F384087

General Info

Members Datasets Scaffolds Average Seq Length
281 186 281 222

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100279919|Ga0068869_1002799192
Length 248
Sequence MKKAQGTQIKPRTQRNTPVLALSVCVFFFVSLVPFASFVRGRAAVLTAAAAAGGTIRGRVELRRVASPVERRPNVSDLGAPLARDVSDRLRSVVYLESAPRRAFEQSQPGHAVLDQRDERFVPHVLAITTGTSVDFPNSDRIYHNVFSLSKAARFDLGRYAVGHSKSVRFDQAGIVRVFCDIHSHMNAFILVFSHPFFAVTDEEGRYRIENVPPGTYSVVAWNEGLSSESRPVTVLDGGAAELDFTLR

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
112 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
113 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
114 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
115 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
116 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
117 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
118 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
119 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
120 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
121 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
122 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
123 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
124 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
125 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
126 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
127 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
128 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
140 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
141 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
144 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
147 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
148 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
167 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
168 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
169 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
174 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
180 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
181 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
182 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
184 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
186 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.42
Nodule 0
Rhizoplane 7.12
Rhizosphere 91.46
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10035105 3300005293 Bacteria 1381
2 Ga0070676_10343919 3300005328 Bacteria 1024
3 Ga0070690_100001651 3300005330 Bacteria 11742
4 Ga0070670_100048627 3300005331 Unclassified 3649
5 Ga0068869_100102733 3300005334 Bacteria 2164
6 Ga0068869_100279919 3300005334 Unclassified 1341
7 Ga0070666_10013190 3300005335 Bacteria 5239
8 Ga0070680_100018295 3300005336 Bacteria 5534
9 Ga0070682_100220177 3300005337 Bacteria 1350
10 Ga0070660_100004376 3300005339 Bacteria 9753
11 Ga0070660_100007927 3300005339 Bacteria 7411
12 Ga0070689_100424642 3300005340 Bacteria 1127
13 Ga0070661_100036711 3300005344 Bacteria 3562
14 Ga0070692_10478244 3300005345 Bacteria 803
15 Ga0070675_100000033 3300005354 Bacteria 94281
16 Ga0070671_100376669 3300005355 Bacteria 1213
17 Ga0070674_100042309 3300005356 Bacteria 3094
18 Ga0070674_100253124 3300005356 Unclassified 1384
19 Ga0070674_100364587 3300005356 Bacteria 1171
20 Ga0070673_100001066 3300005364 Bacteria 15656
21 Ga0070673_100236954 3300005364 Unclassified 1585
22 Ga0070659_100061978 3300005366 Bacteria 2955
23 Ga0070667_100360130 3300005367 Viruses 1318
24 Ga0070709_10644013 3300005434 Bacteria 820
25 Ga0070714_100032037 3300005435 Bacteria 4388
26 Ga0070705_100008213 3300005440 Bacteria 5165
27 Ga0070700_100417751 3300005441 Bacteria 1013
28 Ga0070694_100004048 3300005444 Bacteria 8783
29 Ga0070694_100497399 3300005444 Bacteria 970
30 Ga0070708_100061495 3300005445 Unclassified 3355
31 Ga0070678_100565859 3300005456 Bacteria 1011
32 Ga0070681_10010364 3300005458 Bacteria 9202
33 Ga0070681_10096748 3300005458 Unclassified 2900
34 Ga0070681_10132142 3300005458 Bacteria 2428
35 Ga0070706_100177602 3300005467 Unclassified 1988
36 Ga0070706_100288122 3300005467 Bacteria 1533
37 Ga0070698_100058121 3300005471 Unclassified 3911
38 Ga0070698_100062058 3300005471 Bacteria 3771
39 Ga0070698_100298739 3300005471 Archaea 1541
40 Ga0070699_100482512 3300005518 Bacteria 1125
41 Ga0070679_100102546 3300005530 Unclassified 2847
42 Ga0070679_100221348 3300005530 Unclassified 1854
43 Ga0070679_100227038 3300005530 Bacteria 1827
44 Ga0070684_100066848 3300005535 Bacteria 3156
45 Ga0070697_100667524 3300005536 Unclassified 916
46 Ga0070697_100678907 3300005536 Unclassified 908
47 Ga0068853_100284773 3300005539 Bacteria 1524
48 Ga0070686_100042581 3300005544 Unclassified 2845
49 Ga0070686_100581633 3300005544 Bacteria 880
50 Ga0070695_100097423 3300005545 Bacteria 1975
51 Ga0070665_100115742 3300005548 Bacteria 2684
52 Ga0070704_100006638 3300005549 Bacteria 6832
53 Ga0068855_100006073 3300005563 Bacteria 14723
54 Ga0068855_100245638 3300005563 Bacteria 1998
55 Ga0068857_100140946 3300005577 Bacteria 2179
56 Ga0068854_100320400 3300005578 Bacteria 1260
57 Ga0068856_100039481 3300005614 Bacteria 4635
58 Ga0068859_100007908 3300005617 Bacteria 10786
59 Ga0068861_100058412 3300005719 Bacteria 2950
60 Ga0068863_100540383 3300005841 Unclassified 1150
61 Ga0068860_100395758 3300005843 Bacteria 1366
