F383797
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 280 | 185 | 280 | 318 |
Family's Representative Sequence
| Representative Sequence | 3300036401|Ga0373937_0302740|Ga0373937_0302740_17_1168 |
| Length | 383 |
| Sequence | VKFHKIPFCEFSHLFANWNCSFWDTLCREGFSGYNELRLVDDFRLFEGISDHEENQTSGKFLQCEAGPLRAVVTGGAGFLGSHLCEYLLNQGWEVLAIDNLVTGTPANLRHFPRNVPFAIMQHDVSKFIDVPGPVDYVLHFASPASPVDYLKLPIQTLKVGSLGTHNTLGLALAKKAKYFLASTSECYGDPAVSPQPETYWGNVNTVGPRGVYDEAKRFAEAMTMAYHRAKGLDTHIVRIFNTYGPRMRLNDGRALPNFVHQALTGQPITVYGTGKQTRSFCYVSDLIEGIYRLMMSDEHEPTNVGNPYEITILEFAERVRSLMGVTTPIIFEPLPQDDPKQRCPDISKARRVLGWEPKVNLEEGLKLTLESFKKQFAETQAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 3 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 17 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 32 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 33 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 34 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 35 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 36 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 37 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 38 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 39 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 43 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 44 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 46 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 54 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 58 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 59 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 86 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 87 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 91 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 92 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 93 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 94 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 95 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 96 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 97 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 98 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 99 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 100 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 101 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 102 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 103 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 104 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 105 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 106 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 107 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 108 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 109 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 110 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 111 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 112 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 113 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 114 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 115 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 116 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 117 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 118 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 119 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 120 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 121 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 122 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 123 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 124 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 125 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 126 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 127 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 128 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 129 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 130 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 131 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 132 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 133 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 134 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 167 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 168 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 169 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 170 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 180 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 181 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.29 |
| Metatranscriptomes | 0.71 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.07 |
| Nodule | 0 |
| Rhizoplane | 1.79 |
| Rhizosphere | 95.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10018483 | 3300003203 | Bacteria | 2863 |
| 2 | Ga0070690_100000030 | 3300005330 | Bacteria | 65042 |
| 3 | Ga0070666_10007482 | 3300005335 | Bacteria | 6731 |
| 4 | Ga0070689_100036094 | 3300005340 | Bacteria | 3780 |
| 5 | Ga0070673_100045844 | 3300005364 | Bacteria | 3393 |
| 6 | Ga0070688_100056597 | 3300005365 | Bacteria | 2463 |
| 7 | Ga0070667_100001955 | 3300005367 | Bacteria | 18296 |
| 8 | Ga0070703_10038827 | 3300005406 | Bacteria | 1473 |
| 9 | Ga0070709_10022722 | 3300005434 | Bacteria | 3673 |
| 10 | Ga0070709_10148571 | 3300005434 | Unclassified | 1617 |
| 11 | Ga0070713_100005164 | 3300005436 | Bacteria | 8888 |
| 12 | Ga0070711_100119211 | 3300005439 | Bacteria | 1949 |
| 13 | Ga0070705_100007116 | 3300005440 | Bacteria | 5505 |
| 14 | Ga0070694_100006424 | 3300005444 | Bacteria | 7132 |
| 15 | Ga0070694_100010330 | 3300005444 | Bacteria | 5757 |
| 16 | Ga0070708_100000117 | 3300005445 | Bacteria | 52877 |
| 17 | Ga0070708_100015558 | 3300005445 | Bacteria | 6288 |
| 18 | Ga0070663_100016721 | 3300005455 | Bacteria | 4773 |
| 19 | Ga0070663_100037413 | 3300005455 | Bacteria | 3378 |
| 20 | Ga0068867_100002678 | 3300005459 | Bacteria | 12565 |
| 21 | Ga0070706_100001122 | 3300005467 | Bacteria | 28963 |
| 22 | Ga0070706_100032964 | 3300005467 | Bacteria | 4779 |
| 23 | Ga0070707_100001973 | 3300005468 | Bacteria | 19626 |
| 24 | Ga0070707_100006142 | 3300005468 | Bacteria | 11194 |
| 25 | Ga0070698_100000039 | 3300005471 | Bacteria | 91348 |
| 26 | Ga0070698_100017863 | 3300005471 | Bacteria | 7473 |
| 27 | Ga0070699_100009200 | 3300005518 | Bacteria | 8566 |
| 28 | Ga0070699_100252249 | 3300005518 | Unclassified | 1577 |
| 29 | Ga0070699_100295353 | 3300005518 | Bacteria | 1453 |
| 30 | Ga0070679_100021605 | 3300005530 | Bacteria | 6285 |
| 31 | Ga0070679_100451353 | 3300005530 | Bacteria | 1230 |
| 32 | Ga0070697_100002374 | 3300005536 | Bacteria | 14491 |
| 33 | Ga0070697_100003296 | 3300005536 | Bacteria | 12405 |
| 34 | Ga0070697_100003459 | 3300005536 | Bacteria | 12139 |
| 35 | Ga0070697_100328222 | 3300005536 | Unclassified | 1319 |
| 36 | Ga0070672_100011959 | 3300005543 | Bacteria | 6069 |
| 37 | Ga0070672_100237268 | 3300005543 | Bacteria | 1533 |
| 38 | Ga0070695_100000093 | 3300005545 | Bacteria | 38335 |
| 39 | Ga0070695_100055504 | 3300005545 | Bacteria | 2553 |
| 40 | Ga0070696_100077521 | 3300005546 | Bacteria | 2348 |
| 41 | Ga0070693_100001159 | 3300005547 | Bacteria | 11829 |
| 42 | Ga0070665_100022006 | 3300005548 | Bacteria | 6414 |
| 43 | Ga0070704_100000727 | 3300005549 | Bacteria | 16101 |
| 44 | Ga0070664_100081690 | 3300005564 | Bacteria | 2786 |
| 45 | Ga0068856_100004024 | 3300005614 | Bacteria | 14717 |
| 46 | Ga0068856_100372355 | 3300005614 | Bacteria | 1447 |
| 47 | Ga0068859_100015094 | 3300005617 | Bacteria | 7755 |
| 48 | Ga0068861_100171201 | 3300005719 | Bacteria | 1800 |
| 49 | Ga0068863_100052872 | 3300005841 | Bacteria | 3849 |
| 50 | Ga0068858_100000696 | 3300005842 | Bacteria | 35129 |
| 51 | Ga0068858_100133833 | 3300005842 | Bacteria | 2325 |
| 52 | Ga0068860_100004208 | 3300005843 | Bacteria | 14747 |
| 53 | Ga0068860_100008389 | 3300005843 | Bacteria | 10291 |
| 54 | Ga0068860_100055725 | 3300005843 | Bacteria | 3758 |
| 55 | Ga0068862_100030824 | 3300005844 | Bacteria | 4521 |
| 56 | Ga0081538_10002005 | 3300005981 | Bacteria | 20335 |
| 57 | Ga0081539_10000210 | 3300005985 | Bacteria | 136405 |
| 58 | Ga0070717_10053318 | 3300006028 | Bacteria | 3333 |
| 59 | Ga0070716_100000072 | 3300006173 | Bacteria | 38870 |
| 60 | Ga0070712_100342453 | 3300006175 | Bacteria | 1221 |
| 61 | Ga0075370_10233604 | 3300006353 | Bacteria | 1088 |
| 62 | Ga0075433_10071432 | 3300006852 | Bacteria | 3051 |
| 63 | Ga0097620_100015094 | 3300006931 | Bacteria | 7755 |
| 64 | Ga0099794_10004082 | 3300007265 | Bacteria | 5683 |
| 65 | Ga0099794_10008857 | 3300007265 | Bacteria | 4193 |
| 66 | Ga0099794_10013836 | 3300007265 | Bacteria | 3521 |
| 67 | Ga0099794_10030604 | 3300007265 | Bacteria | 2515 |
| 68 | Ga0099794_10034899 | 3300007265 | Bacteria | 2372 |
| 69 | Ga0099794_10051481 | 3300007265 | Bacteria | 1983 |
| 70 | Ga0099795_10020332 | 3300007788 | Bacteria | 2161 |
| 71 | Ga0105240_10030211 | 3300009093 | Bacteria | 7046 |
| 72 | Ga0105245_10002109 | 3300009098 | Bacteria | 17996 |
| 73 | Ga0105242_10039905 | 3300009176 | Bacteria | 3781 |
| 74 | Ga0105242_10070265 | 3300009176 | Bacteria | 2903 |
| 75 | Ga0105248_10000542 | 3300009177 | Bacteria | 43053 |
| 76 | Ga0105237_10000015 | 3300009545 | Bacteria | 266079 |
| 77 | Ga0105237_10285872 | 3300009545 | Bacteria | 1652 |
| 78 | Ga0105249_10002275 | 3300009553 | Bacteria | 16670 |
| 79 | Ga0099796_10024204 | 3300010159 | Bacteria | 1904 |
| 80 | Ga0157374_10001894 | 3300013296 | Bacteria | 17545 |
| 81 | Ga0157378_10001056 | 3300013297 | Bacteria | 25231 |
| 82 | Ga0157378_10008080 | 3300013297 | Bacteria | 9183 |
| 83 | Ga0157378_10026638 | 3300013297 | Bacteria | 5096 |
| 84 | Ga0163162_10009110 | 3300013306 | Bacteria | 9652 |
| 85 | Ga0163162_10066864 | 3300013306 | Bacteria | 3644 |
| 86 | Ga0163162_10076371 | 3300013306 | Bacteria | 3412 |
| 87 | Ga0213876_10042867 | 3300021384 | Unclassified | 2391 |
| 88 | Ga0228598_1001049 | 3300024227 | Bacteria | 6074 |
| 89 | Ga0207653_10000535 | 3300025885 | Bacteria | 14220 |
| 90 | Ga0207710_10071239 | 3300025900 | Bacteria | 1594 |
| 91 | Ga0207680_10000698 | 3300025903 | Bacteria | 15773 |
| 92 | Ga0207680_10049705 | 3300025903 | Unclassified | 2497 |
| 93 | Ga0207684_10002584 | 3300025910 | Bacteria | 18133 |
| 94 | Ga0207684_10011102 | 3300025910 | Bacteria | 7885 |
| 95 | Ga0207684_10103246 | 3300025910 | Bacteria | 2437 |
| 96 | Ga0207695_10000121 | 3300025913 | Bacteria | 234102 |
| 97 | Ga0207695_10051063 | 3300025913 | Bacteria | 4345 |
| 98 | Ga0207671_10000007 | 3300025914 | Bacteria | 825758 |
| 99 | Ga0207693_10043532 | 3300025915 | Bacteria | 3532 |
| 100 | Ga0207663_10082266 | 3300025916 | Bacteria | 2111 |
| 101 | Ga0207660_10251912 | 3300025917 | Bacteria | 1394 |
| 102 | Ga0207660_10433940 | 3300025917 | Bacteria | 1061 |
| 103 | Ga0207652_10010497 | 3300025921 | Bacteria | 7455 |
| 104 | Ga0207652_10110782 | 3300025921 | Bacteria | 2434 |
| 105 | Ga0207646_10001587 | 3300025922 | Bacteria | 27768 |
| 106 | Ga0207687_10025353 | 3300025927 | Bacteria | 3968 |
| 107 | Ga0207700_10341259 | 3300025928 | Bacteria | 1302 |
| 108 | Ga0207670_10024953 | 3300025936 | Bacteria | 3744 |
| 109 | Ga0207704_10011218 | 3300025938 | Bacteria | 4405 |
| 110 | Ga0207691_10255286 | 3300025940 | Bacteria | 1512 |
| 111 | Ga0207651_10019083 | 3300025960 | Bacteria | 4099 |
| 112 | Ga0207712_10100764 | 3300025961 | Bacteria | 2147 |
| 113 | Ga0207640_10086219 | 3300025981 | Bacteria | 2161 |
| 114 | Ga0207658_10010659 | 3300025986 | Bacteria | 6247 |
| 115 | Ga0207703_10002265 | 3300026035 | Bacteria | 16817 |
| 116 | Ga0207703_10601936 | 3300026035 | Bacteria | 1040 |
| 117 | Ga0207678_10009963 | 3300026067 | Bacteria | 8338 |
| 118 | Ga0207702_10011900 | 3300026078 | Bacteria | 7239 |
| 119 | Ga0207648_10034742 | 3300026089 | Bacteria | 4443 |
| 120 | Ga0207675_100067885 | 3300026118 | Bacteria | 3333 |
| 121 | Ga0209588_1007055 | 3300027671 | Bacteria | 3293 |
| 122 | Ga0209588_1011451 | 3300027671 | Bacteria | 2680 |
| 123 | Ga0209588_1014907 | 3300027671 | Bacteria | 2386 |
| 124 | Ga0265354_1000894 | 3300028016 | Bacteria | 4749 |
| 125 | Ga0265357_1003611 | 3300028023 | Bacteria | 1350 |
| 126 | Ga0265357_1005947 | 3300028023 | Unclassified | 1143 |
| 127 | Ga0268266_10030743 | 3300028379 | Bacteria | 4561 |
| 128 | Ga0268265_10016654 | 3300028380 | Bacteria | 5055 |
| 129 | Ga0268264_10007228 | 3300028381 | Bacteria | 9302 |
| 130 | Ga0265319_1000155 | 3300028563 | Bacteria | 51380 |
| 131 | Ga0265319_1049502 | 3300028563 | Bacteria | 1391 |
| 132 | Ga0265318_10000096 | 3300028577 | Bacteria | 81827 |
| 133 | Ga0265318_10000123 | 3300028577 | Bacteria | 71866 |
| 134 | Ga0265318_10068353 | 3300028577 | Unclassified | 1318 |
| 135 | Ga0265338_10073632 | 3300028800 | Bacteria | 2910 |
| 136 | Ga0265338_10087000 | 3300028800 | Bacteria | 2598 |
| 137 | Ga0265770_1001558 | 3300030878 | Bacteria | 3145 |
| 138 | Ga0265330_10001136 | 3300031235 | Bacteria | 15912 |
| 139 | Ga0265332_10001591 | 3300031238 | Bacteria | 12440 |
| 140 | Ga0265332_10026182 | 3300031238 | Bacteria | 2558 |
| 141 | Ga0265328_10001651 | 3300031239 | Bacteria | 10254 |
| 142 | Ga0265320_10001593 | 3300031240 | Bacteria | 16270 |
| 143 | Ga0265320_10004943 | 3300031240 | Bacteria | 8646 |
| 144 | Ga0265320_10031151 | 3300031240 | Bacteria | 2743 |
| 145 | Ga0265325_10000768 | 3300031241 | Bacteria | 23225 |
| 146 | Ga0265325_10013313 | 3300031241 | Bacteria | 4685 |
| 147 | Ga0265325_10051156 | 3300031241 | Bacteria | 2125 |
| 148 | Ga0265329_10000084 | 3300031242 | Bacteria | 43535 |
| 149 | Ga0265329_10001887 | 3300031242 | Bacteria | 9882 |
| 150 | Ga0265340_10061771 | 3300031247 | Bacteria | 1791 |
| 151 | Ga0265339_10002389 | 3300031249 | Bacteria | 13476 |
| 152 | Ga0265331_10000047 | 3300031250 | Bacteria | 183230 |
| 153 | Ga0265331_10003352 | 3300031250 | Bacteria | 10399 |
| 154 | Ga0265331_10083688 | 3300031250 | Bacteria | 1479 |
| 155 | Ga0265316_10009006 | 3300031344 | Bacteria | 9206 |
| 156 | Ga0265316_10046302 | 3300031344 | Bacteria | 3447 |
| 157 | Ga0265316_10109479 | 3300031344 | Bacteria | 2093 |
| 158 | Ga0307408_100021831 | 3300031548 | Bacteria | 4339 |
| 159 | Ga0307408_100077387 | 3300031548 | Bacteria | 2477 |
| 160 | Ga0265313_10007149 | 3300031595 | Bacteria | 7688 |
| 161 | Ga0265313_10008632 | 3300031595 | Bacteria | 6738 |
| 162 | Ga0316579_10000389 | 3300031691 | Bacteria | 13864 |
| 163 | Ga0265314_10006231 | 3300031711 | Bacteria | 10591 |
| 164 | Ga0265314_10065422 | 3300031711 | Bacteria | 2456 |
| 165 | Ga0265314_10127069 | 3300031711 | Bacteria | 1595 |
| 166 | Ga0265342_10000158 | 3300031712 | Bacteria | 76866 |
| 167 | Ga0265342_10005352 | 3300031712 | Bacteria | 9811 |
| 168 | Ga0316576_10001163 | 3300031727 | Bacteria | 13786 |
| 169 | Ga0316576_10090080 | 3300031727 | Unclassified | 2284 |
| 170 | Ga0316578_10023154 | 3300031728 | Unclassified | 3474 |
| 171 | Ga0316577_10004975 | 3300031733 | Bacteria | 6930 |
| 172 | Ga0307413_10103010 | 3300031824 | Bacteria | 1891 |
| 173 | Ga0307410_10047285 | 3300031852 | Bacteria | 2875 |
| 174 | Ga0307416_100017463 | 3300032002 | Bacteria | 5024 |
| 175 | Ga0307416_100103921 | 3300032002 | Bacteria | 2482 |
| 176 | Ga0307416_100300709 | 3300032002 | Bacteria | 1595 |
| 177 | Ga0316583_10002275 | 3300032133 | Bacteria | 6614 |
| 178 | Ga0316585_10000267 | 3300032137 | Bacteria | 11327 |
| 179 | Ga0316580_10000617 | 3300032139 | Bacteria | 8358 |
| 180 | Ga0316596_1026334 | 3300033541 | Bacteria | 1499 |
| 181 | Ga0316212_1002653 | 3300033547 | Bacteria | 2554 |
| 182 | Ga0373926_0002147 | 3300035083 | Bacteria | 6208 |
| 183 | Ga0373953_0021306 | 3300035117 | Bacteria | 2430 |
| 184 | Ga0373954_0007475 | 3300035118 | Bacteria | 4782 |
| 185 | Ga0316574_0001135 | 3300035398 | Bacteria | 12225 |
| 186 | Ga0316574_0032409 | 3300035398 | Bacteria | 3176 |
| 187 | Ga0373937_0027783 | 3300036401 | Bacteria | 5119 |
| 188 | Ga0373937_0124571 | 3300036401 | Unclassified | 2403 |
| 189 | Ga0373937_0207690 | 3300036401 | Bacteria | 1842 |
| 190 | Ga0373937_0302740 | 3300036401 | Bacteria | 1511 |
| 191 | Ga0316582_0004775 | 3300036647 | Bacteria | 6906 |
| 192 | Ga0316584_0001640 | 3300036712 | Bacteria | 13659 |
| 193 | Ga0395905_0000396 | 3300037471 | Bacteria | 61743 |
| 194 | Ga0316581_0000792 | 3300037588 | Bacteria | 6547 |
| 195 | Ga0436364_0625534 | 3300037853 | Bacteria | 6784 |
| 196 | Ga0436365_1550865 | 3300039437 | Bacteria | 4172 |
| 197 | Ga0451577_0124459 | 3300042876 | Bacteria | 2310 |
| 198 | Ga0451577_0376465 | 3300042876 | Bacteria | 1288 |
| 199 | Ga0453683_0003755 | 3300044673 | Bacteria | 11081 |
| 200 | Ga0453683_0068284 | 3300044673 | Bacteria | 2222 |
| 201 | Ga0451576_0167909 | 3300045051 | Bacteria | 2290 |
| 202 | Ga0495592_0036307 | 3300046454 | Bacteria | 3712 |
| 203 | Ga0495603_0160770 | 3300046455 | Bacteria | 1303 |
| 204 | Ga0495651_0000075 | 3300046462 | Bacteria | 73020 |
| 205 | Ga0495651_0001555 | 3300046462 | Bacteria | 17737 |
| 206 | Ga0495651_0013164 | 3300046462 | Bacteria | 6393 |
| 207 | Ga0495653_0003265 | 3300046463 | Bacteria | 13013 |
| 208 | Ga0495653_0046187 | 3300046463 | Bacteria | 3373 |
| 209 | Ga0495580_0000901 | 3300046472 | Bacteria | 25876 |
| 210 | Ga0495580_0024462 | 3300046472 | Bacteria | 4421 |
| 211 | Ga0495582_0034102 | 3300046473 | Bacteria | 2798 |
| 212 | Ga0495582_0166716 | 3300046473 | Bacteria | 1253 |
| 213 | Ga0495664_0016525 | 3300046477 | Bacteria | 4206 |
| 214 | Ga0495608_0095095 | 3300046511 | Bacteria | 1925 |
| 215 | Ga0495608_0118572 | 3300046511 | Bacteria | 1698 |
| 216 | Ga0495608_0129140 | 3300046511 | Bacteria | 1618 |
| 217 | Ga0495618_0078450 | 3300046514 | Bacteria | 2105 |
| 218 | Ga0495628_0000283 | 3300046516 | Bacteria | 45481 |
| 219 | Ga0495628_0012244 | 3300046516 | Bacteria | 7232 |
| 220 | Ga0495628_0053980 | 3300046516 | Bacteria | 3169 |
| 221 | Ga0495630_0024549 | 3300046517 | Bacteria | 4456 |
| 222 | Ga0495630_0052237 | 3300046517 | Bacteria | 3059 |
| 223 | Ga0495652_0001131 | 3300046529 | Bacteria | 30078 |
| 224 | Ga0495652_0004816 | 3300046529 | Bacteria | 12835 |
| 225 | Ga0495665_0000672 | 3300046531 | Bacteria | 17541 |
| 226 | Ga0495586_0042830 | 3300046535 | Bacteria | 2438 |
| 227 | Ga0495587_0003629 | 3300046536 | Bacteria | 10271 |
| 228 | Ga0495587_0113901 | 3300046536 | Bacteria | 1552 |
| 229 | Ga0495667_0000317 | 3300046559 | Bacteria | 30459 |
| 230 | Ga0495667_0008999 | 3300046559 | Bacteria | 6784 |
| 231 | Ga0495635_0001513 | 3300046663 | Bacteria | 15559 |
| 232 | Ga0495635_0141561 | 3300046663 | Bacteria | 1638 |
| 233 | Ga0495599_0011134 | 3300046678 | Bacteria | 5520 |
| 234 | Ga0495599_0135584 | 3300046678 | Bacteria | 1528 |
| 235 | Ga0495623_0000369 | 3300046679 | Bacteria | 29555 |
| 236 | Ga0495646_0000366 | 3300046680 | Bacteria | 23389 |
| 237 | Ga0495646_0189324 | 3300046680 | Bacteria | 1125 |
| 238 | Ga0495647_0009641 | 3300046681 | Bacteria | 3276 |
| 239 | Ga0495658_0175612 | 3300046683 | Bacteria | 1327 |
| 240 | Ga0495613_0019999 | 3300046689 | Bacteria | 4989 |
| 241 | Ga0495613_0205635 | 3300046689 | Unclassified | 1386 |
| 242 | Ga0495600_0140620 | 3300046809 | Bacteria | 1566 |
| 243 | Ga0495604_0000278 | 3300047317 | Bacteria | 45825 |
| 244 | Ga0495604_0017137 | 3300047317 | Bacteria | 5794 |
| 245 | Ga0495674_0006748 | 3300047319 | Bacteria | 10989 |
| 246 | Ga0495674_0009819 | 3300047319 | Bacteria | 9085 |
| 247 | Ga0495674_0095636 | 3300047319 | Bacteria | 2532 |
| 248 | Ga0495676_0102959 | 3300047321 | Bacteria | 2109 |
| 249 | Ga0495680_0000274 | 3300047322 | Bacteria | 57527 |
| 250 | Ga0495680_0012201 | 3300047322 | Bacteria | 7578 |
| 251 | Ga0495675_0000599 | 3300047444 | Bacteria | 23250 |
| 252 | Ga0495675_0002088 | 3300047444 | Bacteria | 11915 |
| 253 | Ga0495675_0054012 | 3300047444 | Bacteria | 2550 |
| 254 | Ga0495684_0078203 | 3300047471 | Bacteria | 2510 |
| 255 | Ga0495593_0031615 | 3300047673 | Bacteria | 2890 |
| 256 | Ga0495602_0044484 | 3300048088 | Bacteria | 4027 |
| 257 | Ga0496102_0023341 | 3300048905 | Bacteria | 5492 |
| 258 | Ga0496102_0029220 | 3300048905 | Bacteria | 4931 |
| 259 | Ga0496103_0152667 | 3300048906 | Bacteria | 1480 |
| 260 | Ga0496106_0178663 | 3300048909 | Bacteria | 1684 |
| 261 | Ga0496107_0108044 | 3300048910 | Bacteria | 2043 |
| 262 | Ga0501034_0008838 | 3300049571 | Bacteria | 10594 |
| 263 | Ga0501034_0383649 | 3300049571 | Bacteria | 1330 |
| 264 | Ga0501036_0134237 | 3300049572 | Bacteria | 2089 |
| 265 | Ga0501042_0182583 | 3300049578 | Bacteria | 1514 |
| 266 | Ga0501048_0077076 | 3300049582 | Bacteria | 2353 |
| 267 | Ga0501072_0061537 | 3300049588 | Bacteria | 2961 |
| 268 | Ga0501073_0016084 | 3300049589 | Bacteria | 5424 |
| 269 | Ga0501076_0131216 | 3300049592 | Bacteria | 2032 |
| 270 | Ga0501077_0054375 | 3300049593 | Bacteria | 2543 |
| 271 | Ga0501044_0082016 | 3300049823 | Bacteria | 3264 |
| 272 | Ga0501044_0187754 | 3300049823 | Bacteria | 2031 |
| 273 | nmdc:mga0k408_49348_c1 | 3300050493 | Unclassified | 2436 |
| 274 | nmdc:mga07m45_68689_c1 | 3300050496 | Bacteria | 2014 |
| 275 | nmdc:mga08y16_506302_c1 | 3300050511 | Bacteria | 1226 |
| 276 | nmdc:mga0a205_99694_c1 | 3300050515 | Bacteria | 2803 |
| 277 | Ga0495612_0000983 | 3300053078 | Bacteria | 11728 |
| 278 | Ga0501084_0107875 | 3300054114 | Bacteria | 2339 |
| 279 | Ga0501084_0184319 | 3300054114 | Bacteria | 1762 |
| 280 | Ga0590075_006521 | 3300059424 | Bacteria | 2766 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300007265 | Ga0099794_10013836 | Ga0099794_100138362 | 304 |
| 2 | 3300027671 | Ga0209588_1007055 | Ga0209588_10070552 | 304 |
| 3 | 3300007265 | Ga0099794_10034899 | Ga0099794_100348993 | 305 |
| 4 | 3300027671 | Ga0209588_1014907 | Ga0209588_10149072 | 305 |
| 5 | 3300005434 | Ga0070709_10148571 | Ga0070709_101485712 | 306 |
| 6 | 3300006173 | Ga0070716_100000072 | Ga0070716_10000007217 | 306 |
| 7 | 3300046473 | Ga0495582_0034102 | Ga0495582_0034102_189_1139 | 306 |
| 8 | 3300046689 | Ga0495613_0205635 | Ga0495613_0205635_126_1076 | 306 |
| 9 | 3300035398 | Ga0316574_0032409 | Ga0316574_0032409_1852_2775 | 307 |
| 10 | 3300031548 | Ga0307408_100077387 | Ga0307408_1000773872 | 308 |
| 11 | 3300048906 | Ga0496103_0152667 | Ga0496103_0152667_328_1254 | 308 |
| 12 | 3300049571 | Ga0501034_0008838 | Ga0501034_0008838_9392_10318 | 308 |
| 13 | 3300049571 | Ga0501034_0383649 | Ga0501034_0383649_338_1264 | 308 |
| 14 | 3300005468 | Ga0070707_100001973 | Ga0070707_10000197315 | 309 |
| 15 | 3300025913 | Ga0207695_10000121 | Ga0207695_1000012128 | 309 |
| 16 | 3300031250 | Ga0265331_10083688 | Ga0265331_100836882 | 309 |
| 17 | 3300031691 | Ga0316579_10000389 | Ga0316579_100003899 | 309 |
| 18 | 3300031727 | Ga0316576_10001163 | Ga0316576_100011637 | 309 |
| 19 | 3300031727 | Ga0316576_10090080 | Ga0316576_100900802 | 309 |
| 20 | 3300031728 | Ga0316578_10023154 | Ga0316578_100231542 | 309 |
| 21 | 3300031733 | Ga0316577_10004975 | Ga0316577_100049754 | 309 |
| 22 | 3300032133 | Ga0316583_10002275 | Ga0316583_100022752 | 309 |
| 23 | 3300032137 | Ga0316585_10000267 | Ga0316585_100002676 | 309 |
| 24 | 3300032139 | Ga0316580_10000617 | Ga0316580_100006172 | 309 |
| 25 | 3300033541 | Ga0316596_1026334 | Ga0316596_10263342 | 309 |
| 26 | 3300035398 | Ga0316574_0001135 | Ga0316574_0001135_4674_5615 | 309 |
| 27 | 3300036647 | Ga0316582_0004775 | Ga0316582_0004775_5115_6056 | 309 |
| 28 | 3300036712 | Ga0316584_0001640 | Ga0316584_0001640_6889_7830 | 309 |
| 29 | 3300037471 | Ga0395905_0000396 | Ga0395905_0000396_661_1590 | 309 |
| 30 | 3300037588 | Ga0316581_0000792 | Ga0316581_0000792_158_1099 | 309 |
| 31 | 3300044673 | Ga0453683_0003755 | Ga0453683_0003755_1703_2644 | 309 |
| 32 | 3300049589 | Ga0501073_0016084 | Ga0501073_0016084_515_1450 | 309 |
| 33 | 3300049823 | Ga0501044_0082016 | Ga0501044_0082016_241_1176 | 309 |
| 34 | 3300005330 | Ga0070690_100000030 | Ga0070690_10000003055 | 310 |
| 35 | 3300005335 | Ga0070666_10007482 | Ga0070666_100074824 | 310 |
| 36 | 3300005340 | Ga0070689_100036094 | Ga0070689_1000360944 | 310 |
| 37 | 3300005364 | Ga0070673_100045844 | Ga0070673_1000458445 | 310 |
| 38 | 3300005365 | Ga0070688_100056597 | Ga0070688_1000565972 | 310 |
| 39 | 3300005367 | Ga0070667_100001955 | Ga0070667_1000019553 | 310 |
| 40 | 3300005455 | Ga0070663_100037413 | Ga0070663_1000374135 | 310 |
| 41 | 3300005459 | Ga0068867_100002678 | Ga0068867_1000026783 | 310 |
| 42 | 3300005518 | Ga0070699_100295353 | Ga0070699_1002953531 | 310 |
| 43 | 3300005543 | Ga0070672_100011959 | Ga0070672_1000119594 | 310 |
| 44 | 3300005548 | Ga0070665_100022006 | Ga0070665_1000220065 | 310 |
| 45 | 3300005564 | Ga0070664_100081690 | Ga0070664_1000816902 | 310 |
| 46 | 3300005614 | Ga0068856_100004024 | Ga0068856_10000402412 | 310 |
| 47 | 3300005617 | Ga0068859_100015094 | Ga0068859_1000150947 | 310 |
| 48 | 3300005842 | Ga0068858_100000696 | Ga0068858_10000069620 | 310 |
| 49 | 3300005843 | Ga0068860_100004208 | Ga0068860_1000042082 | 310 |
| 50 | 3300006931 | Ga0097620_100015094 | Ga0097620_1000150943 | 310 |
| 51 | 3300009177 | Ga0105248_10000542 | Ga0105248_1000054231 | 310 |
| 52 | 3300025903 | Ga0207680_10000698 | Ga0207680_1000069814 | 310 |
| 53 | 3300025910 | Ga0207684_10103246 | Ga0207684_101032462 | 310 |
| 54 | 3300025936 | Ga0207670_10024953 | Ga0207670_100249532 | 310 |
| 55 | 3300025938 | Ga0207704_10011218 | Ga0207704_100112184 | 310 |
| 56 | 3300025960 | Ga0207651_10019083 | Ga0207651_100190835 | 310 |
| 57 | 3300025986 | Ga0207658_10010659 | Ga0207658_100106593 | 310 |
| 58 | 3300026035 | Ga0207703_10002265 | Ga0207703_1000226511 | 310 |
| 59 | 3300026067 | Ga0207678_10009963 | Ga0207678_100099632 | 310 |
| 60 | 3300026078 | Ga0207702_10011900 | Ga0207702_100119005 | 310 |
| 61 | 3300026089 | Ga0207648_10034742 | Ga0207648_100347425 | 310 |
| 62 | 3300028381 | Ga0268264_10007228 | Ga0268264_100072282 | 310 |
| 63 | 3300028563 | Ga0265319_1049502 | Ga0265319_10495021 | 310 |
| 64 | 3300028577 | Ga0265318_10000096 | Ga0265318_1000009619 | 310 |
| 65 | 3300031235 | Ga0265330_10001136 | Ga0265330_1000113610 | 310 |
| 66 | 3300031238 | Ga0265332_10001591 | Ga0265332_100015915 | 310 |
| 67 | 3300031239 | Ga0265328_10001651 | Ga0265328_100016514 | 310 |
| 68 | 3300031240 | Ga0265320_10004943 | Ga0265320_100049434 | 310 |
| 69 | 3300031242 | Ga0265329_10001887 | Ga0265329_100018876 | 310 |
| 70 | 3300031250 | Ga0265331_10003352 | Ga0265331_100033523 | 310 |
| 71 | 3300031344 | Ga0265316_10009006 | Ga0265316_100090064 | 310 |
| 72 | 3300031711 | Ga0265314_10006231 | Ga0265314_100062316 | 310 |
| 73 | 3300031712 | Ga0265342_10005352 | Ga0265342_100053526 | 310 |
| 74 | 3300046455 | Ga0495603_0160770 | Ga0495603_0160770_197_1129 | 310 |
| 75 | 3300046472 | Ga0495580_0000901 | Ga0495580_0000901_8204_9136 | 310 |
| 76 | 3300046473 | Ga0495582_0166716 | Ga0495582_0166716_109_1041 | 310 |
| 77 | 3300046681 | Ga0495647_0009641 | Ga0495647_0009641_686_1618 | 310 |
| 78 | 3300046683 | Ga0495658_0175612 | Ga0495658_0175612_210_1142 | 310 |
| 79 | 3300005530 | Ga0070679_100451353 | Ga0070679_1004513532 | 311 |
| 80 | 3300006028 | Ga0070717_10053318 | Ga0070717_100533183 | 311 |
| 81 | 3300013306 | Ga0163162_10066864 | Ga0163162_100668642 | 311 |
| 82 | 3300025903 | Ga0207680_10049705 | Ga0207680_100497052 | 311 |
| 83 | 3300025917 | Ga0207660_10251912 | Ga0207660_102519121 | 311 |
| 84 | 3300025921 | Ga0207652_10110782 | Ga0207652_101107821 | 311 |
| 85 | 3300031241 | Ga0265325_10000768 | Ga0265325_1000076818 | 311 |
| 86 | 3300031824 | Ga0307413_10103010 | Ga0307413_101030102 | 311 |
| 87 | 3300031852 | Ga0307410_10047285 | Ga0307410_100472853 | 311 |
| 88 | 3300032002 | Ga0307416_100103921 | Ga0307416_1001039212 | 311 |
| 89 | 3300035117 | Ga0373953_0021306 | Ga0373953_0021306_970_1917 | 311 |
| 90 | 3300036401 | Ga0373937_0027783 | Ga0373937_0027783_1324_2271 | 311 |
| 91 | 3300046472 | Ga0495580_0024462 | Ga0495580_0024462_2347_3282 | 311 |
| 92 | 3300049572 | Ga0501036_0134237 | Ga0501036_0134237_426_1361 | 311 |
| 93 | 3300049578 | Ga0501042_0182583 | Ga0501042_0182583_426_1403 | 311 |
| 94 | 3300049582 | Ga0501048_0077076 | Ga0501048_0077076_1122_2057 | 311 |
| 95 | 3300049588 | Ga0501072_0061537 | Ga0501072_0061537_1952_2887 | 311 |
| 96 | 3300049592 | Ga0501076_0131216 | Ga0501076_0131216_1039_1974 | 311 |
| 97 | 3300054114 | Ga0501084_0107875 | Ga0501084_0107875_1145_2080 | 311 |
| 98 | 3300003203 | JGI25406J46586_10018483 | JGI25406J46586_100184833 | 312 |
| 99 | 3300005406 | Ga0070703_10038827 | Ga0070703_100388272 | 312 |
| 100 | 3300005434 | Ga0070709_10022722 | Ga0070709_100227222 | 312 |
| 101 | 3300005436 | Ga0070713_100005164 | Ga0070713_1000051642 | 312 |
| 102 | 3300005439 | Ga0070711_100119211 | Ga0070711_1001192112 | 312 |
| 103 | 3300005440 | Ga0070705_100007116 | Ga0070705_1000071163 | 312 |
| 104 | 3300005444 | Ga0070694_100006424 | Ga0070694_1000064244 | 312 |
| 105 | 3300005444 | Ga0070694_100010330 | Ga0070694_1000103302 | 312 |
| 106 | 3300005445 | Ga0070708_100000117 | Ga0070708_10000011710 | 312 |
| 107 | 3300005445 | Ga0070708_100015558 | Ga0070708_1000155584 | 312 |
| 108 | 3300005455 | Ga0070663_100016721 | Ga0070663_1000167212 | 312 |
| 109 | 3300005467 | Ga0070706_100001122 | Ga0070706_1000011229 | 312 |
| 110 | 3300005467 | Ga0070706_100032964 | Ga0070706_1000329642 | 312 |
| 111 | 3300005468 | Ga0070707_100006142 | Ga0070707_1000061426 | 312 |
| 112 | 3300005471 | Ga0070698_100000039 | Ga0070698_10000003948 | 312 |
| 113 | 3300005471 | Ga0070698_100017863 | Ga0070698_1000178634 | 312 |
| 114 | 3300005518 | Ga0070699_100009200 | Ga0070699_1000092005 | 312 |
| 115 | 3300005518 | Ga0070699_100252249 | Ga0070699_1002522492 | 312 |
| 116 | 3300005530 | Ga0070679_100021605 | Ga0070679_1000216053 | 312 |
| 117 | 3300005536 | Ga0070697_100002374 | Ga0070697_1000023748 | 312 |
| 118 | 3300005536 | Ga0070697_100003296 | Ga0070697_1000032967 | 312 |
| 119 | 3300005536 | Ga0070697_100003459 | Ga0070697_1000034596 | 312 |
| 120 | 3300005536 | Ga0070697_100328222 | Ga0070697_1003282221 | 312 |
| 121 | 3300005543 | Ga0070672_100237268 | Ga0070672_1002372682 | 312 |
| 122 | 3300005545 | Ga0070695_100000093 | Ga0070695_10000009332 | 312 |
| 123 | 3300005545 | Ga0070695_100055504 | Ga0070695_1000555042 | 312 |
| 124 | 3300005546 | Ga0070696_100077521 | Ga0070696_1000775212 | 312 |
| 125 | 3300005547 | Ga0070693_100001159 | Ga0070693_10000115910 | 312 |
| 126 | 3300005549 | Ga0070704_100000727 | Ga0070704_10000072710 | 312 |
| 127 | 3300005614 | Ga0068856_100372355 | Ga0068856_1003723551 | 312 |
| 128 | 3300005719 | Ga0068861_100171201 | Ga0068861_1001712013 | 312 |
| 129 | 3300005841 | Ga0068863_100052872 | Ga0068863_1000528725 | 312 |
| 130 | 3300005842 | Ga0068858_100133833 | Ga0068858_1001338333 | 312 |
| 131 | 3300005843 | Ga0068860_100008389 | Ga0068860_1000083895 | 312 |
| 132 | 3300005843 | Ga0068860_100055725 | Ga0068860_1000557252 | 312 |
| 133 | 3300005844 | Ga0068862_100030824 | Ga0068862_1000308243 | 312 |
| 134 | 3300005981 | Ga0081538_10002005 | Ga0081538_100020057 | 312 |
| 135 | 3300005985 | Ga0081539_10000210 | Ga0081539_1000021099 | 312 |
| 136 | 3300006175 | Ga0070712_100342453 | Ga0070712_1003424531 | 312 |
| 137 | 3300006353 | Ga0075370_10233604 | Ga0075370_102336041 | 312 |
| 138 | 3300006852 | Ga0075433_10071432 | Ga0075433_100714323 | 312 |
| 139 | 3300007265 | Ga0099794_10004082 | Ga0099794_100040825 | 312 |
| 140 | 3300007265 | Ga0099794_10008857 | Ga0099794_100088573 | 312 |
| 141 | 3300007265 | Ga0099794_10030604 | Ga0099794_100306041 | 312 |
| 142 | 3300007265 | Ga0099794_10051481 | Ga0099794_100514812 | 312 |
| 143 | 3300007788 | Ga0099795_10020332 | Ga0099795_100203322 | 312 |
| 144 | 3300009093 | Ga0105240_10030211 | Ga0105240_100302112 | 312 |
| 145 | 3300009098 | Ga0105245_10002109 | Ga0105245_1000210914 | 312 |
| 146 | 3300009176 | Ga0105242_10039905 | Ga0105242_100399056 | 312 |
| 147 | 3300009176 | Ga0105242_10070265 | Ga0105242_100702652 | 312 |
| 148 | 3300009545 | Ga0105237_10000015 | Ga0105237_10000015175 | 312 |
| 149 | 3300009545 | Ga0105237_10285872 | Ga0105237_102858722 | 312 |
| 150 | 3300009553 | Ga0105249_10002275 | Ga0105249_100022753 | 312 |
| 151 | 3300010159 | Ga0099796_10024204 | Ga0099796_100242041 | 312 |
| 152 | 3300013296 | Ga0157374_10001894 | Ga0157374_100018947 | 312 |
| 153 | 3300013297 | Ga0157378_10001056 | Ga0157378_100010567 | 312 |
| 154 | 3300013297 | Ga0157378_10008080 | Ga0157378_100080803 | 312 |
| 155 | 3300013297 | Ga0157378_10026638 | Ga0157378_100266382 | 312 |
| 156 | 3300013306 | Ga0163162_10009110 | Ga0163162_100091109 | 312 |
| 157 | 3300013306 | Ga0163162_10076371 | Ga0163162_100763714 | 312 |
| 158 | 3300021384 | Ga0213876_10042867 | Ga0213876_100428672 | 312 |
| 159 | 3300024227 | Ga0228598_1001049 | Ga0228598_10010491 | 312 |
| 160 | 3300025885 | Ga0207653_10000535 | Ga0207653_100005355 | 312 |
| 161 | 3300025900 | Ga0207710_10071239 | Ga0207710_100712391 | 312 |
| 162 | 3300025910 | Ga0207684_10002584 | Ga0207684_1000258410 | 312 |
| 163 | 3300025910 | Ga0207684_10011102 | Ga0207684_100111024 | 312 |
| 164 | 3300025913 | Ga0207695_10051063 | Ga0207695_100510633 | 312 |
| 165 | 3300025914 | Ga0207671_10000007 | Ga0207671_10000007605 | 312 |
| 166 | 3300025915 | Ga0207693_10043532 | Ga0207693_100435322 | 312 |
| 167 | 3300025916 | Ga0207663_10082266 | Ga0207663_100822662 | 312 |
| 168 | 3300025917 | Ga0207660_10433940 | Ga0207660_104339401 | 312 |
| 169 | 3300025921 | Ga0207652_10010497 | Ga0207652_100104973 | 312 |
| 170 | 3300025922 | Ga0207646_10001587 | Ga0207646_1000158719 | 312 |
| 171 | 3300025927 | Ga0207687_10025353 | Ga0207687_100253533 | 312 |
| 172 | 3300025928 | Ga0207700_10341259 | Ga0207700_103412592 | 312 |
| 173 | 3300025940 | Ga0207691_10255286 | Ga0207691_102552861 | 312 |
| 174 | 3300025961 | Ga0207712_10100764 | Ga0207712_101007644 | 312 |
| 175 | 3300025981 | Ga0207640_10086219 | Ga0207640_100862192 | 312 |
| 176 | 3300026035 | Ga0207703_10601936 | Ga0207703_106019361 | 312 |
| 177 | 3300026118 | Ga0207675_100067885 | Ga0207675_1000678852 | 312 |
| 178 | 3300027671 | Ga0209588_1011451 | Ga0209588_10114512 | 312 |
| 179 | 3300028016 | Ga0265354_1000894 | Ga0265354_10008943 | 312 |
| 180 | 3300028023 | Ga0265357_1003611 | Ga0265357_10036112 | 312 |
| 181 | 3300028023 | Ga0265357_1005947 | Ga0265357_10059472 | 312 |
| 182 | 3300028379 | Ga0268266_10030743 | Ga0268266_100307431 | 312 |
| 183 | 3300028380 | Ga0268265_10016654 | Ga0268265_100166543 | 312 |
| 184 | 3300028563 | Ga0265319_1000155 | Ga0265319_10001555 | 312 |
| 185 | 3300028577 | Ga0265318_10000123 | Ga0265318_100001232 | 312 |
| 186 | 3300028577 | Ga0265318_10068353 | Ga0265318_100683531 | 312 |
| 187 | 3300028800 | Ga0265338_10073632 | Ga0265338_100736322 | 312 |
| 188 | 3300028800 | Ga0265338_10087000 | Ga0265338_100870002 | 312 |
| 189 | 3300030878 | Ga0265770_1001558 | Ga0265770_10015583 | 312 |
| 190 | 3300031238 | Ga0265332_10026182 | Ga0265332_100261821 | 312 |
| 191 | 3300031240 | Ga0265320_10001593 | Ga0265320_100015935 | 312 |
| 192 | 3300031240 | Ga0265320_10031151 | Ga0265320_100311512 | 312 |
| 193 | 3300031241 | Ga0265325_10013313 | Ga0265325_100133133 | 312 |
| 194 | 3300031241 | Ga0265325_10051156 | Ga0265325_100511562 | 312 |
| 195 | 3300031242 | Ga0265329_10000084 | Ga0265329_1000008439 | 312 |
| 196 | 3300031247 | Ga0265340_10061771 | Ga0265340_100617711 | 312 |
| 197 | 3300031249 | Ga0265339_10002389 | Ga0265339_100023893 | 312 |
| 198 | 3300031250 | Ga0265331_10000047 | Ga0265331_1000004777 | 312 |
| 199 | 3300031344 | Ga0265316_10046302 | Ga0265316_100463023 | 312 |
| 200 | 3300031344 | Ga0265316_10109479 | Ga0265316_101094792 | 312 |
| 201 | 3300031548 | Ga0307408_100021831 | Ga0307408_1000218313 | 312 |
| 202 | 3300031595 | Ga0265313_10007149 | Ga0265313_100071492 | 312 |
| 203 | 3300031595 | Ga0265313_10008632 | Ga0265313_100086324 | 312 |
| 204 | 3300031711 | Ga0265314_10065422 | Ga0265314_100654222 | 312 |
| 205 | 3300031711 | Ga0265314_10127069 | Ga0265314_101270691 | 312 |
| 206 | 3300031712 | Ga0265342_10000158 | Ga0265342_1000015856 | 312 |
| 207 | 3300032002 | Ga0307416_100017463 | Ga0307416_1000174634 | 312 |
| 208 | 3300032002 | Ga0307416_100300709 | Ga0307416_1003007092 | 312 |
| 209 | 3300033547 | Ga0316212_1002653 | Ga0316212_10026532 | 312 |
| 210 | 3300035083 | Ga0373926_0002147 | Ga0373926_0002147_2437_3384 | 312 |
| 211 | 3300035118 | Ga0373954_0007475 | Ga0373954_0007475_1631_2578 | 312 |
| 212 | 3300036401 | Ga0373937_0124571 | Ga0373937_0124571_1170_2117 | 312 |
| 213 | 3300036401 | Ga0373937_0207690 | Ga0373937_0207690_99_1046 | 312 |
| 214 | 3300036401 | Ga0373937_0302740 | Ga0373937_0302740_17_1168 | 312 |
| 215 | 3300037853 | Ga0436364_0625534 | Ga0436364_0625534_3197_4183 | 312 |
| 216 | 3300039437 | Ga0436365_1550865 | Ga0436365_1550865_1448_2389 | 312 |
| 217 | 3300042876 | Ga0451577_0124459 | Ga0451577_0124459_245_1198 | 312 |
| 218 | 3300042876 | Ga0451577_0376465 | Ga0451577_0376465_20_976 | 312 |
| 219 | 3300044673 | Ga0453683_0068284 | Ga0453683_0068284_403_1356 | 312 |
| 220 | 3300045051 | Ga0451576_0167909 | Ga0451576_0167909_702_1646 | 312 |
| 221 | 3300046454 | Ga0495592_0036307 | Ga0495592_0036307_596_1543 | 312 |
| 222 | 3300046462 | Ga0495651_0000075 | Ga0495651_0000075_48862_49809 | 312 |
| 223 | 3300046462 | Ga0495651_0001555 | Ga0495651_0001555_5890_6837 | 312 |
| 224 | 3300046462 | Ga0495651_0013164 | Ga0495651_0013164_1099_2250 | 312 |
| 225 | 3300046463 | Ga0495653_0003265 | Ga0495653_0003265_9273_10220 | 312 |
| 226 | 3300046463 | Ga0495653_0046187 | Ga0495653_0046187_29_1180 | 312 |
| 227 | 3300046477 | Ga0495664_0016525 | Ga0495664_0016525_3065_4012 | 312 |
| 228 | 3300046511 | Ga0495608_0095095 | Ga0495608_0095095_354_1301 | 312 |
| 229 | 3300046511 | Ga0495608_0118572 | Ga0495608_0118572_458_1609 | 312 |
| 230 | 3300046511 | Ga0495608_0129140 | Ga0495608_0129140_492_1439 | 312 |
| 231 | 3300046514 | Ga0495618_0078450 | Ga0495618_0078450_17_1168 | 312 |
| 232 | 3300046516 | Ga0495628_0000283 | Ga0495628_0000283_44247_45398 | 312 |
| 233 | 3300046516 | Ga0495628_0012244 | Ga0495628_0012244_3844_4791 | 312 |
| 234 | 3300046516 | Ga0495628_0053980 | Ga0495628_0053980_2149_3096 | 312 |
| 235 | 3300046517 | Ga0495630_0024549 | Ga0495630_0024549_1598_2545 | 312 |
| 236 | 3300046517 | Ga0495630_0052237 | Ga0495630_0052237_1370_2317 | 312 |
| 237 | 3300046529 | Ga0495652_0001131 | Ga0495652_0001131_28845_29996 | 312 |
| 238 | 3300046529 | Ga0495652_0004816 | Ga0495652_0004816_9624_10571 | 312 |
| 239 | 3300046531 | Ga0495665_0000672 | Ga0495665_0000672_7102_8049 | 312 |
| 240 | 3300046535 | Ga0495586_0042830 | Ga0495586_0042830_1282_2229 | 312 |
| 241 | 3300046536 | Ga0495587_0003629 | Ga0495587_0003629_29_1180 | 312 |
| 242 | 3300046536 | Ga0495587_0113901 | Ga0495587_0113901_212_1159 | 312 |
| 243 | 3300046559 | Ga0495667_0000317 | Ga0495667_0000317_7154_8101 | 312 |
| 244 | 3300046559 | Ga0495667_0008999 | Ga0495667_0008999_79_1230 | 312 |
| 245 | 3300046663 | Ga0495635_0001513 | Ga0495635_0001513_12228_13175 | 312 |
| 246 | 3300046663 | Ga0495635_0141561 | Ga0495635_0141561_423_1574 | 312 |
| 247 | 3300046678 | Ga0495599_0011134 | Ga0495599_0011134_4287_5438 | 312 |
| 248 | 3300046678 | Ga0495599_0135584 | Ga0495599_0135584_23_970 | 312 |
| 249 | 3300046679 | Ga0495623_0000369 | Ga0495623_0000369_17864_18811 | 312 |
| 250 | 3300046680 | Ga0495646_0000366 | Ga0495646_0000366_12300_13247 | 312 |
| 251 | 3300046680 | Ga0495646_0189324 | Ga0495646_0189324_149_1096 | 312 |
| 252 | 3300046689 | Ga0495613_0019999 | Ga0495613_0019999_343_1290 | 312 |
| 253 | 3300046809 | Ga0495600_0140620 | Ga0495600_0140620_139_1086 | 312 |
| 254 | 3300047317 | Ga0495604_0000278 | Ga0495604_0000278_3724_4875 | 312 |
| 255 | 3300047317 | Ga0495604_0017137 | Ga0495604_0017137_167_1114 | 312 |
| 256 | 3300047319 | Ga0495674_0006748 | Ga0495674_0006748_8251_9402 | 312 |
| 257 | 3300047319 | Ga0495674_0009819 | Ga0495674_0009819_7585_8532 | 312 |
| 258 | 3300047319 | Ga0495674_0095636 | Ga0495674_0095636_473_1420 | 312 |
| 259 | 3300047321 | Ga0495676_0102959 | Ga0495676_0102959_827_1774 | 312 |
| 260 | 3300047322 | Ga0495680_0000274 | Ga0495680_0000274_3879_4826 | 312 |
| 261 | 3300047322 | Ga0495680_0012201 | Ga0495680_0012201_6370_7521 | 312 |
| 262 | 3300047444 | Ga0495675_0000599 | Ga0495675_0000599_16703_17854 | 312 |
| 263 | 3300047444 | Ga0495675_0002088 | Ga0495675_0002088_1834_2781 | 312 |
| 264 | 3300047444 | Ga0495675_0054012 | Ga0495675_0054012_998_1945 | 312 |
| 265 | 3300047471 | Ga0495684_0078203 | Ga0495684_0078203_50_1039 | 312 |
| 266 | 3300047673 | Ga0495593_0031615 | Ga0495593_0031615_1370_2317 | 312 |
| 267 | 3300048088 | Ga0495602_0044484 | Ga0495602_0044484_1555_2496 | 312 |
| 268 | 3300048905 | Ga0496102_0023341 | Ga0496102_0023341_3181_4125 | 312 |
| 269 | 3300048905 | Ga0496102_0029220 | Ga0496102_0029220_442_1386 | 312 |
| 270 | 3300048909 | Ga0496106_0178663 | Ga0496106_0178663_344_1288 | 312 |
| 271 | 3300048910 | Ga0496107_0108044 | Ga0496107_0108044_734_1678 | 312 |
| 272 | 3300049593 | Ga0501077_0054375 | Ga0501077_0054375_1215_2162 | 312 |
| 273 | 3300049823 | Ga0501044_0187754 | Ga0501044_0187754_52_1002 | 312 |
| 274 | 3300050493 | nmdc:mga0k408_49348_c1 | nmdc:mga0k408_49348_c1_1061_2002 | 312 |
| 275 | 3300050496 | nmdc:mga07m45_68689_c1 | nmdc:mga07m45_68689_c1_13_966 | 312 |
| 276 | 3300050511 | nmdc:mga08y16_506302_c1 | nmdc:mga08y16_506302_c1_134_1096 | 312 |
| 277 | 3300050515 | nmdc:mga0a205_99694_c1 | nmdc:mga0a205_99694_c1_1376_2320 | 312 |
| 278 | 3300053078 | Ga0495612_0000983 | Ga0495612_0000983_1639_2586 | 312 |
| 279 | 3300054114 | Ga0501084_0184319 | Ga0501084_0184319_430_1377 | 312 |
| 280 | 3300059424 | Ga0590075_006521 | Ga0590075_006521_1315_2313 | 312 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4lk3-assembly1.cif.gz_E | crystal structure of human udp-xylose synthase r236a substitution | 0.9812 | 2 | 311 |
| 4lk3-assembly1.cif.gz_D | crystal structure of human udp-xylose synthase r236a substitution | 0.979 | 2 | 311 |
| 4m55-assembly1.cif.gz_D | crystal structure of human udp-xylose synthase r236h substitution | 0.978 | 2 | 308 |
| 4lk3-assembly1.cif.gz_C | crystal structure of human udp-xylose synthase r236a substitution | 0.9769 | 2 | 311 |
| 4lk3-assembly1.cif.gz_B | crystal structure of human udp-xylose synthase r236a substitution | 0.9756 | 2 | 311 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4lk3E00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9812 | 2 | 311 | 3.40.50.720 |
| af_A0A1D6N7M5_279_504_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9807 | 90 | 310 | 3.40.50.720 |
| af_Q4E0S3_8_323_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9793 | 1 | 310 | 3.40.50.720 |
| af_A0A0R0KMW5_231_418_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9751 | 123 | 309 | 3.40.50.720 |
| af_Q4E0S3_8_323_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9701 | 1 | 310 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A535DAJ7-F1-model_v4 | UDP-glucuronate decarboxylase (EC 4.1.1.35) | 0.9929 | 136 | 308 |
GO:0005737
GO:0016020 GO:0033320 GO:0042732 GO:0048040 GO:0070403 |
| AF-A0A7R7THY1-F1-model_v4 | deleted | 0.9899 | 1 | 310 |
|
| AF-A0A502D1G3-F1-model_v4 | SDR family oxidoreductase | 0.9897 | 2 | 311 |
GO:0005737
GO:0033320 GO:0042732 GO:0048040 GO:0070403 |
| AF-A0A1V5NRR2-F1-model_v4 | UDP-glucuronate decarboxylase (EC 4.1.1.35) | 0.9897 | 188 | 308 |
GO:0005737
GO:0016020 GO:0033320 GO:0042732 GO:0048040 GO:0070403 |
| AF-A0A520Y571-F1-model_v4 | UDP-glucuronate decarboxylase (EC 4.1.1.35) | 0.989 | 2 | 312 |
GO:0005737
GO:0016020 GO:0033320 GO:0042732 GO:0048040 GO:0070403 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar