR1b_contig_526257 2162886012 Bacteria 1730
3 Ga0065712_10118363 3300005290 Bacteria 1707
4 Ga0065715_10216598 3300005293 Unclassified 1290
5 Ga0070658_10041080 3300005327 Bacteria 3731
6 Ga0070683_100201228 3300005329 Unclassified 1891
7 Ga0070690_100107119 3300005330 Bacteria 1860
8 Ga0070677_10192306 3300005333 Unclassified 979
9 Ga0068869_100030000 3300005334 Bacteria 3814
10 Ga0070680_100395159 3300005336 Bacteria 1178
11 Ga0070682_100117359 3300005337 Bacteria 1781
12 Ga0070682_100200566 3300005337 Bacteria 1407
13 Ga0070682_100396662 3300005337 Bacteria 1042
14 Ga0068868_100015177 3300005338 Bacteria 5691
15 Ga0068868_100287524 3300005338 Bacteria 1393
16 Ga0068868_101455564 3300005338 Bacteria 640
17 Ga0070687_100166651 3300005343 Unclassified 1307
18 Ga0070661_100075275 3300005344 Bacteria 2487
19 Ga0070692_10092656 3300005345 Bacteria 1644
20 Ga0070668_100874009 3300005347 Unclassified 802
21 Ga0070675_100214220 3300005354 Unclassified 1675
22 Ga0070671_100231961 3300005355 Unclassified 1566
23 Ga0070673_100740829 3300005364 Bacteria 904
24 Ga0070667_100240620 3300005367 Bacteria 1616
25 Ga0070711_100313451 3300005439 Unclassified 1251
26 Ga0070711_100587597 3300005439 Bacteria 928
27 Ga0070700_100087776 3300005441 Bacteria 2022
28 Ga0070694_100113205 3300005444 Bacteria 1936
29 Ga0070694_100375582 3300005444 Unclassified 1107
30 Ga0070694_100470022 3300005444 Bacteria 996
31 Ga0070708_100149413 3300005445 Unclassified 2172
32 Ga0070708_100196693 3300005445 Bacteria 1886
33 Ga0070708_100808584 3300005445 Unclassified 881
34 Ga0070678_100366280 3300005456 Unclassified 1243
35 Ga0070662_100680233 3300005457 Unclassified 869
36 Ga0070681_10077764 3300005458 Unclassified 3275
37 Ga0070681_11109516 3300005458 Unclassified 712
38 Ga0068867_100085204 3300005459 Unclassified 2388
39 Ga0068867_100606437 3300005459 Bacteria 955
40 Ga0070706_100637022 3300005467 Unclassified 990
41 Ga0070706_100732679 3300005467 Unclassified 916
42 Ga0070706_101017553 3300005467 Bacteria 764
43 Ga0070707_100042223 3300005468 Bacteria 4365
44 Ga0070707_100103048 3300005468 Unclassified 2765
45 Ga0070707_101042713 3300005468 Unclassified 783
46 Ga0070698_100367742 3300005471 Bacteria 1370
47 Ga0070698_100597219 3300005471 Bacteria 1044
48 Ga0070699_100038775 3300005518 Bacteria 4125
49 Ga0070699_100293627 3300005518 Bacteria 1458
50 Ga0070679_100024230 3300005530 Bacteria 5946
51 Ga0070679_100146207 3300005530 Bacteria 2341
52 Ga0070679_100386093 3300005530 Bacteria 1347
53 Ga0070697_100275352 3300005536 Unclassified 1443
54 Ga0070697_100532936 3300005536 Bacteria 1029
55 Ga0070697_100675089 3300005536 Unclassified 911
56 Ga0068853_100172382 3300005539 Bacteria 1958
57 Ga0070686_100008054 3300005544 Bacteria 5887
58 Ga0070696_100026266 3300005546 Bacteria 3962
59 Ga0070693_100017144 3300005547 Bacteria 3760
60 Ga0068855_100134420 3300005563 Bacteria 2822
61 Ga0068855_100208664 3300005563 Unclassified 2196
62 Ga0068855_101375327 3300005563 Unclassified 728
63 Ga0068857_100022534 3300005577 Bacteria 5541
64 Ga0068857_100155289 3300005577 Bacteria 2075
65 Ga0068854_100985839 3300005578 Bacteria 745
66 Ga0068856_100007037 3300005614 Bacteria 10987
67 Ga0068856_100598267 3300005614 Bacteria 1124
68 Ga0070702_100487786 3300005615 Unclassified 902
69 Ga0068852_100306674 3300005616 Unclassified 1538
70 Ga0068859_100006941 3300005617 Bacteria 11499