62 Ga0068862_100137164 3300005844 Bacteria 2169
63 Ga0068862_100313095 3300005844 Bacteria 1447
64 Ga0070717_10103006 3300006028 Bacteria 2426
65 Ga0070717_10280442 3300006028 Bacteria 1478
66 Ga0075364_10001809 3300006051 Bacteria 11848
67 Ga0075364_10149586 3300006051 Bacteria 1573
68 Ga0070715_10021460 3300006163 Unclassified 2505
69 Ga0097621_100040252 3300006237 Bacteria 3757
70 Ga0097621_100055431 3300006237 Bacteria 3237
71 Ga0097621_100150108 3300006237 Bacteria 1998
72 Ga0068871_100002203 3300006358 Bacteria 13241
73 Ga0068871_100013584 3300006358 Bacteria 6046
74 Ga0068871_100045574 3300006358 Bacteria 3530
75 Ga0068871_100059923 3300006358 Bacteria 3103
76 Ga0068871_100182507 3300006358 Bacteria 1804
77 Ga0068871_100182686 3300006358 Bacteria 1803
78 Ga0068871_100217772 3300006358 Bacteria 1653
79 Ga0075428_100018272 3300006844 Bacteria 7750
80 Ga0075428_100189891 3300006844 Unclassified 2222
81 Ga0075428_100257426 3300006844 Bacteria 1880
82 Ga0075431_100066369 3300006847 Bacteria 3725
83 Ga0075433_10087239 3300006852 Unclassified 2756
84 Ga0075433_10136187 3300006852 Bacteria 2183
85 Ga0075434_100139825 3300006871 Bacteria 2441
86 Ga0075434_100378164 3300006871 Unclassified 1437
87 Ga0075429_100009755 3300006880 Bacteria 8323
88 Ga0075429_100640809 3300006880 Unclassified 931
89 Ga0068865_100017526 3300006881 Bacteria 4607
90 Ga0068865_100041660 3300006881 Bacteria 3126
91 Ga0068865_100440659 3300006881 Bacteria 1075
92 Ga0075436_100011536 3300006914 Bacteria 6062
93 Ga0075436_100158305 3300006914 Bacteria 1596
94 Ga0097620_100007908 3300006931 Bacteria 10786
95 Ga0075435_100003625 3300007076 Bacteria 10514
96 Ga0075435_100067142 3300007076 Unclassified 2920
97 Ga0105240_10088750 3300009093 Bacteria 3782
98 Ga0105240_10987887 3300009093 Bacteria 901
99 Ga0111539_10538034 3300009094 Bacteria 1361
100 Ga0105245_10045050 3300009098 Bacteria 3938
101 Ga0114129_10022673 3300009147 Bacteria 8905
102 Ga0114129_10033295 3300009147 Bacteria 7283
103 Ga0114129_10255085 3300009147 Bacteria 2353
104 Ga0114129_10257941 3300009147 Unclassified 2338
105 Ga0105242_10047075 3300009176 Bacteria 3501
106 Ga0105242_10067952 3300009176 Bacteria 2947
107 Ga0105248_10019632 3300009177 Bacteria 7480
108 Ga0105248_10030971 3300009177 Bacteria 5977
109 Ga0105248_10049436 3300009177 Bacteria 4716
110 Ga0105248_10065238 3300009177 Bacteria 4088
111 Ga0105248_10085810 3300009177 Bacteria 3542
112 Ga0105248_10350501 3300009177 Bacteria 1662
113 Ga0157378_10011823 3300013297 Bacteria 7640
114 Ga0163162_10252091 3300013306 Bacteria 1897
115 Ga0157375_10066817 3300013308 Viruses 3591
116 Ga0157375_10149525 3300013308 Bacteria 2469
117 Ga0157375_11378500 3300013308 Unclassified 830
118 Ga0157380_10008829 3300014326 Bacteria 7202
119 Ga0157380_10037164 3300014326 Bacteria 3771
120 Ga0157377_10116558 3300014745 Bacteria 1613
121 Ga0157379_10148298 3300014968 Bacteria 2116
122 Ga0157376_10005217 3300014969 Bacteria 9067
123 Ga0157376_10059367 3300014969 Bacteria 3207
124 Ga0157376_10200492 3300014969 Unclassified 1836
125 Ga0157376_10252136 3300014969 Bacteria 1649
126 Ga0163161_10107007 3300017792 Bacteria 2087
127 Ga0163161_10159369 3300017792 Bacteria 1720
128 Ga0207680_10145514 3300025903 Bacteria 1575
129 Ga0207699_10441948 3300025906 Bacteria 932
130 Ga0207684_10180507 3300025910 Bacteria 1820
131 Ga0207707_10348222 3300025912 Unclassified 1277
132 Ga0207707_10454205 3300025912 Unclassified 1096
133 Ga0207695_10187791 3300025913 Bacteria 1985
134 Ga0207695_10222486 3300025913 Bacteria 1794
135 Ga0207660_10010076 3300025917 Bacteria 6122
136 Ga0207657_10004760 3300025919 Bacteria 14330
137 Ga0207657_10056338 3300025919 Bacteria 3392
138 Ga0207652_10043570 3300025921 Unclassified 3821
139 Ga0207681_10403678 3300025923 Unclassified 1104
140 Ga0207650_10101589 3300025925 Unclassified 2214
141 Ga0207659_10001001 3300025926 Bacteria 16799
142 Ga0207659_10363456 3300025926 Unclassified 1203
143 Ga0207687_10022228 3300025927 Bacteria 4219
144 Ga0207700_10005587 3300025928 Bacteria 7546
145 Ga0207664_10024176 3300025929 Bacteria 4564
146 Ga0207690_10258211 3300025932 Bacteria 1349
147 Ga0207669_10022707 3300025937 Bacteria 3338
148 Ga0207704_10045406 3300025938 Bacteria 2610
149 Ga0207704_10433250 3300025938 Bacteria 1045
150 Ga0207665_10071205 3300025939 Bacteria 2373
151 Ga0207711_10060635 3300025941 Bacteria 3260
152 Ga0207711_10127560 3300025941 Bacteria 2278
153 Ga0207661_10938326 3300025944 Bacteria 797
154 Ga0207667_10035458 3300025949 Bacteria 5351
155 Ga0207712_10366526 3300025961 Bacteria 1202
156 Ga0207640_10025740 3300025981 Bacteria 3565
157 Ga0207640_10098628 3300025981 Bacteria 2043
158 Ga0207640_10430618 3300025981 Bacteria 1082
159 Ga0207658_10358272 3300025986 Viruses 1272
160 Ga0207639_10540799 3300026041 Bacteria 1069
161 Ga0207708_10103601 3300026075 Bacteria 2204
162 Ga0207702_10014647 3300026078 Bacteria 6508
163 Ga0207648_10205526 3300026089 Bacteria 1748
164 Ga0207648_10501571 3300026089 Bacteria 1110
165 Ga0207648_10687550 3300026089 Bacteria 947
166 Ga0207674_10027441 3300026116 Bacteria 6022
167 Ga0207675_100045511 3300026118 Bacteria 4099
168 Ga0207683_10049956 3300026121 Bacteria 3662
169 Ga0268266_10078460 3300028379 Bacteria 2873
170 Ga0268265_10298712 3300028380 Bacteria 1449
171 Ga0268264_10421477 3300028381 Unclassified 1287
