F384087
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 281 | 186 | 281 | 222 |
Family's Representative Sequence
| Representative Sequence | 3300005334|Ga0068869_100279919|Ga0068869_1002799192 |
| Length | 248 |
| Sequence | MKKAQGTQIKPRTQRNTPVLALSVCVFFFVSLVPFASFVRGRAAVLTAAAAAGGTIRGRVELRRVASPVERRPNVSDLGAPLARDVSDRLRSVVYLESAPRRAFEQSQPGHAVLDQRDERFVPHVLAITTGTSVDFPNSDRIYHNVFSLSKAARFDLGRYAVGHSKSVRFDQAGIVRVFCDIHSHMNAFILVFSHPFFAVTDEEGRYRIENVPPGTYSVVAWNEGLSSESRPVTVLDGGAAELDFTLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 47 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 49 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 52 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 53 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 54 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 55 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 56 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 57 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 58 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 61 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 110 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 111 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 112 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 113 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 114 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 115 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 116 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 117 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 118 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 119 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 120 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 121 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 122 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 123 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 124 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 125 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 126 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 127 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 128 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 129 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 130 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 131 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 132 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 133 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 134 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 135 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 136 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 150 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 151 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 152 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 153 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 154 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 155 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 156 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 157 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 158 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 159 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 160 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 161 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 175 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.42 |
| Nodule | 0 |
| Rhizoplane | 7.12 |
| Rhizosphere | 91.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10035105 | 3300005293 | Bacteria | 1381 |
| 2 | Ga0070676_10343919 | 3300005328 | Bacteria | 1024 |
| 3 | Ga0070690_100001651 | 3300005330 | Bacteria | 11742 |
| 4 | Ga0070670_100048627 | 3300005331 | Unclassified | 3649 |
| 5 | Ga0068869_100102733 | 3300005334 | Bacteria | 2164 |
| 6 | Ga0068869_100279919 | 3300005334 | Unclassified | 1341 |
| 7 | Ga0070666_10013190 | 3300005335 | Bacteria | 5239 |
| 8 | Ga0070680_100018295 | 3300005336 | Bacteria | 5534 |
| 9 | Ga0070682_100220177 | 3300005337 | Bacteria | 1350 |
| 10 | Ga0070660_100004376 | 3300005339 | Bacteria | 9753 |
| 11 | Ga0070660_100007927 | 3300005339 | Bacteria | 7411 |
| 12 | Ga0070689_100424642 | 3300005340 | Bacteria | 1127 |
| 13 | Ga0070661_100036711 | 3300005344 | Bacteria | 3562 |
| 14 | Ga0070692_10478244 | 3300005345 | Bacteria | 803 |
| 15 | Ga0070675_100000033 | 3300005354 | Bacteria | 94281 |
| 16 | Ga0070671_100376669 | 3300005355 | Bacteria | 1213 |
| 17 | Ga0070674_100042309 | 3300005356 | Bacteria | 3094 |
| 18 | Ga0070674_100253124 | 3300005356 | Unclassified | 1384 |
| 19 | Ga0070674_100364587 | 3300005356 | Bacteria | 1171 |
| 20 | Ga0070673_100001066 | 3300005364 | Bacteria | 15656 |
| 21 | Ga0070673_100236954 | 3300005364 | Unclassified | 1585 |
| 22 | Ga0070659_100061978 | 3300005366 | Bacteria | 2955 |
| 23 | Ga0070667_100360130 | 3300005367 | Viruses | 1318 |
| 24 | Ga0070709_10644013 | 3300005434 | Bacteria | 820 |
| 25 | Ga0070714_100032037 | 3300005435 | Bacteria | 4388 |
| 26 | Ga0070705_100008213 | 3300005440 | Bacteria | 5165 |
| 27 | Ga0070700_100417751 | 3300005441 | Bacteria | 1013 |
| 28 | Ga0070694_100004048 | 3300005444 | Bacteria | 8783 |
| 29 | Ga0070694_100497399 | 3300005444 | Bacteria | 970 |
| 30 | Ga0070708_100061495 | 3300005445 | Unclassified | 3355 |
| 31 | Ga0070678_100565859 | 3300005456 | Bacteria | 1011 |