71 Ga0068864_100008542 3300005618 Bacteria 8452
72 Ga0068864_100367352 3300005618 Bacteria 1361
73 Ga0068864_100658301 3300005618 Unclassified 1020
74 Ga0068864_101114203 3300005618 Bacteria 786
75 Ga0068866_10039576 3300005718 Unclassified 2328
76 Ga0068861_100304776 3300005719 Unclassified 1381
77 Ga0068870_10256521 3300005840 Unclassified 1086
78 Ga0068863_100020571 3300005841 Bacteria 6307
79 Ga0068863_100082963 3300005841 Bacteria 3037
80 Ga0068858_100004193 3300005842 Bacteria 14192
81 Ga0068858_100081989 3300005842 Bacteria 2998
82 Ga0068858_100365607 3300005842 Unclassified 1383
83 Ga0068860_100167803 3300005843 Bacteria 2120
84 Ga0068860_100419079 3300005843 Bacteria 1327
85 Ga0068860_101482004 3300005843 Bacteria 700
86 Ga0070715_10270088 3300006163 Unclassified 897
87 Ga0070715_10535841 3300006163 Bacteria 676
88 Ga0097621_100072375 3300006237 Bacteria 2851
89 Ga0097621_100123791 3300006237 Unclassified 2195
90 Ga0097621_100299869 3300006237 Bacteria 1419
91 Ga0068871_100193061 3300006358 Unclassified 1755
92 Ga0068871_100212979 3300006358 Bacteria 1672
93 Ga0068871_100462461 3300006358 Bacteria 1139
94 Ga0075428_100027354 3300006844 Bacteria 6310
95 Ga0075431_101174070 3300006847 Bacteria 731
96 Ga0075433_10033279 3300006852 Bacteria 4417
97 Ga0075434_100050646 3300006871 Bacteria 4126
98 Ga0068865_100173387 3300006881 Bacteria 1655
99 Ga0068865_100691817 3300006881 Bacteria 870
100 Ga0075436_100013256 3300006914 Bacteria 5649
101 Ga0097620_100006941 3300006931 Bacteria 11499
102 Ga0075435_100001935 3300007076 Bacteria 13489
103 Ga0075435_100153775 3300007076 Bacteria 1935
104 Ga0075435_101001916 3300007076 Bacteria 729
105 Ga0105240_10209441 3300009093 Unclassified 2279
106 Ga0105240_10447192 3300009093 Bacteria 1447
107 Ga0111539_10000447 3300009094 Bacteria 51936
108 Ga0105245_10023910 3300009098 Bacteria 5363
109 Ga0105245_10094365 3300009098 Bacteria 2758
110 Ga0105245_10105692 3300009098 Bacteria 2611
111 Ga0105247_10132427 3300009101 Unclassified 1626
112 Ga0105243_10059002 3300009148 Bacteria 3060
113 Ga0105241_10010824 3300009174 Bacteria 6691
114 Ga0105241_10038572 3300009174 Bacteria 3601
115 Ga0105241_10334384 3300009174 Bacteria 1310
116 Ga0105248_10017491 3300009177 Bacteria 7905
117 Ga0105248_10100264 3300009177 Bacteria 3263
118 Ga0105237_10032031 3300009545 Bacteria 5324
119 Ga0105237_10036710 3300009545 Bacteria 4958
120 Ga0105237_10158227 3300009545 Bacteria 2263
121 Ga0105238_10064535 3300009551 Bacteria 3662
122 Ga0105238_10174238 3300009551 Bacteria 2128
123 Ga0105238_10488640 3300009551 Unclassified 1231
124 Ga0105238_11137990 3300009551 Bacteria 804
125 Ga0105239_10020873 3300010375 Bacteria 7227
126 Ga0105239_10051093 3300010375 Bacteria 4532
127 Ga0105239_10118519 3300010375 Bacteria 2938
128 Ga0105239_10328801 3300010375 Bacteria 1724
129 Ga0157370_10326956 3300013104 Bacteria 1414
130 Ga0157370_10646418 3300013104 Bacteria 967
131 Ga0157369_10275139 3300013105 Bacteria 1754
132 Ga0157374_10150752 3300013296 Unclassified 2261
133 Ga0157378_10135739 3300013297 Bacteria 2281
134 Ga0157378_10512561 3300013297 Bacteria 1200
135 Ga0163162_10038978 3300013306 Bacteria 4744
136 Ga0157372_10010884 3300013307 Bacteria 9682
137 Ga0157372_10207048 3300013307 Bacteria 2273
138 Ga0157375_10040976 3300013308 Bacteria 4469
139 Ga0157375_11818754 3300013308 Bacteria 722