172 Ga0265314_10015825 3300031711 Bacteria 5973
173 Ga0307409_100436915 3300031995 Unclassified 1260
174 Ga0373930_0001261 3300034816 Bacteria 3740
175 Ga0373948_0024001 3300034817 Bacteria 1187
176 Ga0373958_0054935 3300034819 Bacteria 849
177 Ga0373959_0001468 3300034820 Bacteria 3764
178 Ga0373929_0006255 3300035085 Bacteria 2150
179 Ga0373934_0072066 3300035086 Bacteria 1383
180 Ga0373940_0000502 3300035088 Bacteria 6105
181 Ga0373949_0001047 3300035090 Bacteria 8464
182 Ga0373951_0000611 3300035091 Bacteria 9826
183 Ga0373932_0000722 3300035112 Bacteria 9961
184 Ga0373939_0001246 3300035114 Bacteria 6221
185 Ga0373941_0002054 3300035115 Bacteria 4367
186 Ga0373941_0034713 3300035115 Bacteria 1523
187 Ga0373953_0058480 3300035117 Bacteria 1572
188 Ga0373956_0160785 3300035119 Bacteria 1058
189 Ga0373957_0237327 3300035120 Bacteria 765
190 Ga0373960_0023654 3300035121 Bacteria 1655
191 Ga0373942_0001224 3300035207 Bacteria 6757
192 Ga0373961_0001854 3300035241 Bacteria 5777
193 Ga0373931_0023662 3300035691 Bacteria 3103
194 Ga0373931_0341456 3300035691 Unclassified 935
195 Ga0373927_0111975 3300035695 Bacteria 1779
196 Ga0373947_0116046 3300035725 Bacteria 1697
197 Ga0373937_0063850 3300036401 Bacteria 3387
198 Ga0373937_0325100 3300036401 Bacteria 1455
199 Ga0373937_0502358 3300036401 Bacteria 1152
200 Ga0373937_1049447 3300036401 Unclassified 764
201 Ga0450898_012688 3300042134 Bacteria 1396
202 Ga0451576_0023923 3300045051 Bacteria 6604
203 Ga0466967_0107335 3300045976 Bacteria 2561
204 Ga0495618_0111860 3300046514 Bacteria 1749
205 Ga0495628_0256327 3300046516 Bacteria 1304
206 Ga0495586_0223134 3300046535 Unclassified 1071
207 Ga0495667_0083053 3300046559 Bacteria 2081
208 Ga0495599_0134565 3300046678 Unclassified 1535
209 Ga0495647_0225980 3300046681 Bacteria 827
210 Ga0495658_0029252 3300046683 Unclassified 2981
211 Ga0495658_0274284 3300046683 Bacteria 1063
212 Ga0495669_0078683 3300046684 Bacteria 1511
213 Ga0495600_0271466 3300046809 Unclassified 1076
214 Ga0495604_0177928 3300047317 Bacteria 1490
215 Ga0495675_0364154 3300047444 Bacteria 848
216 Ga0495684_0609339 3300047471 Bacteria 736
217 Ga0496100_0111358 3300048903 Unclassified 1902
218 Ga0496100_0348326 3300048903 Bacteria 1118
219 Ga0496101_0000253 3300048904 Bacteria 38375
220 Ga0496102_0228893 3300048905 Bacteria 1753
221 Ga0496103_0340846 3300048906 Bacteria 964
222 Ga0496104_0003824 3300048907 Bacteria 13032
223 Ga0496104_0269230 3300048907 Unclassified 1616
224 Ga0496104_0295295 3300048907 Bacteria 1533
225 Ga0496104_0396228 3300048907 Unclassified 1293
226 Ga0496105_0025515 3300048908 Bacteria 4811
227 Ga0496105_0078656 3300048908 Bacteria 2723
228 Ga0496106_0068560 3300048909 Bacteria 2706
229 Ga0496107_0054096 3300048910 Bacteria 2897
230 Ga0496109_0057907 3300048912 Unclassified 3539
231 Ga0496109_0703731 3300048912 Bacteria 948
232 Ga0496112_0033274 3300048915 Bacteria 5010
233 Ga0496113_0284035 3300048916 Unclassified 1324
234 Ga0496113_0319803 3300048916 Unclassified 1244
235 Ga0496114_0001314 3300048917 Bacteria 18831
236 Ga0496115_0116966 3300048918 Bacteria 2193
237 Ga0501037_0506067 3300049573 Unclassified 819
238 Ga0501039_0297347 3300049575 Unclassified 1269
239 Ga0501039_0907992 3300049575 Bacteria 685
240 Ga0501041_0150994 3300049577 Bacteria 1451
241 Ga0501041_0231947 3300049577 Unclassified 1159
242 Ga0501042_0200954 3300049578 Unclassified 1437
243 Ga0501046_0406699 3300049580 Bacteria 982
244 Ga0501072_0024494 3300049588 Bacteria 4695
245 Ga0501072_0046824 3300049588 Unclassified 3405
246 Ga0501072_0083903 3300049588 Bacteria 2526
247 Ga0501074_0121146 3300049590 Bacteria 1871
248 Ga0501074_0359531 3300049590 Unclassified 1033
249 Ga0501075_0149179 3300049591 Unclassified 1782
250 Ga0501076_0080772 3300049592 Unclassified 2610
251 Ga0501076_0107481 3300049592 Bacteria 2253
252 Ga0501076_0433361 3300049592 Bacteria 1082
253 Ga0501079_0110269 3300049741 Unclassified 2138
254 Ga0501080_0228052 3300049742 Unclassified 1703
255 Ga0501081_0025027 3300049743 Bacteria 4013
256 Ga0501045_0066310 3300049824 Bacteria 2651
257 nmdc:mga00v17_136006_c1 3300050491 Bacteria 1573
258 nmdc:mga00v17_64968_c1 3300050491 Unclassified 2250
259 nmdc:mga05p37_138730_c1 3300050507 Bacteria 2980
260 nmdc:mga05p37_22272_c1 3300050507 Bacteria 7683
261 nmdc:mga05p37_41995_c1 3300050507 Bacteria 5617
262 nmdc:mga05p37_976099_c1 3300050507 Bacteria 903
263 nmdc:mga09592_1403_c1 3300050508 Bacteria 19281
264 nmdc:mga09592_637099_c1 3300050508 Unclassified 911
265 nmdc:mga06r32_394899_c1 3300050510 Bacteria 1365
266 nmdc:mga0n895_114397_c1 3300050512 Bacteria 2716
267 nmdc:mga0n895_330697_c1 3300050512 Unclassified 1544
268 nmdc:mga0n895_530116_c1 3300050512 Bacteria 1185
269 nmdc:mga0n895_667566_c1 3300050512 Bacteria 1037
270 nmdc:mga08x19_22921_c1 3300050514 Bacteria 3871
271 nmdc:mga08x19_7260_c1 3300050514 Bacteria 6580
272 nmdc:mga0a205_621315_c1 3300050515 Bacteria 933
273 Ga0495601_0068080 3300053077 Unclassified 2269
274 Ga0495595_0006276 3300053084 Bacteria 4842
275 Ga0495619_0207486 3300053085 Unclassified 1357
276 Ga0495619_0507689 3300053085 Bacteria 829
277 Ga0501084_0144008 3300054114 Unclassified 2007
278 Ga0501082_0073036 3300060353 Bacteria 2955
279 Ga0501082_0180041 3300060353 Bacteria 1838
280 Ga0501082_0318482 3300060353 Bacteria 1355
281 Ga0530510_0099685 3300061734 Bacteria 2124

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006871 Ga0075434_100139825 Ga0075434_1001398252 199
2 3300007076 Ga0075435_100003625 Ga0075435_1000036257 199
3 3300049588 Ga0501072_0083903 Ga0501072_0083903_255_890 199
4 3300005355 Ga0070671_100376669 Ga0070671_1003766692 200
5 3300005578 Ga0068854_100320400 Ga0068854_1003204002 200
6 3300005843 Ga0068860_100395758 Ga0068860_1003957582 200
7 3300025981 Ga0207640_10430618 Ga0207640_104306181 200
8 3300049577 Ga0501041_0150994 Ga0501041_0150994_679_1314 200
9 3300005354 Ga0070675_100000033 Ga0070675_1000000332 201
10 3300006852 Ga0075433_10136187 Ga0075433_101361872 201
11 3300017792 Ga0163161_10159369 Ga0163161_101593692 201
12 3300048912 Ga0496109_0703731 Ga0496109_0703731_252_857 201
13 3300049575 Ga0501039_0907992 Ga0501039_0907992_15_644 201
14 3300050507 nmdc:mga05p37_976099_c1 nmdc:mga05p37_976099_c1_225_848 201
15 3300009147 Ga0114129_10257941 Ga0114129_102579412 202
16 3300047471 Ga0495684_0609339 Ga0495684_0609339_37_660 202
17 3300005444 Ga0070694_100497399 Ga0070694_1004973991 203
18 3300026089 Ga0207648_10501571 Ga0207648_105015711 203
19 3300036401 Ga0373937_1049447 Ga0373937_1049447_49_681 204
20 3300005548 Ga0070665_100115742 Ga0070665_1001157422 205
21 3300006237 Ga0097621_100040252 Ga0097621_1000402522 205
22 3300006358 Ga0068871_100182507 Ga0068871_1001825072 205
23 3300014969 Ga0157376_10252136 Ga0157376_102521362 205
24 3300025961 Ga0207712_10366526 Ga0207712_103665262 205
25 3300061734 Ga0530510_0099685 Ga0530510_0099685_1213_1851 205
26 3300005344 Ga0070661_100036711 Ga0070661_1000367113 207
27 3300006880 Ga0075429_100640809 Ga0075429_1006408092 207
28 3300009093 Ga0105240_10088750 Ga0105240_100887503 207
29 3300025913 Ga0207695_10187791 Ga0207695_101877912 207
30 3300025944 Ga0207661_10938326 Ga0207661_109383262 207
31 3300005356 Ga0070674_100042309 Ga0070674_1000423093 208
32 3300006051 Ga0075364_10001809 Ga0075364_100018093 208
33 3300006237 Ga0097621_100150108 Ga0097621_1001501082 208
34 3300006358 Ga0068871_100059923 Ga0068871_1000599233 208
35 3300006358 Ga0068871_100182686 Ga0068871_1001826862 208
36 3300006871 Ga0075434_100378164 Ga0075434_1003781642 208
37 3300007076 Ga0075435_100067142 Ga0075435_1000671422 208
38 3300009176 Ga0105242_10067952 Ga0105242_100679522 208
39 3300009177 Ga0105248_10085810 Ga0105248_100858103 208
40 3300013308 Ga0157375_10149525 Ga0157375_101495252 208
41 3300014969 Ga0157376_10005217 Ga0157376_100052176 208
42 3300025941 Ga0207711_10060635 Ga0207711_100606352 208
43 3300026089 Ga0207648_10687550 Ga0207648_106875502 208
44 3300026121 Ga0207683_10049956 Ga0207683_100499562 208
45 3300035120 Ga0373957_0237327 Ga0373957_0237327_50_694 208
46 3300048907 Ga0496104_0295295 Ga0496104_0295295_509_1240 208
47 3300050491 nmdc:mga00v17_64968_c1 nmdc:mga00v17_64968_c1_977_1654 208
48 3300050512 nmdc:mga0n895_330697_c1 nmdc:mga0n895_330697_c1_123_752 208
49 3300005356 Ga0070674_100253124 Ga0070674_1002531242 209
50 3300005356 Ga0070674_100364587 Ga0070674_1003645871 209
51 3300005364 Ga0070673_100236954 Ga0070673_1002369541 209
52 3300006881 Ga0068865_100017526 Ga0068865_1000175265 209
53 3300006881 Ga0068865_100041660 Ga0068865_1000416602 209
54 3300009147 Ga0114129_10255085 Ga0114129_102550852 209
55 3300009176 Ga0105242_10047075 Ga0105242_100470753 209
56 3300014326 Ga0157380_10008829 Ga0157380_100088294 209
57 3300014745 Ga0157377_10116558 Ga0157377_101165582 209
58 3300025903 Ga0207680_10145514 Ga0207680_101455142 209
59 3300025923 Ga0207681_10403678 Ga0207681_104036782 209
60 3300025926 Ga0207659_10363456 Ga0207659_103634562 209
61 3300025938 Ga0207704_10045406 Ga0207704_100454062 209
62 3300028379 Ga0268266_10078460 Ga0268266_100784602 209
63 3300034816 Ga0373930_0001261 Ga0373930_0001261_140_841 209
64 3300034817 Ga0373948_0024001 Ga0373948_0024001_365_1066 209
65 3300034819 Ga0373958_0054935 Ga0373958_0054935_120_821 209
66 3300034820 Ga0373959_0001468 Ga0373959_0001468_279_980 209
67 3300035085 Ga0373929_0006255 Ga0373929_0006255_1185_1886 209
68 3300035088 Ga0373940_0000502 Ga0373940_0000502_312_1013 209
69 3300035090 Ga0373949_0001047 Ga0373949_0001047_5412_6113 209
70 3300035091 Ga0373951_0000611 Ga0373951_0000611_5104_5805 209
71 3300035112 Ga0373932_0000722 Ga0373932_0000722_5551_6252 209