| 32 | Ga0070681_10010364 | 3300005458 | Bacteria | 9202 |
| 33 | Ga0070681_10096748 | 3300005458 | Unclassified | 2900 |
| 34 | Ga0070681_10132142 | 3300005458 | Bacteria | 2428 |
| 35 | Ga0070706_100177602 | 3300005467 | Unclassified | 1988 |
| 36 | Ga0070706_100288122 | 3300005467 | Bacteria | 1533 |
| 37 | Ga0070698_100058121 | 3300005471 | Unclassified | 3911 |
| 38 | Ga0070698_100062058 | 3300005471 | Bacteria | 3771 |
| 39 | Ga0070698_100298739 | 3300005471 | Archaea | 1541 |
| 40 | Ga0070699_100482512 | 3300005518 | Bacteria | 1125 |
| 41 | Ga0070679_100102546 | 3300005530 | Unclassified | 2847 |
| 42 | Ga0070679_100221348 | 3300005530 | Unclassified | 1854 |
| 43 | Ga0070679_100227038 | 3300005530 | Bacteria | 1827 |
| 44 | Ga0070684_100066848 | 3300005535 | Bacteria | 3156 |
| 45 | Ga0070697_100667524 | 3300005536 | Unclassified | 916 |
| 46 | Ga0070697_100678907 | 3300005536 | Unclassified | 908 |
| 47 | Ga0068853_100284773 | 3300005539 | Bacteria | 1524 |
| 48 | Ga0070686_100042581 | 3300005544 | Unclassified | 2845 |
| 49 | Ga0070686_100581633 | 3300005544 | Bacteria | 880 |
| 50 | Ga0070695_100097423 | 3300005545 | Bacteria | 1975 |
| 51 | Ga0070665_100115742 | 3300005548 | Bacteria | 2684 |
| 52 | Ga0070704_100006638 | 3300005549 | Bacteria | 6832 |
| 53 | Ga0068855_100006073 | 3300005563 | Bacteria | 14723 |
| 54 | Ga0068855_100245638 | 3300005563 | Bacteria | 1998 |
| 55 | Ga0068857_100140946 | 3300005577 | Bacteria | 2179 |
| 56 | Ga0068854_100320400 | 3300005578 | Bacteria | 1260 |
| 57 | Ga0068856_100039481 | 3300005614 | Bacteria | 4635 |
| 58 | Ga0068859_100007908 | 3300005617 | Bacteria | 10786 |
| 59 | Ga0068861_100058412 | 3300005719 | Bacteria | 2950 |
| 60 | Ga0068863_100540383 | 3300005841 | Unclassified | 1150 |
| 61 | Ga0068860_100395758 | 3300005843 | Bacteria | 1366 |
| 62 | Ga0068862_100137164 | 3300005844 | Bacteria | 2169 |
| 63 | Ga0068862_100313095 | 3300005844 | Bacteria | 1447 |
| 64 | Ga0070717_10103006 | 3300006028 | Bacteria | 2426 |
| 65 | Ga0070717_10280442 | 3300006028 | Bacteria | 1478 |
| 66 | Ga0075364_10001809 | 3300006051 | Bacteria | 11848 |
| 67 | Ga0075364_10149586 | 3300006051 | Bacteria | 1573 |
| 68 | Ga0070715_10021460 | 3300006163 | Unclassified | 2505 |
| 69 | Ga0097621_100040252 | 3300006237 | Bacteria | 3757 |
| 70 | Ga0097621_100055431 | 3300006237 | Bacteria | 3237 |
| 71 | Ga0097621_100150108 | 3300006237 | Bacteria | 1998 |
| 72 | Ga0068871_100002203 | 3300006358 | Bacteria | 13241 |
| 73 | Ga0068871_100013584 | 3300006358 | Bacteria | 6046 |
| 74 | Ga0068871_100045574 | 3300006358 | Bacteria | 3530 |
| 75 | Ga0068871_100059923 | 3300006358 | Bacteria | 3103 |
| 76 | Ga0068871_100182507 | 3300006358 | Bacteria | 1804 |
| 77 | Ga0068871_100182686 | 3300006358 | Bacteria | 1803 |
| 78 | Ga0068871_100217772 | 3300006358 | Bacteria | 1653 |
| 79 | Ga0075428_100018272 | 3300006844 | Bacteria | 7750 |
| 80 | Ga0075428_100189891 | 3300006844 | Unclassified | 2222 |
| 81 | Ga0075428_100257426 | 3300006844 | Bacteria | 1880 |
| 82 | Ga0075431_100066369 | 3300006847 | Bacteria | 3725 |
| 83 | Ga0075433_10087239 | 3300006852 | Unclassified | 2756 |
| 84 | Ga0075433_10136187 | 3300006852 | Bacteria | 2183 |
| 85 | Ga0075434_100139825 | 3300006871 | Bacteria | 2441 |
| 86 | Ga0075434_100378164 | 3300006871 | Unclassified | 1437 |
| 87 | Ga0075429_100009755 | 3300006880 | Bacteria | 8323 |
| 88 | Ga0075429_100640809 | 3300006880 | Unclassified | 931 |
| 89 | Ga0068865_100017526 | 3300006881 | Bacteria | 4607 |
| 90 | Ga0068865_100041660 | 3300006881 | Bacteria | 3126 |
| 91 | Ga0068865_100440659 | 3300006881 | Bacteria | 1075 |
| 92 | Ga0075436_100011536 | 3300006914 | Bacteria | 6062 |
| 93 | Ga0075436_100158305 | 3300006914 | Bacteria | 1596 |
| 94 | Ga0097620_100007908 | 3300006931 | Bacteria | 10786 |
| 95 | Ga0075435_100003625 | 3300007076 | Bacteria | 10514 |
| 96 | Ga0075435_100067142 | 3300007076 | Unclassified | 2920 |
| 97 | Ga0105240_10088750 | 3300009093 | Bacteria | 3782 |
| 98 | Ga0105240_10987887 | 3300009093 | Bacteria | 901 |
| 99 | Ga0111539_10538034 | 3300009094 | Bacteria | 1361 |
| 100 | Ga0105245_10045050 | 3300009098 | Bacteria | 3938 |
| 101 | Ga0114129_10022673 | 3300009147 | Bacteria | 8905 |
| 102 | Ga0114129_10033295 | 3300009147 | Bacteria | 7283 |
| 103 | Ga0114129_10255085 | 3300009147 | Bacteria | 2353 |
| 104 | Ga0114129_10257941 | 3300009147 | Unclassified | 2338 |
| 105 | Ga0105242_10047075 | 3300009176 | Bacteria | 3501 |
| 106 | Ga0105242_10067952 | 3300009176 | Bacteria | 2947 |
| 107 | Ga0105248_10019632 | 3300009177 | Bacteria | 7480 |
| 108 | Ga0105248_10030971 | 3300009177 | Bacteria | 5977 |
| 109 | Ga0105248_10049436 | 3300009177 | Bacteria | 4716 |
| 110 | Ga0105248_10065238 | 3300009177 | Bacteria | 4088 |
| 111 | Ga0105248_10085810 | 3300009177 | Bacteria | 3542 |
| 112 | Ga0105248_10350501 | 3300009177 | Bacteria | 1662 |
| 113 | Ga0157378_10011823 | 3300013297 | Bacteria | 7640 |
| 114 | Ga0163162_10252091 | 3300013306 | Bacteria | 1897 |
| 115 | Ga0157375_10066817 | 3300013308 | Viruses | 3591 |
| 116 | Ga0157375_10149525 | 3300013308 | Bacteria | 2469 |
| 117 | Ga0157375_11378500 | 3300013308 | Unclassified | 830 |
| 118 | Ga0157380_10008829 | 3300014326 | Bacteria | 7202 |
| 119 | Ga0157380_10037164 | 3300014326 | Bacteria | 3771 |
| 120 | Ga0157377_10116558 | 3300014745 | Bacteria | 1613 |