140 Ga0163163_10003105 3300014325 Bacteria 14074
141 Ga0163163_10005354 3300014325 Bacteria 11084
142 Ga0163163_10174154 3300014325 Unclassified 2198
143 Ga0157379_10087103 3300014968 Unclassified 2800
144 Ga0213876_10385713 3300021384 Bacteria 745
145 Ga0207692_10488887 3300025898 Bacteria 779
146 Ga0207642_10027511 3300025899 Unclassified 2328
147 Ga0207710_10186272 3300025900 Unclassified 1020
148 Ga0207685_10234957 3300025905 Bacteria 879
149 Ga0207645_10074861 3300025907 Unclassified 2168
150 Ga0207645_10822022 3300025907 Bacteria 632
151 Ga0207643_10297390 3300025908 Bacteria 1004
152 Ga0207684_10217981 3300025910 Bacteria 1647
153 Ga0207684_10709538 3300025910 Unclassified 854
154 Ga0207654_10003796 3300025911 Bacteria 7618
155 Ga0207654_10019370 3300025911 Bacteria 3590
156 Ga0207654_10022347 3300025911 Bacteria 3373
157 Ga0207654_10335369 3300025911 Bacteria 1037
158 Ga0207707_10095572 3300025912 Unclassified 2597
159 Ga0207695_10026585 3300025913 Bacteria 6459
160 Ga0207695_10869187 3300025913 Bacteria 781
161 Ga0207671_10024357 3300025914 Bacteria 4552
162 Ga0207671_10472907 3300025914 Bacteria 999
163 Ga0207663_10185039 3300025916 Bacteria 1491
164 Ga0207662_10073875 3300025918 Bacteria 2069
165 Ga0207657_10024004 3300025919 Bacteria 5662
166 Ga0207652_10068709 3300025921 Bacteria 3075
167 Ga0207652_10111693 3300025921 Bacteria 2424
168 Ga0207646_10065752 3300025922 Bacteria 3237
169 Ga0207694_10054433 3300025924 Bacteria 3104
170 Ga0207694_10093144 3300025924 Bacteria 2379
171 Ga0207694_10120933 3300025924 Bacteria 2091
172 Ga0207659_10161869 3300025926 Bacteria 1758
173 Ga0207687_10091854 3300025927 Unclassified 2215
174 Ga0207687_10633149 3300025927 Unclassified 904
175 Ga0207664_10439727 3300025929 Bacteria 1163
176 Ga0207644_10122609 3300025931 Unclassified 1981
177 Ga0207644_10124523 3300025931 Bacteria 1966
178 Ga0207706_10001269 3300025933 Bacteria 25461
179 Ga0207669_10065473 3300025937 Unclassified 2255
180 Ga0207691_10440294 3300025940 Bacteria 1110
181 Ga0207711_10020908 3300025941 Bacteria 5463
182 Ga0207711_10118104 3300025941 Bacteria 2366
183 Ga0207689_10037883 3300025942 Bacteria 3997
184 Ga0207667_10002914 3300025949 Bacteria 21244
185 Ga0207667_10080597 3300025949 Bacteria 3372
186 Ga0207667_10090706 3300025949 Bacteria 3158
187 Ga0207667_11059312 3300025949 Unclassified 796
188 Ga0207640_10294842 3300025981 Unclassified 1280
189 Ga0207640_10948862 3300025981 Bacteria 754
190 Ga0207658_10358359 3300025986 Bacteria 1272
191 Ga0207677_10001199 3300026023 Bacteria 14057
192 Ga0207703_10012890 3300026035 Bacteria 6519
193 Ga0207703_10374176 3300026035 Bacteria 1316
194 Ga0207639_10350494 3300026041 Bacteria 1318
195 Ga0207639_10597060 3300026041 Bacteria 1018
196 Ga0207708_10172708 3300026075 Bacteria 1713
197 Ga0207702_10024080 3300026078 Bacteria 5051
198 Ga0207702_10161361 3300026078 Bacteria 2047
199 Ga0207702_10353923 3300026078 Bacteria 1406
200 Ga0207641_10320192 3300026088 Bacteria 1470
201 Ga0207641_10434712 3300026088 Bacteria 1266
202 Ga0207648_10100129 3300026089 Bacteria 2538
203 Ga0207676_10046078 3300026095 Bacteria 3372
204 Ga0207676_10364027 3300026095 Unclassified 1341
205 Ga0207676_11093123 3300026095 Unclassified 788
206 Ga0207674_10008374 3300026116 Bacteria 11959
207 Ga0207675_100392114 3300026118 Bacteria 1367
208 Ga0207683_10344804 3300026121 Unclassified 1366
209 Ga0207698_10195734 3300026142 Bacteria 1805
210 Ga0207698_10249561 3300026142 Bacteria 1623
211 Ga0207428_10004160 3300027907 Bacteria 13872
212 Ga0207428_10015646 3300027907 Bacteria 6554
213 Ga0268266_10034067 3300028379 Bacteria 4329
214 Ga0268264_10281870 3300028381 Bacteria 1557
215 Ga0268264_10416708 3300028381 Bacteria 1294
216 Ga0265332_10002683 3300031238 Bacteria 8911
217 Ga0265327_10012230 3300031251 Bacteria 5816
218 Ga0316575_10085412 3300031665 Bacteria 1275
219 Ga0265314_10005676 3300031711 Bacteria 11204
220 Ga0307405_10176088 3300031731 Bacteria 1531
221 Ga0307410_11050413 3300031852 Bacteria 704
222 Ga0307407_10035749 3300031903 Bacteria 2732
223 Ga0307411_10522489 3300032005 Bacteria 1008
224 Ga0307415_101142188 3300032126 Bacteria 731
225 Ga0373934_0470678 3300035086 Unclassified 527
226 Ga0373923_0169078 3300035111 Bacteria 1000
227 Ga0373932_0054259 3300035112 Bacteria 1199
228 Ga0373945_0373582 3300035116 Unclassified 621
229 Ga0373953_0118417 3300035117 Unclassified 1123
230 Ga0373954_0058586 3300035118 Unclassified 1814
231 Ga0373943_0006771 3300035170 Bacteria 5144
232 Ga0373946_0244465 3300035171 Bacteria 873
233 Ga0373946_0301760 3300035171 Unclassified 792
234 Ga0373935_0082797 3300035692 Bacteria 2088
235 Ga0373927_0000461 3300035695 Bacteria 31104
236 Ga0373933_0023356 3300035724 Bacteria 3532
237 Ga0373947_0001687 3300035725 Bacteria 13529
238 Ga0373947_0142154 3300035725 Unclassified 1540
239 Ga0373937_0063381 3300036401 Bacteria 3399
240 Ga0373925_0000355 3300037068 Bacteria 47711
241 Ga0373925_0737439 3300037068 Unclassified 812
242 Ga0436364_0206456 3300037853 Bacteria 3190
243 Ga0436365_1533584 3300039437 Bacteria 910
244 Ga0436365_1934968 3300039437 Bacteria 793
245 Ga0436363_0411476 3300039450 Bacteria 1901
246 Ga0439431_0132363 3300041997 Bacteria 701
247 Ga0439446_0011180 3300042156 Bacteria 2434
248 Ga0451577_0037013 3300042876 Bacteria 4393
249 Ga0453683_0018554 3300044673 Bacteria 4466
250 Ga0453683_0147850 3300044673 Bacteria 1484
251 Ga0453684_0975369 3300044712 Bacteria 903
252 Ga0451576_0031013 3300045051 Bacteria 5702
253 Ga0451576_1051358 3300045051 Unclassified 853
254 Ga0495603_0215099 3300046455 Bacteria 1109
255 Ga0495629_0009948 3300046459 Bacteria 6941
256 Ga0495584_0186235 3300046491 Bacteria 1055
257 Ga0495630_0323606 3300046517 Unclassified 1179
258 Ga0495643_0004655 3300046522 Bacteria 9528
259 Ga0495666_0157848 3300046526 Unclassified 1053
260 Ga0495652_0118821 3300046529 Unclassified 2112
261 Ga0495634_0699233 3300046642 Unclassified 583
262 Ga0495634_0731770 3300046642 Unclassified 567
263 Ga0495647_0235719 3300046681 Bacteria 811
264 Ga0496101_0068137 3300048904 Bacteria 2601
265 Ga0496106_0186144 3300048909 Bacteria 1650
266 Ga0496113_0546565 3300048916 Bacteria 929
267 Ga0496115_0071848 3300048918 Bacteria 2807
268 nmdc:mga05p37_57363_c1 3300050507 Bacteria 1536
269 nmdc:mga06r32_1106836_c1 3300050510 Bacteria 741
270 nmdc:mga08y16_1188_c1 3300050511 Bacteria 25704
271 nmdc:mga08y16_28338_c1 3300050511 Bacteria 5904
272 nmdc:mga0n895_21718_c1 3300050512 Bacteria 6007
273 nmdc:mga0rr50_191795_c1 3300050513 Bacteria 1675
274 nmdc:mga0rr50_753_c1 3300050513 Bacteria 17431
275 nmdc:mga08x19_1123909_c1 3300050514 Unclassified 557
276 nmdc:mga08x19_7930_c1 3300050514 Bacteria 6310
277 nmdc:mga0a205_1135638_c1 3300050515 Bacteria 629
278 nmdc:mga0a205_19924_c1 3300050515 Bacteria 6328
279 Ga0495595_0085247 3300053084 Unclassified 1510
280 Ga0590075_140497 3300059424 Unclassified 635
281 Ga0590077_016509 3300059426 Bacteria 1550
282 Ga0070679_100463416
283 MBSR1b_contig_526257
284 Ga0065712_10118363
285 Ga0065715_10216598
286 Ga0070658_10041080
287 Ga0070683_100201228
288 Ga0070690_100107119
289 Ga0070677_10192306
290 Ga0068869_100030000
291 Ga0070680_100395159
292 Ga0070682_100117359
293 Ga0070682_100200566
294 Ga0070682_100396662
295 Ga0068868_100015177
296 Ga0068868_100287524
297 Ga0068868_101455564
298 Ga0070687_100166651
299 Ga0070661_100075275
300 Ga0070692_10092656
301 Ga0070668_100874009
302 Ga0070675_100214220
303 Ga0070671_100231961
304 Ga0070673_100740829
305 Ga0070667_100240620
306 Ga0070711_100313451
307 Ga0070711_100587597
308 Ga0070700_100087776
309 Ga0070694_100113205
310 Ga0070694_100375582
311 Ga0070694_100470022
312 Ga0070708_100149413
313 Ga0070708_100196693
314 Ga0070708_100808584
315 Ga0070678_100366280
316 Ga0070662_100680233
317 Ga0070681_10077764
318 Ga0070681_11109516
319 Ga0068867_100085204
320 Ga0068867_100606437
321 Ga0070706_100637022
322 Ga0070706_100732679
323 Ga0070706_101017553
324 Ga0070707_100042223
325 Ga0070707_100103048
326 Ga0070707_101042713
327 Ga0070698_100367742
328 Ga0070698_100597219
329 Ga0070699_100038775
330 Ga0070699_100293627
331 Ga0070679_100024230
332 Ga0070679_100146207
333 Ga0070679_100386093
334 Ga0070697_100275352
335 Ga0070697_100532936
336 Ga0070697_100675089
337 Ga0068853_100172382
338 Ga0070686_100008054
339 Ga0070696_100026266
340 Ga0070693_100017144
341 Ga0068855_100134420
342 Ga0068855_100208664
343 Ga0068855_101375327
344 Ga0068857_100022534
345 Ga0068857_100155289
346 Ga0068854_100985839
347 Ga0068856_100007037
348 Ga0068856_100598267
349 Ga0070702_100487786
350 Ga0068852_100306674
351 Ga0068859_100006941
352 Ga0068864_100008542
353 Ga0068864_100367352
354 Ga0068864_100658301
355 Ga0068864_101114203
356 Ga0068866_10039576
357 Ga0068861_100304776
358 Ga0068870_10256521
359 Ga0068863_100020571
360 Ga0068863_100082963
361 Ga0068858_100004193
362 Ga0068858_100081989
363 Ga0068858_100365607
364 Ga0068860_100167803
365 Ga0068860_100419079
366 Ga0068860_101482004
367 Ga0070715_10270088
368 Ga0070715_10535841
369 Ga0097621_100072375
370 Ga0097621_100123791
371 Ga0097621_100299869
372 Ga0068871_100193061
373 Ga0068871_100212979
374 Ga0068871_100462461
375 Ga0075428_100027354
376 Ga0075431_101174070
377 Ga0075433_10033279
378 Ga0075434_100050646
379 Ga0068865_100173387
380 Ga0068865_100691817
381 Ga0075436_100013256
382 Ga0097620_100006941
383 Ga0075435_100001935
384 Ga0075435_100153775
385 Ga0075435_101001916
386 Ga0105240_10209441
387 Ga0105240_10447192
388 Ga0111539_10000447
389 Ga0105245_10023910
390 Ga0105245_10094365
391 Ga0105245_10105692
392 Ga0105247_10132427
393 Ga0105243_10059002
394 Ga0105241_10010824
395 Ga0105241_10038572
396 Ga0105241_10334384
397 Ga0105248_10017491
398 Ga0105248_10100264
399 Ga0105237_10032031
400 Ga0105237_10036710
401 Ga0105237_10158227
402 Ga0105238_10064535
403 Ga0105238_10174238
404 Ga0105238_10488640
405 Ga0105238_11137990
406 Ga0105239_10020873
407 Ga0105239_10051093
408 Ga0105239_10118519
409 Ga0105239_10328801
410 Ga0157370_10326956
411 Ga0157370_10646418
412 Ga0157369_10275139
413 Ga0157374_10150752
414 Ga0157378_10135739
415 Ga0157378_10512561
416 Ga0163162_10038978
417 Ga0157372_10010884
418 Ga0157372_10207048
419 Ga0157375_10040976
420 Ga0157375_11818754
421 Ga0163163_10003105
422 Ga0163163_10005354
423 Ga0163163_10174154
424 Ga0157379_10087103
425 Ga0213876_10385713
426 Ga0207692_10488887
427 Ga0207642_10027511
428 Ga0207710_10186272
429 Ga0207685_10234957
430 Ga0207645_10074861
431 Ga0207645_10822022
432 Ga0207643_10297390
433 Ga0207684_10217981
434 Ga0207684_10709538
435 Ga0207654_10003796
436 Ga0207654_10019370
437 Ga0207654_10022347
438 Ga0207654_10335369
439 Ga0207707_10095572
440 Ga0207695_10026585
441 Ga0207695_10869187
442 Ga0207671_10024357
443 Ga0207671_10472907
444 Ga0207663_10185039
445 Ga0207662_10073875
446 Ga0207657_10024004
447 Ga0207652_10068709
448 Ga0207652_10111693
449 Ga0207646_10065752
450 Ga0207694_10054433
451 Ga0207694_10093144
452 Ga0207694_10120933
453 Ga0207659_10161869
454 Ga0207687_10091854
455 Ga0207687_10633149
456 Ga0207664_10439727
457 Ga0207644_10122609
458 Ga0207644_10124523
459 Ga0207706_10001269
460 Ga0207669_10065473
461 Ga0207691_10440294
462 Ga0207711_10020908
463 Ga0207711_10118104
464 Ga0207689_10037883
465 Ga0207667_10002914
466 Ga0207667_10080597
467 Ga0207667_10090706
468 Ga0207667_11059312
469 Ga0207640_10294842
470 Ga0207640_10948862
471 Ga0207658_10358359
472 Ga0207677_10001199
473 Ga0207703_10012890
474 Ga0207703_10374176
475 Ga0207639_10350494
476 Ga0207639_10597060
477 Ga0207708_10172708
478 Ga0207702_10024080
479 Ga0207702_10161361
480 Ga0207702_10353923
481 Ga0207641_10320192
482 Ga0207641_10434712
483 Ga0207648_10100129
484 Ga0207676_10046078
485 Ga0207676_10364027
486 Ga0207676_11093123
487 Ga0207674_10008374
488 Ga0207675_100392114
489 Ga0207683_10344804
490 Ga0207698_10195734
491 Ga0207698_10249561
492 Ga0207428_10004160
493 Ga0207428_10015646
494 Ga0268266_10034067
495 Ga0268264_10281870
496 Ga0268264_10416708
497 Ga0265332_10002683
498 Ga0265327_10012230
499 Ga0316575_10085412
500 Ga0265314_10005676
501 Ga0307405_10176088
502 Ga0307410_11050413
503 Ga0307407_10035749
504 Ga0307411_10522489
505 Ga0307415_101142188
506 Ga0373934_0470678
507 Ga0373923_0169078
508 Ga0373932_0054259
509 Ga0373945_0373582
510 Ga0373953_0118417
511 Ga0373954_0058586
512 Ga0373943_0006771
513 Ga0373946_0244465
514 Ga0373946_0301760
515 Ga0373935_0082797
516 Ga0373927_0000461
517 Ga0373933_0023356
518 Ga0373947_0001687
519 Ga0373947_0142154
520 Ga0373937_0063381
521 Ga0373925_0000355
522 Ga0373925_0737439
523 Ga0436364_0206456
524 Ga0436365_1533584
525 Ga0436365_1934968
526 Ga0436363_0411476
527 Ga0439431_0132363
528 Ga0439446_0011180
529 Ga0451577_0037013
530 Ga0453683_0018554
531 Ga0453683_0147850
532 Ga0453684_0975369
533 Ga0451576_0031013
534 Ga0451576_1051358
535 Ga0495603_0215099
536 Ga0495629_0009948
537 Ga0495584_0186235
538 Ga0495630_0323606
539 Ga0495643_0004655
540 Ga0495666_0157848
541 Ga0495652_0118821
542 Ga0495634_0699233
543 Ga0495634_0731770
544 Ga0495647_0235719
545 Ga0496101_0068137
546 Ga0496106_0186144
547 Ga0496113_0546565
548 Ga0496115_0071848
549 nmdc:mga05p37_57363_c1
550 nmdc:mga06r32_1106836_c1
551 nmdc:mga08y16_1188_c1
552 nmdc:mga08y16_28338_c1
553 nmdc:mga0n895_21718_c1
554 nmdc:mga0rr50_191795_c1
555 nmdc:mga0rr50_753_c1
556 nmdc:mga08x19_1123909_c1
557 nmdc:mga08x19_7930_c1
558 nmdc:mga0a205_1135638_c1
559 nmdc:mga0a205_19924_c1
560 Ga0495595_0085247
561 Ga0590075_140497
562 Ga0590077_016509

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07609

DUF1572

Protein of unknown function (DUF1572)

12

174

0.99

PF12867

DinB_2

DinB superfamily

25

153

0.91

PF04978

DUF664

Protein of unknown function (DUF664)

21

159

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ou6-assembly1.cif.gz_A-2 crystal structure of a putative metalloenzyme of the duf664 family (dr_1065) from deinococcus radiodurans at 1.80 a resolution 0.7689 5 147
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.7684 5 156
2qnl-assembly1.cif.gz_A-2 crystal structure of a putative dna damage-inducible protein (chu_0679) from cytophaga hutchinsonii atcc 33406 at 1.50 a resolution 0.7449 5 143
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.7441 1 149
2yqy-assembly1.cif.gz_A crystal structure of tt2238, a four-helix bundle protein 0.7437 5 140
ID Description Score Start End Superfamily
2ou6A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7727 5 147 1.20.120.450
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7605 8 144 1.20.120.450
2qnlA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7543 5 143 1.20.120.450
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7369 6 140 1.20.120.450
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7354 8 144 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A6A7L714-F1-model_v4 DUF1572 domain-containing protein 0.9942 1 167
AF-A0A2V8I9Y8-F1-model_v4 DinB-like domain-containing protein 0.9913 18 141
AF-A0A1Q7GEJ6-F1-model_v4 DUF1572 domain-containing protein 0.9875 1 167
AF-A0A7Y5PAD7-F1-model_v4 DUF1572 family protein 0.9815 1 168
AF-A0A2W4KAD7-F1-model_v4 DUF1572 domain-containing protein 0.9792 18 158

Map