72 3300035114 Ga0373939_0001246 Ga0373939_0001246_1498_2199 209
73 3300035115 Ga0373941_0002054 Ga0373941_0002054_3181_3882 209
74 3300035121 Ga0373960_0023654 Ga0373960_0023654_856_1557 209
75 3300035207 Ga0373942_0001224 Ga0373942_0001224_5445_6146 209
76 3300035241 Ga0373961_0001854 Ga0373961_0001854_1369_2070 209
77 3300035691 Ga0373931_0023662 Ga0373931_0023662_1567_2268 209
78 3300045051 Ga0451576_0023923 Ga0451576_0023923_2084_2785 209
79 3300048907 Ga0496104_0269230 Ga0496104_0269230_593_1315 209
80 3300049577 Ga0501041_0231947 Ga0501041_0231947_57_758 209
81 3300049580 Ga0501046_0406699 Ga0501046_0406699_183_884 209
82 3300049588 Ga0501072_0024494 Ga0501072_0024494_1625_2326 209
83 3300049590 Ga0501074_0121146 Ga0501074_0121146_418_1119 209
84 3300049592 Ga0501076_0107481 Ga0501076_0107481_548_1249 209
85 3300049824 Ga0501045_0066310 Ga0501045_0066310_1043_1744 209
86 3300050507 nmdc:mga05p37_41995_c1 nmdc:mga05p37_41995_c1_4014_4682 209
87 3300050508 nmdc:mga09592_637099_c1 nmdc:mga09592_637099_c1_166_834 209
88 3300050510 nmdc:mga06r32_394899_c1 nmdc:mga06r32_394899_c1_413_1114 209
89 3300060353 Ga0501082_0318482 Ga0501082_0318482_133_825 209
90 3300005330 Ga0070690_100001651 Ga0070690_1000016517 210
91 3300005335 Ga0070666_10013190 Ga0070666_100131903 210
92 3300005440 Ga0070705_100008213 Ga0070705_1000082133 210
93 3300005441 Ga0070700_100417751 Ga0070700_1004177512 210
94 3300005444 Ga0070694_100004048 Ga0070694_1000040487 210
95 3300005458 Ga0070681_10132142 Ga0070681_101321422 210
96 3300005467 Ga0070706_100288122 Ga0070706_1002881221 210
97 3300005518 Ga0070699_100482512 Ga0070699_1004825122 210
98 3300005530 Ga0070679_100221348 Ga0070679_1002213482 210
99 3300005545 Ga0070695_100097423 Ga0070695_1000974232 210
100 3300005549 Ga0070704_100006638 Ga0070704_1000066383 210
101 3300005563 Ga0068855_100245638 Ga0068855_1002456382 210
102 3300006163 Ga0070715_10021460 Ga0070715_100214602 210
103 3300006237 Ga0097621_100055431 Ga0097621_1000554313 210
104 3300006358 Ga0068871_100013584 Ga0068871_1000135842 210
105 3300013306 Ga0163162_10252091 Ga0163162_102520912 210
106 3300025910 Ga0207684_10180507 Ga0207684_101805072 210
107 3300025912 Ga0207707_10454205 Ga0207707_104542052 210
108 3300025926 Ga0207659_10001001 Ga0207659_1000100113 210
109 3300025981 Ga0207640_10098628 Ga0207640_100986282 210
110 3300028381 Ga0268264_10421477 Ga0268264_104214772 210
111 3300031995 Ga0307409_100436915 Ga0307409_1004369152 210
112 3300036401 Ga0373937_0063850 Ga0373937_0063850_987_1658 210
113 3300046681 Ga0495647_0225980 Ga0495647_0225980_30_701 210
114 3300046683 Ga0495658_0029252 Ga0495658_0029252_691_1362 210
115 3300046684 Ga0495669_0078683 Ga0495669_0078683_433_1086 210
116 3300048903 Ga0496100_0111358 Ga0496100_0111358_591_1262 210
117 3300048904 Ga0496101_0000253 Ga0496101_0000253_24897_25568 210
118 3300048906 Ga0496103_0340846 Ga0496103_0340846_120_791 210
119 3300048907 Ga0496104_0003824 Ga0496104_0003824_1653_2324 210
120 3300048908 Ga0496105_0025515 Ga0496105_0025515_3712_4383 210
121 3300048910 Ga0496107_0054096 Ga0496107_0054096_2149_2820 210
122 3300048917 Ga0496114_0001314 Ga0496114_0001314_3751_4422 210
123 3300048918 Ga0496115_0116966 Ga0496115_0116966_211_882 210
124 3300049592 Ga0501076_0433361 Ga0501076_0433361_216_881 210
125 3300053085 Ga0495619_0507689 Ga0495619_0507689_18_689 210
126 3300005434 Ga0070709_10644013 Ga0070709_106440131 211
127 3300005435 Ga0070714_100032037 Ga0070714_1000320373 211
128 3300005456 Ga0070678_100565859 Ga0070678_1005658592 211
129 3300006028 Ga0070717_10280442 Ga0070717_102804422 211
130 3300009093 Ga0105240_10987887 Ga0105240_109878872 211
131 3300009094 Ga0111539_10538034 Ga0111539_105380342 211
132 3300009098 Ga0105245_10045050 Ga0105245_100450503 211
133 3300009177 Ga0105248_10350501 Ga0105248_103505012 211
134 3300017792 Ga0163161_10107007 Ga0163161_101070072 211
135 3300025906 Ga0207699_10441948 Ga0207699_104419482 211
136 3300025913 Ga0207695_10222486 Ga0207695_102224862 211
137 3300025927 Ga0207687_10022228 Ga0207687_100222282 211
138 3300025929 Ga0207664_10024176 Ga0207664_100241764 211
139 3300026089 Ga0207648_10205526 Ga0207648_102055262 211
140 3300049573 Ga0501037_0506067 Ga0501037_0506067_67_729 211
141 3300049575 Ga0501039_0297347 Ga0501039_0297347_319_981 211
142 3300049578 Ga0501042_0200954 Ga0501042_0200954_317_979 211
143 3300049588 Ga0501072_0046824 Ga0501072_0046824_1477_2139 211
144 3300049591 Ga0501075_0149179 Ga0501075_0149179_480_1142 211
145 3300049592 Ga0501076_0080772 Ga0501076_0080772_1026_1688 211
146 3300049741 Ga0501079_0110269 Ga0501079_0110269_1118_1780 211
147 3300049742 Ga0501080_0228052 Ga0501080_0228052_1021_1683 211
148 3300049743 Ga0501081_0025027 Ga0501081_0025027_3310_3972 211
149 3300054114 Ga0501084_0144008 Ga0501084_0144008_702_1364 211
150 3300060353 Ga0501082_0180041 Ga0501082_0180041_783_1445 211
151 3300005331 Ga0070670_100048627 Ga0070670_1000486272 212
152 3300005536 Ga0070697_100678907 Ga0070697_1006789071 212
153 3300005577 Ga0068857_100140946 Ga0068857_1001409462 212
154 3300005617 Ga0068859_100007908 Ga0068859_1000079085 212
155 3300005841 Ga0068863_100540383 Ga0068863_1005403832 212
156 3300006931 Ga0097620_100007908 Ga0097620_1000079085 212
157 3300009147 Ga0114129_10033295 Ga0114129_100332952 212
158 3300025925 Ga0207650_10101589 Ga0207650_101015892 212
159 3300026116 Ga0207674_10027441 Ga0207674_100274414 212
160 3300050507 nmdc:mga05p37_138730_c1 nmdc:mga05p37_138730_c1_1968_2675 212
161 3300060353 Ga0501082_0073036 Ga0501082_0073036_955_1626 212
162 3300005345 Ga0070692_10478244 Ga0070692_104782441 213
163 3300005471 Ga0070698_100298739 Ga0070698_1002987392 213
164 3300005539 Ga0068853_100284773 Ga0068853_1002847732 213
165 3300006051 Ga0075364_10149586 Ga0075364_101495862 213
166 3300006844 Ga0075428_100018272 Ga0075428_1000182729 213
167 3300006847 Ga0075431_100066369 Ga0075431_1000663693 213
168 3300006880 Ga0075429_100009755 Ga0075429_1000097554 213
169 3300009147 Ga0114129_10022673 Ga0114129_100226736 213
170 3300009177 Ga0105248_10065238 Ga0105248_100652382 213
171 3300014968 Ga0157379_10148298 Ga0157379_101482981 213
172 3300025937 Ga0207669_10022707 Ga0207669_100227073 213
173 3300026041 Ga0207639_10540799 Ga0207639_105407992 213
174 3300026075 Ga0207708_10103601 Ga0207708_101036011 213
175 3300050491 nmdc:mga00v17_136006_c1 nmdc:mga00v17_136006_c1_158_847 213
176 3300050507 nmdc:mga05p37_22272_c1 nmdc:mga05p37_22272_c1_5022_5699 213
177 3300050508 nmdc:mga09592_1403_c1 nmdc:mga09592_1403_c1_3909_4586 213
178 3300050512 nmdc:mga0n895_530116_c1 nmdc:mga0n895_530116_c1_317_1009 213
179 3300005328 Ga0070676_10343919 Ga0070676_103439192 214
180 3300005334 Ga0068869_100102733 Ga0068869_1001027333 214
181 3300005364 Ga0070673_100001066 Ga0070673_1000010662 214
182 3300005530 Ga0070679_100227038 Ga0070679_1002270382 214
183 3300005544 Ga0070686_100581633 Ga0070686_1005816332 214
184 3300006358 Ga0068871_100002203 Ga0068871_10000220311 214
185 3300006914 Ga0075436_100158305 Ga0075436_1001583052 214
186 3300009177 Ga0105248_10030971 Ga0105248_100309713 214
187 3300025932 Ga0207690_10258211 Ga0207690_102582113 214
188 3300025981 Ga0207640_10025740 Ga0207640_100257402 214
189 3300035115 Ga0373941_0034713 Ga0373941_0034713_638_1342 214
190 3300042134 Ga0450898_012688 Ga0450898_012688_530_1222 214
191 3300048903 Ga0496100_0348326 Ga0496100_0348326_219_908 214
192 3300048907 Ga0496104_0396228 Ga0496104_0396228_496_1185 214
193 3300050512 nmdc:mga0n895_667566_c1 nmdc:mga0n895_667566_c1_20_793 214
194 3300050514 nmdc:mga08x19_7260_c1 nmdc:mga08x19_7260_c1_1042_1743 214
195 3300050515 nmdc:mga0a205_621315_c1 nmdc:mga0a205_621315_c1_91_864 214
196 3300005467 Ga0070706_100177602 Ga0070706_1001776022 215
197 3300005471 Ga0070698_100062058 Ga0070698_1000620582 215
198 3300005536 Ga0070697_100667524 Ga0070697_1006675241 215
199 3300005445 Ga0070708_100061495 Ga0070708_1000614953 216
200 3300005471 Ga0070698_100058121 Ga0070698_1000581213 216
201 3300006844 Ga0075428_100189891 Ga0075428_1001898912 216
202 3300006914 Ga0075436_100011536 Ga0075436_1000115362 216
203 3300050514 nmdc:mga08x19_22921_c1 nmdc:mga08x19_22921_c1_2963_3664 216
204 3300005367 Ga0070667_100360130 Ga0070667_1003601302 217
205 3300006358 Ga0068871_100217772 Ga0068871_1002177722 217
206 3300006881 Ga0068865_100440659 Ga0068865_1004406592 217
207 3300009177 Ga0105248_10049436 Ga0105248_100494362 217
208 3300013308 Ga0157375_10066817 Ga0157375_100668172 217
209 3300014969 Ga0157376_10059367 Ga0157376_100593672 217
210 3300025938 Ga0207704_10433250 Ga0207704_104332502 217
211 3300025941 Ga0207711_10127560 Ga0207711_101275602 217
212 3300025986 Ga0207658_10358272 Ga0207658_103582722 217
213 3300045976 Ga0466967_0107335 Ga0466967_0107335_968_1648 217
214 3300046535 Ga0495586_0223134 Ga0495586_0223134_70_738 217
215 3300046559 Ga0495667_0083053 Ga0495667_0083053_499_1167 217
216 3300046683 Ga0495658_0274284 Ga0495658_0274284_235_903 217
217 3300046809 Ga0495600_0271466 Ga0495600_0271466_136_804 217
218 3300053077 Ga0495601_0068080 Ga0495601_0068080_472_1140 217
219 3300053085 Ga0495619_0207486 Ga0495619_0207486_408_1076 217
220 3300005535 Ga0070684_100066848 Ga0070684_1000668482 218
221 3300005614 Ga0068856_100039481 Ga0068856_1000394812 218
222 3300013297 Ga0157378_10011823 Ga0157378_100118236 218
223 3300013308 Ga0157375_11378500 Ga0157375_113785001 218
224 3300025939 Ga0207665_10071205 Ga0207665_100712052 218
225 3300026078 Ga0207702_10014647 Ga0207702_100146472 218
226 3300048912 Ga0496109_0057907 Ga0496109_0057907_1261_1917 218
227 3300048916 Ga0496113_0284035 Ga0496113_0284035_78_734 218
228 3300006852 Ga0075433_10087239 Ga0075433_100872392 219
229 3300048909 Ga0496106_0068560 Ga0496106_0068560_1756_2415 219
230 3300049590 Ga0501074_0359531 Ga0501074_0359531_37_750 219
231 3300005339 Ga0070660_100004376 Ga0070660_1000043767 220
232 3300005458 Ga0070681_10096748 Ga0070681_100967482 220
233 3300005530 Ga0070679_100102546 Ga0070679_1001025462 220
234 3300005563 Ga0068855_100006073 Ga0068855_1000060737 220
235 3300006358 Ga0068871_100045574 Ga0068871_1000455742 220
236 3300009177 Ga0105248_10019632 Ga0105248_100196325 220
237 3300014969 Ga0157376_10200492 Ga0157376_102004922 220
238 3300025912 Ga0207707_10348222 Ga0207707_103482222 220
239 3300025919 Ga0207657_10004760 Ga0207657_100047602 220
240 3300025921 Ga0207652_10043570 Ga0207652_100435703 220
241 3300025949 Ga0207667_10035458 Ga0207667_100354583 220
242 3300031711 Ga0265314_10015825 Ga0265314_100158252 220
243 3300005334 Ga0068869_100279919 Ga0068869_1002799192 221
244 3300005336 Ga0070680_100018295 Ga0070680_1000182954 221
245 3300005337 Ga0070682_100220177 Ga0070682_1002201772 221
246 3300005339 Ga0070660_100007927 Ga0070660_1000079275 221
247 3300005366 Ga0070659_100061978 Ga0070659_1000619782 221
248 3300005458 Ga0070681_10010364 Ga0070681_100103645 221
249 3300005719 Ga0068861_100058412 Ga0068861_1000584122 221
250 3300005844 Ga0068862_100137164 Ga0068862_1001371642 221
251 3300025917 Ga0207660_10010076 Ga0207660_100100765 221
252 3300025919 Ga0207657_10056338 Ga0207657_100563383 221
253 3300026118 Ga0207675_100045511 Ga0207675_1000455113 221
254 3300028380 Ga0268265_10298712 Ga0268265_102987122 221
255 3300035691 Ga0373931_0341456 Ga0373931_0341456_203_868 221
256 3300036401 Ga0373937_0325100 Ga0373937_0325100_748_1413 221
257 3300048905 Ga0496102_0228893 Ga0496102_0228893_527_1192 221
258 3300048908 Ga0496105_0078656 Ga0496105_0078656_1220_1885 221
259 3300048915 Ga0496112_0033274 Ga0496112_0033274_2899_3564 221
260 3300048916 Ga0496113_0319803 Ga0496113_0319803_350_1015 221
261 3300005844 Ga0068862_100313095 Ga0068862_1003130952 222
262 3300006028 Ga0070717_10103006 Ga0070717_101030063 222
263 3300006844 Ga0075428_100257426 Ga0075428_1002574262 222
264 3300014326 Ga0157380_10037164 Ga0157380_100371642 222
265 3300025928 Ga0207700_10005587 Ga0207700_100055876 222
266 3300035086 Ga0373934_0072066 Ga0373934_0072066_335_1003 222
267 3300035117 Ga0373953_0058480 Ga0373953_0058480_755_1423 222
268 3300035119 Ga0373956_0160785 Ga0373956_0160785_206_874 222
269 3300035695 Ga0373927_0111975 Ga0373927_0111975_901_1569 222
270 3300035725 Ga0373947_0116046 Ga0373947_0116046_772_1440 222
271 3300036401 Ga0373937_0502358 Ga0373937_0502358_30_698 222
272 3300046514 Ga0495618_0111860 Ga0495618_0111860_933_1601 222
273 3300046516 Ga0495628_0256327 Ga0495628_0256327_14_682 222
274 3300046678 Ga0495599_0134565 Ga0495599_0134565_784_1452 222
275 3300047317 Ga0495604_0177928 Ga0495604_0177928_315_983 222
276 3300047444 Ga0495675_0364154 Ga0495675_0364154_111_779 222
277 3300050512 nmdc:mga0n895_114397_c1 nmdc:mga0n895_114397_c1_613_1281 222
278 3300053084 Ga0495595_0006276 Ga0495595_0006276_2574_3242 222
279 3300005293 Ga0065715_10035105 Ga0065715_100351052 223
280 3300005340 Ga0070689_100424642 Ga0070689_1004246422 223
281 3300005544 Ga0070686_100042581 Ga0070686_1000425812 223

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13620

CarboxypepD_reg

Carboxypeptidase regulatory-like domain

186

248

0.91

PF14686

fn3_3

Polysaccharide lyase family 4, domain II

193

243

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fc9-assembly1.cif.gz_D novel purple cupredoxin from nitrosopumilus maritimus 0.908 87 167
2jxm-assembly1.cif.gz_A ensemble of twenty structures of the prochlorothrix hollandica plastocyanin- cytochrome f complex 0.8719 85 167
5ysg-assembly3.cif.gz_C x-ray crystal structure of pseudoazurin met16gly variant, reduced form. 0.8626 85 167
6akn-assembly2.cif.gz_B x-ray crystal structure of pseudoazurin met16leu variant 0.8606 85 167
1m9w-assembly1.cif.gz_A study of electrostatic potential surface distribution using high resolution side-chain conformation determined by nmr 0.8589 85 167
ID Description Score Start End Superfamily
5fc9B00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9096 87 167 2.60.40.420
af_Q54VX3_19_99_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8716 85 167 2.60.40.420
1jxdA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8569 85 167 2.60.40.420
5ysgA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8551 85 167 2.60.40.420
1b3iA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8387 85 167 2.60.40.420
ID Description Score Start End GO Terms
AF-A0A519C345-F1-model_v4 Blue (type 1) copper domain-containing protein 0.9748 85 167 GO:0005507
GO:0009055
GO:0042597
AF-A0A1F6DTK2-F1-model_v4 Blue (type 1) copper domain-containing protein 0.9703 89 168 GO:0005507
GO:0009055
AF-I3WZF7-F1-model_v4 EfeO-type cupredoxin-like domain-containing protein 0.9673 98 167
AF-A0A1I4BYP3-F1-model_v4 Copper binding protein, plastocyanin/azurin family 0.9631 89 167 GO:0005507
GO:0009055
GO:0042597
AF-A0A1G0ATZ2-F1-model_v4 deleted 0.9565 80 167

Feature Viewer

pLDDT pTM Quality
84.43 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map