| 121 | Ga0157379_10148298 | 3300014968 | Bacteria | 2116 |
| 122 | Ga0157376_10005217 | 3300014969 | Bacteria | 9067 |
| 123 | Ga0157376_10059367 | 3300014969 | Bacteria | 3207 |
| 124 | Ga0157376_10200492 | 3300014969 | Unclassified | 1836 |
| 125 | Ga0157376_10252136 | 3300014969 | Bacteria | 1649 |
| 126 | Ga0163161_10107007 | 3300017792 | Bacteria | 2087 |
| 127 | Ga0163161_10159369 | 3300017792 | Bacteria | 1720 |
| 128 | Ga0207680_10145514 | 3300025903 | Bacteria | 1575 |
| 129 | Ga0207699_10441948 | 3300025906 | Bacteria | 932 |
| 130 | Ga0207684_10180507 | 3300025910 | Bacteria | 1820 |
| 131 | Ga0207707_10348222 | 3300025912 | Unclassified | 1277 |
| 132 | Ga0207707_10454205 | 3300025912 | Unclassified | 1096 |
| 133 | Ga0207695_10187791 | 3300025913 | Bacteria | 1985 |
| 134 | Ga0207695_10222486 | 3300025913 | Bacteria | 1794 |
| 135 | Ga0207660_10010076 | 3300025917 | Bacteria | 6122 |
| 136 | Ga0207657_10004760 | 3300025919 | Bacteria | 14330 |
| 137 | Ga0207657_10056338 | 3300025919 | Bacteria | 3392 |
| 138 | Ga0207652_10043570 | 3300025921 | Unclassified | 3821 |
| 139 | Ga0207681_10403678 | 3300025923 | Unclassified | 1104 |
| 140 | Ga0207650_10101589 | 3300025925 | Unclassified | 2214 |
| 141 | Ga0207659_10001001 | 3300025926 | Bacteria | 16799 |
| 142 | Ga0207659_10363456 | 3300025926 | Unclassified | 1203 |
| 143 | Ga0207687_10022228 | 3300025927 | Bacteria | 4219 |
| 144 | Ga0207700_10005587 | 3300025928 | Bacteria | 7546 |
| 145 | Ga0207664_10024176 | 3300025929 | Bacteria | 4564 |
| 146 | Ga0207690_10258211 | 3300025932 | Bacteria | 1349 |
| 147 | Ga0207669_10022707 | 3300025937 | Bacteria | 3338 |
| 148 | Ga0207704_10045406 | 3300025938 | Bacteria | 2610 |
| 149 | Ga0207704_10433250 | 3300025938 | Bacteria | 1045 |
| 150 | Ga0207665_10071205 | 3300025939 | Bacteria | 2373 |
| 151 | Ga0207711_10060635 | 3300025941 | Bacteria | 3260 |
| 152 | Ga0207711_10127560 | 3300025941 | Bacteria | 2278 |
| 153 | Ga0207661_10938326 | 3300025944 | Bacteria | 797 |
| 154 | Ga0207667_10035458 | 3300025949 | Bacteria | 5351 |
| 155 | Ga0207712_10366526 | 3300025961 | Bacteria | 1202 |
| 156 | Ga0207640_10025740 | 3300025981 | Bacteria | 3565 |
| 157 | Ga0207640_10098628 | 3300025981 | Bacteria | 2043 |
| 158 | Ga0207640_10430618 | 3300025981 | Bacteria | 1082 |
| 159 | Ga0207658_10358272 | 3300025986 | Viruses | 1272 |
| 160 | Ga0207639_10540799 | 3300026041 | Bacteria | 1069 |
| 161 | Ga0207708_10103601 | 3300026075 | Bacteria | 2204 |
| 162 | Ga0207702_10014647 | 3300026078 | Bacteria | 6508 |
| 163 | Ga0207648_10205526 | 3300026089 | Bacteria | 1748 |
| 164 | Ga0207648_10501571 | 3300026089 | Bacteria | 1110 |
| 165 | Ga0207648_10687550 | 3300026089 | Bacteria | 947 |
| 166 | Ga0207674_10027441 | 3300026116 | Bacteria | 6022 |
| 167 | Ga0207675_100045511 | 3300026118 | Bacteria | 4099 |
| 168 | Ga0207683_10049956 | 3300026121 | Bacteria | 3662 |
| 169 | Ga0268266_10078460 | 3300028379 | Bacteria | 2873 |
| 170 | Ga0268265_10298712 | 3300028380 | Bacteria | 1449 |
| 171 | Ga0268264_10421477 | 3300028381 | Unclassified | 1287 |
| 172 | Ga0265314_10015825 | 3300031711 | Bacteria | 5973 |
| 173 | Ga0307409_100436915 | 3300031995 | Unclassified | 1260 |
| 174 | Ga0373930_0001261 | 3300034816 | Bacteria | 3740 |
| 175 | Ga0373948_0024001 | 3300034817 | Bacteria | 1187 |
| 176 | Ga0373958_0054935 | 3300034819 | Bacteria | 849 |
| 177 | Ga0373959_0001468 | 3300034820 | Bacteria | 3764 |
| 178 | Ga0373929_0006255 | 3300035085 | Bacteria | 2150 |
| 179 | Ga0373934_0072066 | 3300035086 | Bacteria | 1383 |
| 180 | Ga0373940_0000502 | 3300035088 | Bacteria | 6105 |
| 181 | Ga0373949_0001047 | 3300035090 | Bacteria | 8464 |
| 182 | Ga0373951_0000611 | 3300035091 | Bacteria | 9826 |
| 183 | Ga0373932_0000722 | 3300035112 | Bacteria | 9961 |
| 184 | Ga0373939_0001246 | 3300035114 | Bacteria | 6221 |
| 185 | Ga0373941_0002054 | 3300035115 | Bacteria | 4367 |
| 186 | Ga0373941_0034713 | 3300035115 | Bacteria | 1523 |
| 187 | Ga0373953_0058480 | 3300035117 | Bacteria | 1572 |
| 188 | Ga0373956_0160785 | 3300035119 | Bacteria | 1058 |
| 189 | Ga0373957_0237327 | 3300035120 | Bacteria | 765 |
| 190 | Ga0373960_0023654 | 3300035121 | Bacteria | 1655 |
| 191 | Ga0373942_0001224 | 3300035207 | Bacteria | 6757 |
| 192 | Ga0373961_0001854 | 3300035241 | Bacteria | 5777 |
| 193 | Ga0373931_0023662 | 3300035691 | Bacteria | 3103 |
| 194 | Ga0373931_0341456 | 3300035691 | Unclassified | 935 |
| 195 | Ga0373927_0111975 | 3300035695 | Bacteria | 1779 |
| 196 | Ga0373947_0116046 | 3300035725 | Bacteria | 1697 |
| 197 | Ga0373937_0063850 | 3300036401 | Bacteria | 3387 |
| 198 | Ga0373937_0325100 | 3300036401 | Bacteria | 1455 |
| 199 | Ga0373937_0502358 | 3300036401 | Bacteria | 1152 |
| 200 | Ga0373937_1049447 | 3300036401 | Unclassified | 764 |
| 201 | Ga0450898_012688 | 3300042134 | Bacteria | 1396 |
| 202 | Ga0451576_0023923 | 3300045051 | Bacteria | 6604 |
| 203 | Ga0466967_0107335 | 3300045976 | Bacteria | 2561 |
| 204 | Ga0495618_0111860 | 3300046514 | Bacteria | 1749 |
| 205 | Ga0495628_0256327 | 3300046516 | Bacteria | 1304 |
| 206 | Ga0495586_0223134 | 3300046535 | Unclassified | 1071 |
| 207 | Ga0495667_0083053 | 3300046559 | Bacteria | 2081 |
| 208 | Ga0495599_0134565 | 3300046678 | Unclassified | 1535 |
| 209 | Ga0495647_0225980 | 3300046681 | Bacteria | 827 |
