F383992

General Info

Members Datasets Scaffolds Average Seq Length
280 190 560 236

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2877676314|2877678594
Length 282
Sequence AAVCPCPPLLVPEVAAGAAPELDTARAACADALGVLAAARPDLLVVVGPAEQSGRGVHAEGSRGSFRGFGVDVDVRLGAGGAGGVGVGPGAAGGEGVGVGPGADGGVGVGVRPGADGAVGVDAGAGADHGDDEAPRPLPTSLAVAAWLLERTGWSDAPIEGLGVGEPLEPERCIQTGRGIAGRAERVALLVMGDASACRTLKAPGYLDERAAPFDAEVARALGAADVAALRALDAELAYELKASGRAPWQILAGAAEGAGLGGSLLYEDAPYGVGYVVAAWS

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
3 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
4 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
6 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
7 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
8 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
9 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
10 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
11 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
12 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
13 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
14 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
15 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
16 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
17 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
18 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
19 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
20 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
21 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
22 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
23 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
24 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
25 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
26 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
27 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
28 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
29 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
30 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
31 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
32 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
33 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
34 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
35 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
36 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
37 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
38 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
39 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
40 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
41 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
42 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
43 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
44 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
45 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
46 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
47 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
48 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
49 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
50 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
51 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
52 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
53 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
54 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
55 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
56 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
57 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
58 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
59 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
60 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
61 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
62 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
63 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
64 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
65 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
66 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
67 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
68 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
69 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
70 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
71 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
72 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
73 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
74 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
75 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
76 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
77 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
78 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
79 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
80 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
81 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
82 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
83 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
84 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
85 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
86 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
87 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
88 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
89 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
90 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
91 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
92 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
93 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
94 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
95 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
96 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
97 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
98 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
99 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
100 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
116 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
117 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
118 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
119 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
120 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
121 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
122 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
123 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
124 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
125 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
126 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
127 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
128 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
129 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
130 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
131 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
132 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
133 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
134 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
135 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
136 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
137 2643221578 Streptomyces sp. Root63 Isolate Unclassified
138 2643221647 Streptomyces sp. Root369 Isolate Unclassified
139 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
140 2643221714 Streptomyces sp. Root264 Isolate Unclassified
141 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
142 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
143 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
144 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
145 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
146 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
147 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
148 2808606448 Streptomyces sp. 193411 Isolate Unclassified
149 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
150 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
151 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
152 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
153 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
154 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
155 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
156 2867428634 Streptomyces sp. RP5T Isolate Unclassified
157 2867475112 Streptomyces sp. TM32 Isolate Unclassified
158 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
159 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
160 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
161 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
162 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
163 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
164 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
165 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
166 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
167 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
168 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
169 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
170 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
171 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
172 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
173 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
174 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
175 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
176 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
177 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
178 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
179 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
180 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
181 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
182 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
183 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
184 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
185 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
186 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
187 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
188 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
189 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
190 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.29
Metatranscriptomes 0
Isolates 20.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.21
Nodule 1.07
Rhizoplane 0.71
Rhizosphere 74.29
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10141520 3300005434 Bacteria 1653
2 Ga0070685_10090173 3300005466 Bacteria 1854
3 Ga0068853_100129845 3300005539 Bacteria 2255
4 Ga0081455_10034404 3300005937 Bacteria 4539
5 Ga0075368_10009807 3300006042 Bacteria 3453
6 Ga0075367_10015662 3300006178 Bacteria 4126
7 Ga0075370_10125530 3300006353 Bacteria 1496
8 Ga0099826_10045494 3300006948 Bacteria 3000
9 Ga0105251_10019089 3300009011 Bacteria 3629
10 Ga0182008_10005537 3300014497 Bacteria 7178
11 Ga0182007_10000101 3300015262 Bacteria 60723
12 Ga0183367_1019 3300015688 Bacteria 100516
13 Ga0207426_1012308 3300025302 Bacteria 3219
14 Ga0207663_10097850 3300025916 Bacteria 1963
15 Ga0207639_10098121 3300026041 Bacteria 2361
16 Ga0209813_10026684 3300027866 Bacteria 1672
17 Ga0307517_10005035 3300028786 Bacteria 20096
18 Ga0307515_10001401 3300028794 Bacteria 54557
19 Ga0307515_10120715 3300028794 Bacteria 2971
20 Ga0307511_10080074 3300030521 Bacteria 2304
21 Ga0307511_10248376 3300030521 Bacteria 858
22 Ga0307512_10002707 3300030522 Bacteria 21759
23 Ga0307513_10001846 3300031456 Bacteria 30093
24 Ga0307513_10027733 3300031456 Bacteria 6493
25 Ga0307509_10073400 3300031507 Bacteria 3562
26 Ga0307509_10231128 3300031507 Bacteria 1652
27 Ga0307508_10007652 3300031616 Bacteria 10044
28 Ga0307508_10018585 3300031616 Bacteria 6316
29 Ga0307508_10082941 3300031616 Bacteria 2787
30 Ga0307514_10036223 3300031649 Bacteria 3922
31 Ga0307516_10008243 3300031730 Bacteria 11828
32 Ga0307516_10012835 3300031730 Bacteria 8994
33 Ga0307518_10241675 3300031838 Bacteria 1157
34 Ga0307507_10006939 3300033179 Bacteria 16857
35 Ga0307507_10045625 3300033179 Bacteria 4308
36 Ga0307510_10058975 3300033180 Bacteria 3968
37 Ga0307510_10105449 3300033180 Bacteria 2587
38 Ga0307510_10225585 3300033180 Bacteria 1381
39 Ga0395898_0010040 3300037466 Bacteria 9912
40 Ga0395898_0270688 3300037466 Bacteria 1620
41 Ga0439436_0060206 3300041404 Bacteria 1063
42 Ga0439442_002359 3300042002 Bacteria 3704
43 Ga0450903_005158 3300042138 Bacteria 2194
44 Ga0439458_0001532 3300042157 Bacteria 5777
45 Ga0466969_0085908 3300044656 Bacteria 1495
46 Ga0466965_0010830 3300044683 Bacteria 4265
47 Ga0466961_0002028 3300044693 Bacteria 12605
48 Ga0466963_0000796 3300044694 Bacteria 15712
49 Ga0466963_0002503 3300044694 Bacteria 10283
50 Ga0466963_0183719 3300044694 Bacteria 1460
51 Ga0466964_0026933 3300044706 Bacteria 2253
52 Ga0466971_0008108 3300044719 Bacteria 4580
53 Ga0466971_0011895 3300044719 Bacteria 3812
54 Ga0466957_0052094 3300044842 Bacteria 2491
55 Ga0466960_0098058 3300044901 Bacteria 1505
56 Ga0466959_0001727 3300045049 Bacteria 13586
57 Ga0466959_0019931 3300045049 Bacteria 4937
58 Ga0466958_0000924 3300045836 Bacteria 13221
59 Ga0466967_0005228 3300045976 Bacteria 8943
60 Ga0466967_0064944 3300045976 Bacteria 3247
61 Ga0466967_0215426 3300045976 Bacteria 1823
62 Ga0495627_077085 3300046453 Bacteria 969
63 Ga0495592_0009631 3300046454 Bacteria 7269
64 Ga0495592_0030690 3300046454 Bacteria 4065
65 Ga0495603_0003469 3300046455 Bacteria 9377
66 Ga0495603_0015003 3300046455 Bacteria 4684
67 Ga0495603_0035616 3300046455 Bacteria 2989
68 Ga0495629_0004193 3300046459 Bacteria 10822
69 Ga0495629_0018782 3300046459 Bacteria 4941
70 Ga0495629_0036127 3300046459 Bacteria 3490
71 Ga0495629_0040372 3300046459 Bacteria 3282
72 Ga0495629_0042374 3300046459 Bacteria 3199
73 Ga0495629_0052388 3300046459 Bacteria 2855
74 Ga0495629_0055297 3300046459 Bacteria 2775
75 Ga0495629_0422055 3300046459 Bacteria 905
76 Ga0495638_0120502 3300046460 Bacteria 1551
77 Ga0495651_0000913 3300046462 Bacteria 22915
78 Ga0495651_0006869 3300046462 Bacteria 8697
79 Ga0495651_0047427 3300046462 Bacteria 3321
80 Ga0495653_0054864 3300046463 Bacteria 3043
81 Ga0495580_0129876 3300046472 Bacteria 1748
82 Ga0495605_0110368 3300046474 Bacteria 1256
83 Ga0495639_0054159 3300046475 Bacteria 1828
84 Ga0495662_0000099 3300046476 Bacteria 31451
85 Ga0495662_0000511 3300046476 Bacteria 17665
86 Ga0495662_0102476 3300046476 Bacteria 1400
87 Ga0495664_0000275 3300046477 Bacteria 24568
88 Ga0495664_0009572 3300046477 Bacteria 5422
89 Ga0495664_0072432 3300046477 Bacteria 2059
90 Ga0495585_0039868 3300046492 Bacteria 2639
91 Ga0495594_0000242 3300046499 Bacteria 26512
92 Ga0495594_0015054 3300046499 Bacteria 4059
93 Ga0495583_0081761 3300046506 Bacteria 1402
94 Ga0495608_0000588 3300046511 Bacteria 24992
95 Ga0495618_0010740 3300046514 Bacteria 5545
96 Ga0495628_0032782 3300046516 Bacteria 4190
97 Ga0495628_0045483 3300046516 Bacteria 3490
98 Ga0495628_0324056 3300046516 Bacteria 1136
99 Ga0495628_0355175 3300046516 Bacteria 1077
100 Ga0495630_0019254 3300046517 Bacteria 5016
101 Ga0495666_0009541 3300046526 Bacteria 4849
102 Ga0495652_0016555 3300046529 Bacteria 6593
103 Ga0495652_0082439 3300046529 Bacteria 2650
104 Ga0495652_0201770 3300046529 Bacteria 1509
105 Ga0495665_0019169 3300046531 Bacteria 3677
106 Ga0495640_0002102 3300046533 Bacteria 15879
107 Ga0495640_0012806 3300046533 Bacteria 6400
108 Ga0495640_0048401 3300046533 Bacteria 2938
109 Ga0495587_0000507 3300046536 Bacteria 27190
110 Ga0495587_0048104 3300046536 Bacteria 2526
111 Ga0495645_0076689 3300046543 Bacteria 2404
112 Ga0495645_0243245 3300046543 Bacteria 1199
113 Ga0495622_0025478 3300046557 Bacteria 2762
114 Ga0495622_0041676 3300046557 Bacteria 2134
115 Ga0495622_0163246 3300046557 Bacteria 1004
116 Ga0495622_0226542 3300046557 Bacteria 827
117 Ga0495667_0018722 3300046559 Bacteria 4674
118 Ga0495634_0015444 3300046642 Bacteria 5487
119 Ga0495634_0097189 3300046642 Bacteria 1906
120 Ga0495611_0108429 3300046648 Bacteria 1292
121 Ga0495635_0094289 3300046663 Bacteria 2046
122 Ga0495588_0069934 3300046674 Bacteria 1824
123 Ga0495588_0242404 3300046674 Bacteria 951
124 Ga0495657_0000913 3300046675 Bacteria 26040
125 Ga0495657_0002072 3300046675 Bacteria 17022
126 Ga0495657_0013715 3300046675 Bacteria 5969
127 Ga0495657_0029517 3300046675 Bacteria 3845
128 Ga0495623_0037681 3300046679 Bacteria 3092
129 Ga0495646_0010526 3300046680 Bacteria 5875
130 Ga0495658_0054084 3300046683 Bacteria 2282
131 Ga0495613_0000530 3300046689 Bacteria 31918
132 Ga0495613_0002001 3300046689 Bacteria 15472
133 Ga0495613_0018423 3300046689 Bacteria 5206
134 Ga0495613_0051416 3300046689 Bacteria 3036
135 Ga0495613_0271311 3300046689 Bacteria 1180
136 Ga0495671_0017179 3300046692 Bacteria 3852
137 Ga0495649_0138909 3300046694 Bacteria 1280
138 Ga0495589_0007978 3300046794 Bacteria 5539
139 Ga0495589_0182282 3300046794 Bacteria 995
140 Ga0495589_0268756 3300046794 Bacteria 794
141 Ga0495600_0040342 3300046809 Bacteria 3039
142 Ga0495600_0129459 3300046809 Bacteria 1641
143 Ga0495581_0009381 3300047315 Bacteria 5663
144 Ga0495581_0010731 3300047315 Bacteria 5298
145 Ga0495581_0024075 3300047315 Bacteria 3528
146 Ga0495604_0000236 3300047317 Bacteria 49736
147 Ga0495604_0008552 3300047317 Bacteria 8082
148 Ga0495604_0026595 3300047317 Bacteria 4605
149 Ga0495636_0005768 3300047318 Bacteria 4853
150 Ga0495636_0107259 3300047318 Bacteria 1226
151 Ga0495674_0021435 3300047319 Bacteria 5978
152 Ga0495674_0028861 3300047319 Bacteria 5055
153 Ga0495676_0001984 3300047321 Bacteria 17984
154 Ga0495676_0014588 3300047321 Bacteria 7028
155 Ga0495676_0016106 3300047321 Bacteria 6641
156 Ga0495683_0084905 3300047323 Bacteria 1540
157 Ga0495687_001157 3300047443 Bacteria 25550
158 Ga0495675_0128749 3300047444 Bacteria 1574
159 Ga0495685_000142 3300047447 Bacteria 24471
160 Ga0495685_003690 3300047447 Bacteria 4895
161 Ga0495685_019642 3300047447 Bacteria 2322
162 Ga0495685_021387 3300047447 Bacteria 2225
163 Ga0495681_0003629 3300047470 Bacteria 10735
164 Ga0495681_0035090 3300047470 Bacteria 2493
165 Ga0495684_0044288 3300047471 Bacteria 3406
166 Ga0495593_0000509 3300047673 Bacteria 21985
167 Ga0495602_0007316 3300048088 Bacteria 11561
168 Ga0495602_0041077 3300048088 Bacteria 4229
169 Ga0495614_0005815 3300048089 Bacteria 5558
170 Ga0495614_0012214 3300048089 Bacteria 3771
171 Ga0496109_0140372 3300048912 Bacteria 2259
172 Ga0501031_0034711 3300049568 Bacteria 3292
173 Ga0501032_0016830 3300049569 Bacteria 5138
174 Ga0501033_0001549 3300049570 Bacteria 20306
175 Ga0501033_0010511 3300049570 Bacteria 7099
176 Ga0501034_0037539 3300049571 Bacteria 4905
177 Ga0501034_0075131 3300049571 Bacteria 3387
178 Ga0501036_0014046 3300049572 Bacteria 6655
179 Ga0501037_0030921 3300049573 Bacteria 3954
180 Ga0501038_0002484 3300049574 Bacteria 17149
181 Ga0501038_0099761 3300049574 Bacteria 2420
182 Ga0501038_0255554 3300049574 Bacteria 1386
183 Ga0501038_0477767 3300049574 Bacteria 955
184 Ga0501039_0005134 3300049575 Bacteria 9921
185 Ga0501039_0138239 3300049575 Bacteria 1913
186 Ga0501042_0009169 3300049578 Bacteria 6580
187 Ga0501043_0003029 3300049579 Bacteria 13971
188 Ga0501043_0374386 3300049579 Bacteria 1079
189 Ga0501047_0114166 3300049581 Bacteria 2583
190 Ga0501047_0313661 3300049581 Bacteria 1408
191 Ga0501047_0656016 3300049581 Bacteria 868
192 Ga0501047_0695481 3300049581 Bacteria 834
193 Ga0501048_0072251 3300049582 Bacteria 2435
194 Ga0501048_0137653 3300049582 Bacteria 1726
195 Ga0501070_0000559 3300049586 Bacteria 33924
196 Ga0501070_0253576 3300049586 Bacteria 1439
197 Ga0501035_0063568 3300049822 Bacteria 3282
198 Ga0501035_0093139 3300049822 Bacteria 2651
199 Ga0501035_0204789 3300049822 Bacteria 1690
200 Ga0501044_0005161 3300049823 Bacteria 14556
201 Ga0501044_0069499 3300049823 Bacteria 3584
202 Ga0501044_0077864 3300049823 Bacteria 3361
203 Ga0501044_0117044 3300049823 Bacteria 2669
204 nmdc:mga06z11_3298_c1 3300050494 Bacteria 6244
205 nmdc:mga04h51_4718_c1 3300050495 Bacteria 3415
206 Ga0495619_0010107 3300053085 Bacteria 5941
207 Ga0500566_0015328 3300053094 Bacteria 4498
208 Ga0500640_049401 3300053095 Bacteria 1842
209 Ga0500654_056780 3300053099 Bacteria 2046
210 Ga0500553_061019 3300053101 Bacteria 1770
211 Ga0500560_004608 3300053107 Bacteria 2953
212 Ga0500560_078558 3300053107 Bacteria 1094
213 Ga0500569_012922 3300053109 Bacteria 2030
214 Ga0500572_016716 3300053111 Bacteria 1874
215 Ga0500614_041123 3300053123 Bacteria 1176
216 Ga0500628_003626 3300053129 Bacteria 2551
217 Ga0500652_001023 3300053131 Bacteria 9124
218 Ga0500658_0122833 3300053134 Bacteria 1152
219 Ga0500559_0196939 3300053136 Bacteria 950
220 Ga0500561_0063901 3300053137 Bacteria 1037
221 Ga0500600_0026210 3300053149 Bacteria 3462
222 Ga0500616_0005788 3300053153 Bacteria 8296
223 2877678594 2877676314 Bacteria 9512378
224 2547407274 2547132111 Bacteria 8013147
225 2585310036 2582581313 Bacteria 10042643
226 2585318436 2582581314 Bacteria 11452267
227 2643899061 2643221578 Bacteria 9213798
228 2644267093 2643221647 Bacteria 10741251
229 2644442295 2643221678 Bacteria 9540101
230 2644626423 2643221714 Bacteria 9015452
231 2768646446 2767802112 Bacteria 6465194
232 2784590766 2784132148 Bacteria 8627943
233 2785371979 2784746768 Bacteria 10036182
234 2786673095 2786546132 Bacteria 10419719
235 2793977412 2791355406 Bacteria 11364898
236 2808844483 2808606359 Bacteria 9866990
237 2808914055 2808606375 Bacteria 9466072
238 2809234472 2808606448 Bacteria 8656184
239 2812355546 2811994879 Bacteria 9313447
240 2812478390 2811994917 Bacteria 7761064
241 2852641605 2852635781 Bacteria 8251373
242 2862182357 2862178590 Bacteria 8583590
243 2862284204 2862281513 Bacteria 9621493
244 2862390534 2862382967 Bacteria 10317375
245 2867350745 2867346516 Bacteria 7608576
246 2867433892 2867428634 Bacteria 9590268
247 2867478959 2867475112 Bacteria 6909112
248 2873153692 2873151551 Bacteria 8625867
249 2912717178 2912715099 Bacteria 9460473
250 2912763182 2912757875 Bacteria 7940295
251 2919474119 2919468124 Bacteria 9133025
252 2946070261 2946064051 Bacteria 8957905
253 2947226553 2947224130 Bacteria 9938529
254 2954383564 2954380949 Bacteria 10050426
255 2954679409 2954673503 Bacteria 9685905
256 2954684746 2954682443 Bacteria 9862841
257 2954694357 2954691527 Bacteria 10720516
258 2954709560 2954701450 Bacteria 10834262
259 2954713866 2954711539 Bacteria 10867210
260 2954723834 2954721474 Bacteria 10456478
261 2954738001 2954731030 Bacteria 10243860
262 2954742734 2954740390 Bacteria 10229294
263 2954756861 2954749733 Bacteria 10366972
264 2954761696 2954759201 Bacteria 9358192
265 2990067394 2990059506 Bacteria 9321252
266 2997454964 2997451912 Bacteria 8492419
267 2997602599 2997600082 Bacteria 9896405
268 3006394584 3006393351 Bacteria 6615579
269 3006426166 3006425503 Bacteria 6491253
270 3006494122 3006493962 Bacteria 8825450
271 8008563206 8008558824 Bacteria 10610750
272 8008576755 8008574985 Bacteria 7815457
273 8023627630 8023623736 Bacteria 8593882
274 8047895683 8047893842 Bacteria 11723082
275 8048130020 8048127548 Bacteria 11053136
276 8048363256 8048356638 Bacteria 11044339
277 8048372707 8048369669 Bacteria 11666822
278 8048381641 8048379754 Bacteria 11877923
279 8056669810 8056667051 Bacteria 6953971
280 8056830093 8056829672 Bacteria 9045328
281 Ga0070709_10141520
282 Ga0070685_10090173
283 Ga0068853_100129845
284 Ga0081455_10034404
285 Ga0075368_10009807
286 Ga0075367_10015662
287 Ga0075370_10125530
288 Ga0099826_10045494
289 Ga0105251_10019089
290 Ga0182008_10005537
291 Ga0182007_10000101
292 Ga0183367_1019
293 Ga0207426_1012308
294 Ga0207663_10097850
295 Ga0207639_10098121
296 Ga0209813_10026684
297 Ga0307517_10005035
298 Ga0307515_10001401
299 Ga0307515_10120715
300 Ga0307511_10080074
301 Ga0307511_10248376
302 Ga0307512_10002707
303 Ga0307513_10001846
304 Ga0307513_10027733
305 Ga0307509_10073400
306 Ga0307509_10231128
307 Ga0307508_10007652
308 Ga0307508_10018585
309 Ga0307508_10082941
310 Ga0307514_10036223
311 Ga0307516_10008243
312 Ga0307516_10012835
313 Ga0307518_10241675
314 Ga0307507_10006939
315 Ga0307507_10045625
316 Ga0307510_10058975
317 Ga0307510_10105449
318 Ga0307510_10225585
319 Ga0395898_0010040
320 Ga0395898_0270688
321 Ga0439436_0060206
322 Ga0439442_002359
323 Ga0450903_005158
324 Ga0439458_0001532
325 Ga0466969_0085908
326 Ga0466965_0010830
327 Ga0466961_0002028
328 Ga0466963_0000796
329 Ga0466963_0002503
330 Ga0466963_0183719
331 Ga0466964_0026933
332 Ga0466971_0008108
333 Ga0466971_0011895
334 Ga0466957_0052094
335 Ga0466960_0098058
336 Ga0466959_0001727
337 Ga0466959_0019931
338 Ga0466958_0000924
339 Ga0466967_0005228
340 Ga0466967_0064944
341 Ga0466967_0215426
342 Ga0495627_077085
343 Ga0495592_0009631
344 Ga0495592_0030690
345 Ga0495603_0003469
346 Ga0495603_0015003
347 Ga0495603_0035616
348 Ga0495629_0004193
349 Ga0495629_0018782
350 Ga0495629_0036127
351 Ga0495629_0040372
352 Ga0495629_0042374
353 Ga0495629_0052388
354 Ga0495629_0055297
355 Ga0495629_0422055
356 Ga0495638_0120502
357 Ga0495651_0000913
358 Ga0495651_0006869
359 Ga0495651_0047427
360 Ga0495653_0054864
361 Ga0495580_0129876
362 Ga0495605_0110368
363 Ga0495639_0054159
364 Ga0495662_0000099
365 Ga0495662_0000511
366 Ga0495662_0102476
367 Ga0495664_0000275
368 Ga0495664_0009572
369 Ga0495664_0072432
370 Ga0495585_0039868
371 Ga0495594_0000242
372 Ga0495594_0015054
373 Ga0495583_0081761
374 Ga0495608_0000588
375 Ga0495618_0010740
376 Ga0495628_0032782
377 Ga0495628_0045483
378 Ga0495628_0324056
379 Ga0495628_0355175
380 Ga0495630_0019254
381 Ga0495666_0009541
382 Ga0495652_0016555
383 Ga0495652_0082439
384 Ga0495652_0201770
385 Ga0495665_0019169
386 Ga0495640_0002102
387 Ga0495640_0012806
388 Ga0495640_0048401
389 Ga0495587_0000507
390 Ga0495587_0048104
391 Ga0495645_0076689
392 Ga0495645_0243245
393 Ga0495622_0025478
394 Ga0495622_0041676
395 Ga0495622_0163246
396 Ga0495622_0226542
397 Ga0495667_0018722
398 Ga0495634_0015444
399 Ga0495634_0097189
400 Ga0495611_0108429
401 Ga0495635_0094289
402 Ga0495588_0069934
403 Ga0495588_0242404
404 Ga0495657_0000913
405 Ga0495657_0002072
406 Ga0495657_0013715
407 Ga0495657_0029517
408 Ga0495623_0037681
409 Ga0495646_0010526
410 Ga0495658_0054084
411 Ga0495613_0000530
412 Ga0495613_0002001
413 Ga0495613_0018423
414 Ga0495613_0051416
415 Ga0495613_0271311
416 Ga0495671_0017179
417 Ga0495649_0138909
418 Ga0495589_0007978
419 Ga0495589_0182282
420 Ga0495589_0268756
421 Ga0495600_0040342
422 Ga0495600_0129459
423 Ga0495581_0009381
424 Ga0495581_0010731
425 Ga0495581_0024075
426 Ga0495604_0000236
427 Ga0495604_0008552
428 Ga0495604_0026595
429 Ga0495636_0005768
430 Ga0495636_0107259
431 Ga0495674_0021435
432 Ga0495674_0028861
433 Ga0495676_0001984
434 Ga0495676_0014588
435 Ga0495676_0016106
436 Ga0495683_0084905
437 Ga0495687_001157
438 Ga0495675_0128749
439 Ga0495685_000142
440 Ga0495685_003690
441 Ga0495685_019642
442 Ga0495685_021387
443 Ga0495681_0003629
444 Ga0495681_0035090
445 Ga0495684_0044288
446 Ga0495593_0000509
447 Ga0495602_0007316
448 Ga0495602_0041077
449 Ga0495614_0005815
450 Ga0495614_0012214
451 Ga0496109_0140372
452 Ga0501031_0034711
453 Ga0501032_0016830
454 Ga0501033_0001549
455 Ga0501033_0010511
456 Ga0501034_0037539
457 Ga0501034_0075131
458 Ga0501036_0014046
459 Ga0501037_0030921
460 Ga0501038_0002484
461 Ga0501038_0099761
462 Ga0501038_0255554
463 Ga0501038_0477767
464 Ga0501039_0005134
465 Ga0501039_0138239
466 Ga0501042_0009169
467 Ga0501043_0003029
468 Ga0501043_0374386
469 Ga0501047_0114166
470 Ga0501047_0313661
471 Ga0501047_0656016
472 Ga0501047_0695481
473 Ga0501048_0072251
474 Ga0501048_0137653
475 Ga0501070_0000559
476 Ga0501070_0253576
477 Ga0501035_0063568
478 Ga0501035_0093139
479 Ga0501035_0204789
480 Ga0501044_0005161
481 Ga0501044_0069499
482 Ga0501044_0077864
483 Ga0501044_0117044
484 nmdc:mga06z11_3298_c1
485 nmdc:mga04h51_4718_c1
486 Ga0495619_0010107
487 Ga0500566_0015328
488 Ga0500640_049401
489 Ga0500654_056780
490 Ga0500553_061019
491 Ga0500560_004608
492 Ga0500560_078558
493 Ga0500569_012922
494 Ga0500572_016716
495 Ga0500614_041123
496 Ga0500628_003626
497 Ga0500652_001023
498 Ga0500658_0122833
499 Ga0500559_0196939
500 Ga0500561_0063901
501 Ga0500600_0026210
502 Ga0500616_0005788
503 2877678594
504 2547407274
505 2585310036
506 2585318436
507 2643899061
508 2644267093
509 2644442295
510 2644626423
511 2768646446
512 2784590766
513 2785371979
514 2786673095
515 2793977412
516 2808844483
517 2808914055
518 2809234472
519 2812355546
520 2812478390
521 2852641605
522 2862182357
523 2862284204
524 2862390534
525 2867350745
526 2867433892
527 2867478959
528 2873153692
529 2912717178
530 2912763182
531 2919474119
532 2946070261
533 2947226553
534 2954383564
535 2954679409
536 2954684746
537 2954694357
538 2954709560
539 2954713866
540 2954723834
541 2954738001
542 2954742734
543 2954756861
544 2954761696
545 2990067394
546 2997454964
547 2997602599
548 3006394584
549 3006426166
550 3006494122
551 8008563206
552 8008576755
553 8023627630
554 8047895683
555 8048130020
556 8048363256
557 8048372707
558 8048381641
559 8056669810
560 8056830093

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jmb-assembly1.cif.gz_A crystal structure of ostrinia furnacalis group iv chitinase in complex with allosamidin 0.6369 116 146
4rkr-assembly2.cif.gz_C crystal structure of laci family transcriptional regulator from arthrobacter sp. fb24, target efi-560007, complex with lactose 0.6182 40 148
7ewf-assembly1.cif.gz_B selenomethionine-substituted structure of s. cerevisiae csn12 in complex with thp3 and sem1 0.6173 161 208
7ewm-assembly1.cif.gz_B native crystal structure of s. cerevisiae csn12 in complex with thp3 and sem1 0.6162 161 208
4u5c-assembly1.cif.gz_A crystal structure of glua2, con-ikot-ikot snail toxin, partial agonist fw and postitive modulator (r,r)-2b complex 0.6061 42 146
ID Description Score Start End Superfamily
3plnA03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.6981 26 64 3.40.50.720
af_Q9VTL1_1_325_1.25.40.570 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; 0.6673 160 207 1.25.40.570
3l07A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.6255 55 146 3.40.50.10860
4a5oB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.625 57 146 3.40.50.10860
3hcwB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.6196 40 147 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A847D092-F1-model_v4 Extradiol ring-cleavage dioxygenase class III enzyme subunit B domain-containing protein 0.745 122 240 GO:0008198
GO:0016491
AF-A0A645E663-F1-model_v4 AMMECR1 domain-containing protein 0.7221 123 234 GO:0008198
GO:0016491
AF-A0A656TK87-F1-model_v4 deleted 0.7051 118 234
AF-A0A143YPS3-F1-model_v4 deleted 0.6942 56 240
AF-A0A7K2Z9R7-F1-model_v4 Uncharacterized protein 0.6919 142 234

Map