| 210 | Ga0495658_0029252 | 3300046683 | Unclassified | 2981 |
| 211 | Ga0495658_0274284 | 3300046683 | Bacteria | 1063 |
| 212 | Ga0495669_0078683 | 3300046684 | Bacteria | 1511 |
| 213 | Ga0495600_0271466 | 3300046809 | Unclassified | 1076 |
| 214 | Ga0495604_0177928 | 3300047317 | Bacteria | 1490 |
| 215 | Ga0495675_0364154 | 3300047444 | Bacteria | 848 |
| 216 | Ga0495684_0609339 | 3300047471 | Bacteria | 736 |
| 217 | Ga0496100_0111358 | 3300048903 | Unclassified | 1902 |
| 218 | Ga0496100_0348326 | 3300048903 | Bacteria | 1118 |
| 219 | Ga0496101_0000253 | 3300048904 | Bacteria | 38375 |
| 220 | Ga0496102_0228893 | 3300048905 | Bacteria | 1753 |
| 221 | Ga0496103_0340846 | 3300048906 | Bacteria | 964 |
| 222 | Ga0496104_0003824 | 3300048907 | Bacteria | 13032 |
| 223 | Ga0496104_0269230 | 3300048907 | Unclassified | 1616 |
| 224 | Ga0496104_0295295 | 3300048907 | Bacteria | 1533 |
| 225 | Ga0496104_0396228 | 3300048907 | Unclassified | 1293 |
| 226 | Ga0496105_0025515 | 3300048908 | Bacteria | 4811 |
| 227 | Ga0496105_0078656 | 3300048908 | Bacteria | 2723 |
| 228 | Ga0496106_0068560 | 3300048909 | Bacteria | 2706 |
| 229 | Ga0496107_0054096 | 3300048910 | Bacteria | 2897 |
| 230 | Ga0496109_0057907 | 3300048912 | Unclassified | 3539 |
| 231 | Ga0496109_0703731 | 3300048912 | Bacteria | 948 |
| 232 | Ga0496112_0033274 | 3300048915 | Bacteria | 5010 |
| 233 | Ga0496113_0284035 | 3300048916 | Unclassified | 1324 |
| 234 | Ga0496113_0319803 | 3300048916 | Unclassified | 1244 |
| 235 | Ga0496114_0001314 | 3300048917 | Bacteria | 18831 |
| 236 | Ga0496115_0116966 | 3300048918 | Bacteria | 2193 |
| 237 | Ga0501037_0506067 | 3300049573 | Unclassified | 819 |
| 238 | Ga0501039_0297347 | 3300049575 | Unclassified | 1269 |
| 239 | Ga0501039_0907992 | 3300049575 | Bacteria | 685 |
| 240 | Ga0501041_0150994 | 3300049577 | Bacteria | 1451 |
| 241 | Ga0501041_0231947 | 3300049577 | Unclassified | 1159 |
| 242 | Ga0501042_0200954 | 3300049578 | Unclassified | 1437 |
| 243 | Ga0501046_0406699 | 3300049580 | Bacteria | 982 |
| 244 | Ga0501072_0024494 | 3300049588 | Bacteria | 4695 |
| 245 | Ga0501072_0046824 | 3300049588 | Unclassified | 3405 |
| 246 | Ga0501072_0083903 | 3300049588 | Bacteria | 2526 |
| 247 | Ga0501074_0121146 | 3300049590 | Bacteria | 1871 |
| 248 | Ga0501074_0359531 | 3300049590 | Unclassified | 1033 |
| 249 | Ga0501075_0149179 | 3300049591 | Unclassified | 1782 |
| 250 | Ga0501076_0080772 | 3300049592 | Unclassified | 2610 |
| 251 | Ga0501076_0107481 | 3300049592 | Bacteria | 2253 |
| 252 | Ga0501076_0433361 | 3300049592 | Bacteria | 1082 |
| 253 | Ga0501079_0110269 | 3300049741 | Unclassified | 2138 |
| 254 | Ga0501080_0228052 | 3300049742 | Unclassified | 1703 |
| 255 | Ga0501081_0025027 | 3300049743 | Bacteria | 4013 |
| 256 | Ga0501045_0066310 | 3300049824 | Bacteria | 2651 |
| 257 | nmdc:mga00v17_136006_c1 | 3300050491 | Bacteria | 1573 |
| 258 | nmdc:mga00v17_64968_c1 | 3300050491 | Unclassified | 2250 |
| 259 | nmdc:mga05p37_138730_c1 | 3300050507 | Bacteria | 2980 |
| 260 | nmdc:mga05p37_22272_c1 | 3300050507 | Bacteria | 7683 |
| 261 | nmdc:mga05p37_41995_c1 | 3300050507 | Bacteria | 5617 |
| 262 | nmdc:mga05p37_976099_c1 | 3300050507 | Bacteria | 903 |
| 263 | nmdc:mga09592_1403_c1 | 3300050508 | Bacteria | 19281 |
| 264 | nmdc:mga09592_637099_c1 | 3300050508 | Unclassified | 911 |
| 265 | nmdc:mga06r32_394899_c1 | 3300050510 | Bacteria | 1365 |
| 266 | nmdc:mga0n895_114397_c1 | 3300050512 | Bacteria | 2716 |
| 267 | nmdc:mga0n895_330697_c1 | 3300050512 | Unclassified | 1544 |
| 268 | nmdc:mga0n895_530116_c1 | 3300050512 | Bacteria | 1185 |
| 269 | nmdc:mga0n895_667566_c1 | 3300050512 | Bacteria | 1037 |
| 270 | nmdc:mga08x19_22921_c1 | 3300050514 | Bacteria | 3871 |
| 271 | nmdc:mga08x19_7260_c1 | 3300050514 | Bacteria | 6580 |
| 272 | nmdc:mga0a205_621315_c1 | 3300050515 | Bacteria | 933 |
| 273 | Ga0495601_0068080 | 3300053077 | Unclassified | 2269 |
| 274 | Ga0495595_0006276 | 3300053084 | Bacteria | 4842 |
| 275 | Ga0495619_0207486 | 3300053085 | Unclassified | 1357 |
| 276 | Ga0495619_0507689 | 3300053085 | Bacteria | 829 |
| 277 | Ga0501084_0144008 | 3300054114 | Unclassified | 2007 |
| 278 | Ga0501082_0073036 | 3300060353 | Bacteria | 2955 |
| 279 | Ga0501082_0180041 | 3300060353 | Bacteria | 1838 |
| 280 | Ga0501082_0318482 | 3300060353 | Bacteria | 1355 |
| 281 | Ga0530510_0099685 | 3300061734 | Bacteria | 2124 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006871 | Ga0075434_100139825 | Ga0075434_1001398252 | 199 |
| 2 | 3300007076 | Ga0075435_100003625 | Ga0075435_1000036257 | 199 |
| 3 | 3300049588 | Ga0501072_0083903 | Ga0501072_0083903_255_890 | 199 |
| 4 | 3300005355 | Ga0070671_100376669 | Ga0070671_1003766692 | 200 |
| 5 | 3300005578 | Ga0068854_100320400 | Ga0068854_1003204002 | 200 |
| 6 | 3300005843 | Ga0068860_100395758 | Ga0068860_1003957582 | 200 |
| 7 | 3300025981 | Ga0207640_10430618 | Ga0207640_104306181 | 200 |
| 8 | 3300049577 | Ga0501041_0150994 | Ga0501041_0150994_679_1314 | 200 |
| 9 | 3300005354 | Ga0070675_100000033 | Ga0070675_1000000332 | 201 |
| 10 | 3300006852 | Ga0075433_10136187 | Ga0075433_101361872 | 201 |
| 11 | 3300017792 | Ga0163161_10159369 | Ga0163161_101593692 | 201 |
| 12 | 3300048912 | Ga0496109_0703731 | Ga0496109_0703731_252_857 | 201 |
| 13 | 3300049575 | Ga0501039_0907992 | Ga0501039_0907992_15_644 | 201 |
| 14 | 3300050507 | nmdc:mga05p37_976099_c1 | nmdc:mga05p37_976099_c1_225_848 | 201 |
| 15 | 3300009147 | Ga0114129_10257941 | Ga0114129_102579412 | 202 |
| 16 | 3300047471 | Ga0495684_0609339 | Ga0495684_0609339_37_660 | 202 |
| 17 | 3300005444 | Ga0070694_100497399 | Ga0070694_1004973991 | 203 |
| 18 | 3300026089 | Ga0207648_10501571 | Ga0207648_105015711 | 203 |
| 19 | 3300036401 | Ga0373937_1049447 | Ga0373937_1049447_49_681 | 204 |
| 20 | 3300005548 | Ga0070665_100115742 | Ga0070665_1001157422 | 205 |
| 21 | 3300006237 | Ga0097621_100040252 | Ga0097621_1000402522 | 205 |
| 22 | 3300006358 | Ga0068871_100182507 | Ga0068871_1001825072 | 205 |
| 23 | 3300014969 | Ga0157376_10252136 | Ga0157376_102521362 | 205 |
| 24 | 3300025961 | Ga0207712_10366526 | Ga0207712_103665262 | 205 |
| 25 | 3300061734 | Ga0530510_0099685 | Ga0530510_0099685_1213_1851 | 205 |
| 26 | 3300005344 | Ga0070661_100036711 | Ga0070661_1000367113 | 207 |
| 27 | 3300006880 | Ga0075429_100640809 | Ga0075429_1006408092 | 207 |
| 28 | 3300009093 | Ga0105240_10088750 | Ga0105240_100887503 | 207 |
| 29 | 3300025913 | Ga0207695_10187791 | Ga0207695_101877912 | 207 |
| 30 | 3300025944 | Ga0207661_10938326 | Ga0207661_109383262 | 207 |
| 31 | 3300005356 | Ga0070674_100042309 | Ga0070674_1000423093 | 208 |
| 32 | 3300006051 | Ga0075364_10001809 | Ga0075364_100018093 | 208 |
| 33 | 3300006237 | Ga0097621_100150108 | Ga0097621_1001501082 | 208 |
| 34 | 3300006358 | Ga0068871_100059923 | Ga0068871_1000599233 | 208 |
| 35 | 3300006358 | Ga0068871_100182686 | Ga0068871_1001826862 | 208 |
| 36 | 3300006871 | Ga0075434_100378164 | Ga0075434_1003781642 | 208 |
| 37 | 3300007076 | Ga0075435_100067142 | Ga0075435_1000671422 | 208 |
| 38 | 3300009176 | Ga0105242_10067952 | Ga0105242_100679522 | 208 |
| 39 | 3300009177 | Ga0105248_10085810 | Ga0105248_100858103 | 208 |
| 40 | 3300013308 | Ga0157375_10149525 | Ga0157375_101495252 | 208 |
| 41 | 3300014969 | Ga0157376_10005217 | Ga0157376_100052176 | 208 |
| 42 | 3300025941 | Ga0207711_10060635 | Ga0207711_100606352 | 208 |
| 43 | 3300026089 | Ga0207648_10687550 | Ga0207648_106875502 | 208 |
| 44 | 3300026121 | Ga0207683_10049956 | Ga0207683_100499562 | 208 |
| 45 | 3300035120 | Ga0373957_0237327 | Ga0373957_0237327_50_694 | 208 |
| 46 | 3300048907 | Ga0496104_0295295 | Ga0496104_0295295_509_1240 | 208 |
| 47 | 3300050491 | nmdc:mga00v17_64968_c1 | nmdc:mga00v17_64968_c1_977_1654 | 208 |
| 48 | 3300050512 | nmdc:mga0n895_330697_c1 | nmdc:mga0n895_330697_c1_123_752 | 208 |
| 49 | 3300005356 | Ga0070674_100253124 | Ga0070674_1002531242 | 209 |
| 50 | 3300005356 | Ga0070674_100364587 | Ga0070674_1003645871 | 209 |
| 51 | 3300005364 | Ga0070673_100236954 | Ga0070673_1002369541 | 209 |
| 52 | 3300006881 | Ga0068865_100017526 | Ga0068865_1000175265 | 209 |
| 53 | 3300006881 | Ga0068865_100041660 | Ga0068865_1000416602 | 209 |
| 54 | 3300009147 | Ga0114129_10255085 | Ga0114129_102550852 | 209 |
| 55 | 3300009176 | Ga0105242_10047075 | Ga0105242_100470753 | 209 |
| 56 | 3300014326 | Ga0157380_10008829 | Ga0157380_100088294 | 209 |
| 57 | 3300014745 | Ga0157377_10116558 | Ga0157377_101165582 | 209 |
| 58 | 3300025903 | Ga0207680_10145514 | Ga0207680_101455142 | 209 |
| 59 | 3300025923 | Ga0207681_10403678 | Ga0207681_104036782 | 209 |
| 60 | 3300025926 | Ga0207659_10363456 | Ga0207659_103634562 | 209 |
| 61 | 3300025938 | Ga0207704_10045406 | Ga0207704_100454062 | 209 |
| 62 | 3300028379 | Ga0268266_10078460 | Ga0268266_100784602 | 209 |
| 63 | 3300034816 | Ga0373930_0001261 | Ga0373930_0001261_140_841 | 209 |
| 64 | 3300034817 | Ga0373948_0024001 | Ga0373948_0024001_365_1066 | 209 |
| 65 | 3300034819 | Ga0373958_0054935 | Ga0373958_0054935_120_821 | 209 |
| 66 | 3300034820 | Ga0373959_0001468 | Ga0373959_0001468_279_980 | 209 |
| 67 | 3300035085 | Ga0373929_0006255 | Ga0373929_0006255_1185_1886 | 209 |
| 68 | 3300035088 | Ga0373940_0000502 | Ga0373940_0000502_312_1013 | 209 |
| 69 | 3300035090 | Ga0373949_0001047 | Ga0373949_0001047_5412_6113 | 209 |
| 70 | 3300035091 | Ga0373951_0000611 | Ga0373951_0000611_5104_5805 | 209 |
| 71 | 3300035112 | Ga0373932_0000722 | Ga0373932_0000722_5551_6252 | 209 |
| 72 | 3300035114 | Ga0373939_0001246 | Ga0373939_0001246_1498_2199 | 209 |
| 73 | 3300035115 | Ga0373941_0002054 | Ga0373941_0002054_3181_3882 | 209 |
| 74 | 3300035121 | Ga0373960_0023654 | Ga0373960_0023654_856_1557 | 209 |
| 75 | 3300035207 | Ga0373942_0001224 | Ga0373942_0001224_5445_6146 | 209 |
| 76 | 3300035241 | Ga0373961_0001854 | Ga0373961_0001854_1369_2070 | 209 |
| 77 | 3300035691 | Ga0373931_0023662 | Ga0373931_0023662_1567_2268 | 209 |
| 78 | 3300045051 | Ga0451576_0023923 | Ga0451576_0023923_2084_2785 | 209 |
| 79 | 3300048907 | Ga0496104_0269230 | Ga0496104_0269230_593_1315 | 209 |
| 80 | 3300049577 | Ga0501041_0231947 | Ga0501041_0231947_57_758 | 209 |
| 81 | 3300049580 | Ga0501046_0406699 | Ga0501046_0406699_183_884 | 209 |
| 82 | 3300049588 | Ga0501072_0024494 | Ga0501072_0024494_1625_2326 | 209 |
| 83 | 3300049590 | Ga0501074_0121146 | Ga0501074_0121146_418_1119 | 209 |
| 84 | 3300049592 | Ga0501076_0107481 | Ga0501076_0107481_548_1249 | 209 |
| 85 | 3300049824 | Ga0501045_0066310 | Ga0501045_0066310_1043_1744 | 209 |
| 86 | 3300050507 | nmdc:mga05p37_41995_c1 | nmdc:mga05p37_41995_c1_4014_4682 | 209 |
| 87 | 3300050508 | nmdc:mga09592_637099_c1 | nmdc:mga09592_637099_c1_166_834 | 209 |
| 88 | 3300050510 | nmdc:mga06r32_394899_c1 | nmdc:mga06r32_394899_c1_413_1114 | 209 |
| 89 | 3300060353 | Ga0501082_0318482 | Ga0501082_0318482_133_825 | 209 |
| 90 | 3300005330 | Ga0070690_100001651 | Ga0070690_1000016517 | 210 |
| 91 | 3300005335 | Ga0070666_10013190 | Ga0070666_100131903 | 210 |
| 92 | 3300005440 | Ga0070705_100008213 | Ga0070705_1000082133 | 210 |
| 93 | 3300005441 | Ga0070700_100417751 | Ga0070700_1004177512 | 210 |
| 94 | 3300005444 | Ga0070694_100004048 | Ga0070694_1000040487 | 210 |
| 95 | 3300005458 | Ga0070681_10132142 | Ga0070681_101321422 | 210 |
| 96 | 3300005467 | Ga0070706_100288122 | Ga0070706_1002881221 | 210 |
| 97 | 3300005518 | Ga0070699_100482512 | Ga0070699_1004825122 | 210 |
| 98 | 3300005530 | Ga0070679_100221348 | Ga0070679_1002213482 | 210 |
| 99 | 3300005545 | Ga0070695_100097423 | Ga0070695_1000974232 | 210 |
| 100 | 3300005549 | Ga0070704_100006638 | Ga0070704_1000066383 | 210 |
| 101 | 3300005563 | Ga0068855_100245638 | Ga0068855_1002456382 | 210 |
| 102 | 3300006163 | Ga0070715_10021460 | Ga0070715_100214602 | 210 |
| 103 | 3300006237 | Ga0097621_100055431 | Ga0097621_1000554313 | 210 |
| 104 | 3300006358 | Ga0068871_100013584 | Ga0068871_1000135842 | 210 |
| 105 | 3300013306 | Ga0163162_10252091 | Ga0163162_102520912 | 210 |
| 106 | 3300025910 | Ga0207684_10180507 | Ga0207684_101805072 | 210 |
| 107 | 3300025912 | Ga0207707_10454205 | Ga0207707_104542052 | 210 |
| 108 | 3300025926 | Ga0207659_10001001 | Ga0207659_1000100113 | 210 |
| 109 | 3300025981 | Ga0207640_10098628 | Ga0207640_100986282 | 210 |
| 110 | 3300028381 | Ga0268264_10421477 | Ga0268264_104214772 | 210 |
| 111 | 3300031995 | Ga0307409_100436915 | Ga0307409_1004369152 | 210 |
| 112 | 3300036401 | Ga0373937_0063850 | Ga0373937_0063850_987_1658 | 210 |
| 113 | 3300046681 | Ga0495647_0225980 | Ga0495647_0225980_30_701 | 210 |
| 114 | 3300046683 | Ga0495658_0029252 | Ga0495658_0029252_691_1362 | 210 |
| 115 | 3300046684 | Ga0495669_0078683 | Ga0495669_0078683_433_1086 | 210 |
| 116 | 3300048903 | Ga0496100_0111358 | Ga0496100_0111358_591_1262 | 210 |
| 117 | 3300048904 | Ga0496101_0000253 | Ga0496101_0000253_24897_25568 | 210 |
| 118 | 3300048906 | Ga0496103_0340846 | Ga0496103_0340846_120_791 | 210 |
| 119 | 3300048907 | Ga0496104_0003824 | Ga0496104_0003824_1653_2324 | 210 |
| 120 | 3300048908 | Ga0496105_0025515 | Ga0496105_0025515_3712_4383 | 210 |
| 121 | 3300048910 | Ga0496107_0054096 | Ga0496107_0054096_2149_2820 | 210 |
| 122 | 3300048917 | Ga0496114_0001314 | Ga0496114_0001314_3751_4422 | 210 |
| 123 | 3300048918 | Ga0496115_0116966 | Ga0496115_0116966_211_882 | 210 |
| 124 | 3300049592 | Ga0501076_0433361 | Ga0501076_0433361_216_881 | 210 |
| 125 | 3300053085 | Ga0495619_0507689 | Ga0495619_0507689_18_689 | 210 |
| 126 | 3300005434 | Ga0070709_10644013 | Ga0070709_106440131 | 211 |
| 127 | 3300005435 | Ga0070714_100032037 | Ga0070714_1000320373 | 211 |
| 128 | 3300005456 | Ga0070678_100565859 | Ga0070678_1005658592 | 211 |
| 129 | 3300006028 | Ga0070717_10280442 | Ga0070717_102804422 | 211 |
| 130 | 3300009093 | Ga0105240_10987887 | Ga0105240_109878872 | 211 |
| 131 | 3300009094 | Ga0111539_10538034 | Ga0111539_105380342 | 211 |
| 132 | 3300009098 | Ga0105245_10045050 | Ga0105245_100450503 | 211 |
| 133 | 3300009177 | Ga0105248_10350501 | Ga0105248_103505012 | 211 |
| 134 | 3300017792 | Ga0163161_10107007 | Ga0163161_101070072 | 211 |
| 135 | 3300025906 | Ga0207699_10441948 | Ga0207699_104419482 | 211 |
| 136 | 3300025913 | Ga0207695_10222486 | Ga0207695_102224862 | 211 |
| 137 | 3300025927 | Ga0207687_10022228 | Ga0207687_100222282 | 211 |
| 138 | 3300025929 | Ga0207664_10024176 | Ga0207664_100241764 | 211 |
| 139 | 3300026089 | Ga0207648_10205526 | Ga0207648_102055262 | 211 |
| 140 | 3300049573 | Ga0501037_0506067 | Ga0501037_0506067_67_729 | 211 |
| 141 | 3300049575 | Ga0501039_0297347 | Ga0501039_0297347_319_981 | 211 |
| 142 | 3300049578 | Ga0501042_0200954 | Ga0501042_0200954_317_979 | 211 |
| 143 | 3300049588 | Ga0501072_0046824 | Ga0501072_0046824_1477_2139 | 211 |
| 144 | 3300049591 | Ga0501075_0149179 | Ga0501075_0149179_480_1142 | 211 |
| 145 | 3300049592 | Ga0501076_0080772 | Ga0501076_0080772_1026_1688 | 211 |
| 146 | 3300049741 | Ga0501079_0110269 | Ga0501079_0110269_1118_1780 | 211 |
| 147 | 3300049742 | Ga0501080_0228052 | Ga0501080_0228052_1021_1683 | 211 |
| 148 | 3300049743 | Ga0501081_0025027 | Ga0501081_0025027_3310_3972 | 211 |
| 149 | 3300054114 | Ga0501084_0144008 | Ga0501084_0144008_702_1364 | 211 |
| 150 | 3300060353 | Ga0501082_0180041 | Ga0501082_0180041_783_1445 | 211 |
| 151 | 3300005331 | Ga0070670_100048627 | Ga0070670_1000486272 | 212 |
| 152 | 3300005536 | Ga0070697_100678907 | Ga0070697_1006789071 | 212 |
| 153 | 3300005577 | Ga0068857_100140946 | Ga0068857_1001409462 | 212 |
| 154 | 3300005617 | Ga0068859_100007908 | Ga0068859_1000079085 | 212 |
| 155 | 3300005841 | Ga0068863_100540383 | Ga0068863_1005403832 | 212 |
| 156 | 3300006931 | Ga0097620_100007908 | Ga0097620_1000079085 | 212 |
| 157 | 3300009147 | Ga0114129_10033295 | Ga0114129_100332952 | 212 |
| 158 | 3300025925 | Ga0207650_10101589 | Ga0207650_101015892 | 212 |
| 159 | 3300026116 | Ga0207674_10027441 | Ga0207674_100274414 | 212 |
| 160 | 3300050507 | nmdc:mga05p37_138730_c1 | nmdc:mga05p37_138730_c1_1968_2675 | 212 |
| 161 | 3300060353 | Ga0501082_0073036 | Ga0501082_0073036_955_1626 | 212 |
| 162 | 3300005345 | Ga0070692_10478244 | Ga0070692_104782441 | 213 |
| 163 | 3300005471 | Ga0070698_100298739 | Ga0070698_1002987392 | 213 |
| 164 | 3300005539 | Ga0068853_100284773 | Ga0068853_1002847732 | 213 |
| 165 | 3300006051 | Ga0075364_10149586 | Ga0075364_101495862 | 213 |
| 166 | 3300006844 | Ga0075428_100018272 | Ga0075428_1000182729 | 213 |
| 167 | 3300006847 | Ga0075431_100066369 | Ga0075431_1000663693 | 213 |
| 168 | 3300006880 | Ga0075429_100009755 | Ga0075429_1000097554 | 213 |
| 169 | 3300009147 | Ga0114129_10022673 | Ga0114129_100226736 | 213 |
| 170 | 3300009177 | Ga0105248_10065238 | Ga0105248_100652382 | 213 |
| 171 | 3300014968 | Ga0157379_10148298 | Ga0157379_101482981 | 213 |
| 172 | 3300025937 | Ga0207669_10022707 | Ga0207669_100227073 | 213 |
| 173 | 3300026041 | Ga0207639_10540799 | Ga0207639_105407992 | 213 |
| 174 | 3300026075 | Ga0207708_10103601 | Ga0207708_101036011 | 213 |
| 175 | 3300050491 | nmdc:mga00v17_136006_c1 | nmdc:mga00v17_136006_c1_158_847 | 213 |
| 176 | 3300050507 | nmdc:mga05p37_22272_c1 | nmdc:mga05p37_22272_c1_5022_5699 | 213 |
| 177 | 3300050508 | nmdc:mga09592_1403_c1 | nmdc:mga09592_1403_c1_3909_4586 | 213 |
| 178 | 3300050512 | nmdc:mga0n895_530116_c1 | nmdc:mga0n895_530116_c1_317_1009 | 213 |
| 179 | 3300005328 | Ga0070676_10343919 | Ga0070676_103439192 | 214 |
| 180 | 3300005334 | Ga0068869_100102733 | Ga0068869_1001027333 | 214 |
| 181 | 3300005364 | Ga0070673_100001066 | Ga0070673_1000010662 | 214 |
| 182 | 3300005530 | Ga0070679_100227038 | Ga0070679_1002270382 | 214 |
| 183 | 3300005544 | Ga0070686_100581633 | Ga0070686_1005816332 | 214 |
| 184 | 3300006358 | Ga0068871_100002203 | Ga0068871_10000220311 | 214 |
| 185 | 3300006914 | Ga0075436_100158305 | Ga0075436_1001583052 | 214 |
| 186 | 3300009177 | Ga0105248_10030971 | Ga0105248_100309713 | 214 |
| 187 | 3300025932 | Ga0207690_10258211 | Ga0207690_102582113 | 214 |
| 188 | 3300025981 | Ga0207640_10025740 | Ga0207640_100257402 | 214 |
| 189 | 3300035115 | Ga0373941_0034713 | Ga0373941_0034713_638_1342 | 214 |
| 190 | 3300042134 | Ga0450898_012688 | Ga0450898_012688_530_1222 | 214 |
| 191 | 3300048903 | Ga0496100_0348326 | Ga0496100_0348326_219_908 | 214 |
| 192 | 3300048907 | Ga0496104_0396228 | Ga0496104_0396228_496_1185 | 214 |
| 193 | 3300050512 | nmdc:mga0n895_667566_c1 | nmdc:mga0n895_667566_c1_20_793 | 214 |
| 194 | 3300050514 | nmdc:mga08x19_7260_c1 | nmdc:mga08x19_7260_c1_1042_1743 | 214 |
| 195 | 3300050515 | nmdc:mga0a205_621315_c1 | nmdc:mga0a205_621315_c1_91_864 | 214 |
| 196 | 3300005467 | Ga0070706_100177602 | Ga0070706_1001776022 | 215 |
| 197 | 3300005471 | Ga0070698_100062058 | Ga0070698_1000620582 | 215 |
| 198 | 3300005536 | Ga0070697_100667524 | Ga0070697_1006675241 | 215 |
| 199 | 3300005445 | Ga0070708_100061495 | Ga0070708_1000614953 | 216 |
| 200 | 3300005471 | Ga0070698_100058121 | Ga0070698_1000581213 | 216 |
| 201 | 3300006844 | Ga0075428_100189891 | Ga0075428_1001898912 | 216 |
| 202 | 3300006914 | Ga0075436_100011536 | Ga0075436_1000115362 | 216 |
| 203 | 3300050514 | nmdc:mga08x19_22921_c1 | nmdc:mga08x19_22921_c1_2963_3664 | 216 |
| 204 | 3300005367 | Ga0070667_100360130 | Ga0070667_1003601302 | 217 |
| 205 | 3300006358 | Ga0068871_100217772 | Ga0068871_1002177722 | 217 |
| 206 | 3300006881 | Ga0068865_100440659 | Ga0068865_1004406592 | 217 |
| 207 | 3300009177 | Ga0105248_10049436 | Ga0105248_100494362 | 217 |
| 208 | 3300013308 | Ga0157375_10066817 | Ga0157375_100668172 | 217 |
| 209 | 3300014969 | Ga0157376_10059367 | Ga0157376_100593672 | 217 |
| 210 | 3300025938 | Ga0207704_10433250 | Ga0207704_104332502 | 217 |
| 211 | 3300025941 | Ga0207711_10127560 | Ga0207711_101275602 | 217 |
| 212 | 3300025986 | Ga0207658_10358272 | Ga0207658_103582722 | 217 |
| 213 | 3300045976 | Ga0466967_0107335 | Ga0466967_0107335_968_1648 | 217 |
| 214 | 3300046535 | Ga0495586_0223134 | Ga0495586_0223134_70_738 | 217 |
| 215 | 3300046559 | Ga0495667_0083053 | Ga0495667_0083053_499_1167 | 217 |
| 216 | 3300046683 | Ga0495658_0274284 | Ga0495658_0274284_235_903 | 217 |
| 217 | 3300046809 | Ga0495600_0271466 | Ga0495600_0271466_136_804 | 217 |
| 218 | 3300053077 | Ga0495601_0068080 | Ga0495601_0068080_472_1140 | 217 |
| 219 | 3300053085 | Ga0495619_0207486 | Ga0495619_0207486_408_1076 | 217 |
| 220 | 3300005535 | Ga0070684_100066848 | Ga0070684_1000668482 | 218 |
| 221 | 3300005614 | Ga0068856_100039481 | Ga0068856_1000394812 | 218 |
| 222 | 3300013297 | Ga0157378_10011823 | Ga0157378_100118236 | 218 |
| 223 | 3300013308 | Ga0157375_11378500 | Ga0157375_113785001 | 218 |
| 224 | 3300025939 | Ga0207665_10071205 | Ga0207665_100712052 | 218 |
| 225 | 3300026078 | Ga0207702_10014647 | Ga0207702_100146472 | 218 |
| 226 | 3300048912 | Ga0496109_0057907 | Ga0496109_0057907_1261_1917 | 218 |
| 227 | 3300048916 | Ga0496113_0284035 | Ga0496113_0284035_78_734 | 218 |
| 228 | 3300006852 | Ga0075433_10087239 | Ga0075433_100872392 | 219 |
| 229 | 3300048909 | Ga0496106_0068560 | Ga0496106_0068560_1756_2415 | 219 |
| 230 | 3300049590 | Ga0501074_0359531 | Ga0501074_0359531_37_750 | 219 |
| 231 | 3300005339 | Ga0070660_100004376 | Ga0070660_1000043767 | 220 |
| 232 | 3300005458 | Ga0070681_10096748 | Ga0070681_100967482 | 220 |
| 233 | 3300005530 | Ga0070679_100102546 | Ga0070679_1001025462 | 220 |
| 234 | 3300005563 | Ga0068855_100006073 | Ga0068855_1000060737 | 220 |
| 235 | 3300006358 | Ga0068871_100045574 | Ga0068871_1000455742 | 220 |
| 236 | 3300009177 | Ga0105248_10019632 | Ga0105248_100196325 | 220 |
| 237 | 3300014969 | Ga0157376_10200492 | Ga0157376_102004922 | 220 |
| 238 | 3300025912 | Ga0207707_10348222 | Ga0207707_103482222 | 220 |
| 239 | 3300025919 | Ga0207657_10004760 | Ga0207657_100047602 | 220 |
| 240 | 3300025921 | Ga0207652_10043570 | Ga0207652_100435703 | 220 |
| 241 | 3300025949 | Ga0207667_10035458 | Ga0207667_100354583 | 220 |
| 242 | 3300031711 | Ga0265314_10015825 | Ga0265314_100158252 | 220 |
| 243 | 3300005334 | Ga0068869_100279919 | Ga0068869_1002799192 | 221 |
| 244 | 3300005336 | Ga0070680_100018295 | Ga0070680_1000182954 | 221 |
| 245 | 3300005337 | Ga0070682_100220177 | Ga0070682_1002201772 | 221 |
| 246 | 3300005339 | Ga0070660_100007927 | Ga0070660_1000079275 | 221 |
| 247 | 3300005366 | Ga0070659_100061978 | Ga0070659_1000619782 | 221 |
| 248 | 3300005458 | Ga0070681_10010364 | Ga0070681_100103645 | 221 |
| 249 | 3300005719 | Ga0068861_100058412 | Ga0068861_1000584122 | 221 |
| 250 | 3300005844 | Ga0068862_100137164 | Ga0068862_1001371642 | 221 |
| 251 | 3300025917 | Ga0207660_10010076 | Ga0207660_100100765 | 221 |
| 252 | 3300025919 | Ga0207657_10056338 | Ga0207657_100563383 | 221 |
| 253 | 3300026118 | Ga0207675_100045511 | Ga0207675_1000455113 | 221 |
| 254 | 3300028380 | Ga0268265_10298712 | Ga0268265_102987122 | 221 |
| 255 | 3300035691 | Ga0373931_0341456 | Ga0373931_0341456_203_868 | 221 |
| 256 | 3300036401 | Ga0373937_0325100 | Ga0373937_0325100_748_1413 | 221 |
| 257 | 3300048905 | Ga0496102_0228893 | Ga0496102_0228893_527_1192 | 221 |
| 258 | 3300048908 | Ga0496105_0078656 | Ga0496105_0078656_1220_1885 | 221 |
| 259 | 3300048915 | Ga0496112_0033274 | Ga0496112_0033274_2899_3564 | 221 |
| 260 | 3300048916 | Ga0496113_0319803 | Ga0496113_0319803_350_1015 | 221 |
| 261 | 3300005844 | Ga0068862_100313095 | Ga0068862_1003130952 | 222 |
| 262 | 3300006028 | Ga0070717_10103006 | Ga0070717_101030063 | 222 |
| 263 | 3300006844 | Ga0075428_100257426 | Ga0075428_1002574262 | 222 |
| 264 | 3300014326 | Ga0157380_10037164 | Ga0157380_100371642 | 222 |
| 265 | 3300025928 | Ga0207700_10005587 | Ga0207700_100055876 | 222 |
| 266 | 3300035086 | Ga0373934_0072066 | Ga0373934_0072066_335_1003 | 222 |
| 267 | 3300035117 | Ga0373953_0058480 | Ga0373953_0058480_755_1423 | 222 |
| 268 | 3300035119 | Ga0373956_0160785 | Ga0373956_0160785_206_874 | 222 |
| 269 | 3300035695 | Ga0373927_0111975 | Ga0373927_0111975_901_1569 | 222 |
| 270 | 3300035725 | Ga0373947_0116046 | Ga0373947_0116046_772_1440 | 222 |
| 271 | 3300036401 | Ga0373937_0502358 | Ga0373937_0502358_30_698 | 222 |
| 272 | 3300046514 | Ga0495618_0111860 | Ga0495618_0111860_933_1601 | 222 |
| 273 | 3300046516 | Ga0495628_0256327 | Ga0495628_0256327_14_682 | 222 |
| 274 | 3300046678 | Ga0495599_0134565 | Ga0495599_0134565_784_1452 | 222 |
| 275 | 3300047317 | Ga0495604_0177928 | Ga0495604_0177928_315_983 | 222 |
| 276 | 3300047444 | Ga0495675_0364154 | Ga0495675_0364154_111_779 | 222 |
| 277 | 3300050512 | nmdc:mga0n895_114397_c1 | nmdc:mga0n895_114397_c1_613_1281 | 222 |
| 278 | 3300053084 | Ga0495595_0006276 | Ga0495595_0006276_2574_3242 | 222 |
| 279 | 3300005293 | Ga0065715_10035105 | Ga0065715_100351052 | 223 |
| 280 | 3300005340 | Ga0070689_100424642 | Ga0070689_1004246422 | 223 |
| 281 | 3300005544 | Ga0070686_100042581 | Ga0070686_1000425812 | 223 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5fc9-assembly1.cif.gz_D | novel purple cupredoxin from nitrosopumilus maritimus | 0.908 | 87 | 167 |
| 2jxm-assembly1.cif.gz_A | ensemble of twenty structures of the prochlorothrix hollandica plastocyanin- cytochrome f complex | 0.8719 | 85 | 167 |
| 5ysg-assembly3.cif.gz_C | x-ray crystal structure of pseudoazurin met16gly variant, reduced form. | 0.8626 | 85 | 167 |
| 6akn-assembly2.cif.gz_B | x-ray crystal structure of pseudoazurin met16leu variant | 0.8606 | 85 | 167 |
| 1m9w-assembly1.cif.gz_A | study of electrostatic potential surface distribution using high resolution side-chain conformation determined by nmr | 0.8589 | 85 | 167 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5fc9B00 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.9096 | 87 | 167 | 2.60.40.420 |
| af_Q54VX3_19_99_2.60.40.420 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.8716 | 85 | 167 | 2.60.40.420 |
| 1jxdA00 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.8569 | 85 | 167 | 2.60.40.420 |
| 5ysgA00 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.8551 | 85 | 167 | 2.60.40.420 |
| 1b3iA00 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.8387 | 85 | 167 | 2.60.40.420 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519C345-F1-model_v4 | Blue (type 1) copper domain-containing protein | 0.9748 | 85 | 167 |
GO:0005507
GO:0009055 GO:0042597 |
| AF-A0A1F6DTK2-F1-model_v4 | Blue (type 1) copper domain-containing protein | 0.9703 | 89 | 168 |
GO:0005507
GO:0009055 |
| AF-I3WZF7-F1-model_v4 | EfeO-type cupredoxin-like domain-containing protein | 0.9673 | 98 | 167 |
|
| AF-A0A1I4BYP3-F1-model_v4 | Copper binding protein, plastocyanin/azurin family | 0.9631 | 89 | 167 |
GO:0005507
GO:0009055 GO:0042597 |
| AF-A0A1G0ATZ2-F1-model_v4 | deleted | 0.9565 | 80 | 167 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar