F383797

General Info

Members Datasets Scaffolds Average Seq Length
280 185 280 318

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0302740|Ga0373937_0302740_17_1168
Length 383
Sequence VKFHKIPFCEFSHLFANWNCSFWDTLCREGFSGYNELRLVDDFRLFEGISDHEENQTSGKFLQCEAGPLRAVVTGGAGFLGSHLCEYLLNQGWEVLAIDNLVTGTPANLRHFPRNVPFAIMQHDVSKFIDVPGPVDYVLHFASPASPVDYLKLPIQTLKVGSLGTHNTLGLALAKKAKYFLASTSECYGDPAVSPQPETYWGNVNTVGPRGVYDEAKRFAEAMTMAYHRAKGLDTHIVRIFNTYGPRMRLNDGRALPNFVHQALTGQPITVYGTGKQTRSFCYVSDLIEGIYRLMMSDEHEPTNVGNPYEITILEFAERVRSLMGVTTPIIFEPLPQDDPKQRCPDISKARRVLGWEPKVNLEEGLKLTLESFKKQFAETQAG

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
46 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
59 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
86 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
91 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
95 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
96 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
97 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
98 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
99 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
100 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
101 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
102 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
106 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
109 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
110 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
111 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
116 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
117 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
118 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
120 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
121 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
122 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
123 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
126 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
132 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
137 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
138 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
141 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
142 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
146 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
150 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
151 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
152 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
153 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
154 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
161 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
162 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
177 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
180 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
184 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
185 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0.71
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.07
Nodule 0
Rhizoplane 1.79
Rhizosphere 95.71
Stem 0
Stem Tuber 0
Unclassified 1.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10018483 3300003203 Bacteria 2863
2 Ga0070690_100000030 3300005330 Bacteria 65042
3 Ga0070666_10007482 3300005335 Bacteria 6731
4 Ga0070689_100036094 3300005340 Bacteria 3780
5 Ga0070673_100045844 3300005364 Bacteria 3393
6 Ga0070688_100056597 3300005365 Bacteria 2463
7 Ga0070667_100001955 3300005367 Bacteria 18296
8 Ga0070703_10038827 3300005406 Bacteria 1473
9 Ga0070709_10022722 3300005434 Bacteria 3673
10 Ga0070709_10148571 3300005434 Unclassified 1617
11 Ga0070713_100005164 3300005436 Bacteria 8888
12 Ga0070711_100119211 3300005439 Bacteria 1949
13 Ga0070705_100007116 3300005440 Bacteria 5505
14 Ga0070694_100006424 3300005444 Bacteria 7132
15 Ga0070694_100010330 3300005444 Bacteria 5757
16 Ga0070708_100000117 3300005445 Bacteria 52877
17 Ga0070708_100015558 3300005445 Bacteria 6288
18 Ga0070663_100016721 3300005455 Bacteria 4773
19 Ga0070663_100037413 3300005455 Bacteria 3378
20 Ga0068867_100002678 3300005459 Bacteria 12565
21 Ga0070706_100001122 3300005467 Bacteria 28963
22 Ga0070706_100032964 3300005467 Bacteria 4779
23 Ga0070707_100001973 3300005468 Bacteria 19626
24 Ga0070707_100006142 3300005468 Bacteria 11194
25 Ga0070698_100000039 3300005471 Bacteria 91348
26 Ga0070698_100017863 3300005471 Bacteria 7473
27 Ga0070699_100009200 3300005518 Bacteria 8566
28 Ga0070699_100252249 3300005518 Unclassified 1577
29 Ga0070699_100295353 3300005518 Bacteria 1453
30 Ga0070679_100021605 3300005530 Bacteria 6285
31 Ga0070679_100451353 3300005530 Bacteria 1230
32 Ga0070697_100002374 3300005536 Bacteria 14491
33 Ga0070697_100003296 3300005536 Bacteria 12405
34 Ga0070697_100003459 3300005536 Bacteria 12139
35 Ga0070697_100328222 3300005536 Unclassified 1319
36 Ga0070672_100011959 3300005543 Bacteria 6069
37 Ga0070672_100237268 3300005543 Bacteria 1533
38 Ga0070695_100000093 3300005545 Bacteria 38335
39 Ga0070695_100055504 3300005545 Bacteria 2553
40 Ga0070696_100077521 3300005546 Bacteria 2348
41 Ga0070693_100001159 3300005547 Bacteria 11829
42 Ga0070665_100022006 3300005548 Bacteria 6414
43 Ga0070704_100000727 3300005549 Bacteria 16101
44 Ga0070664_100081690 3300005564 Bacteria 2786
45 Ga0068856_100004024 3300005614 Bacteria 14717
46 Ga0068856_100372355 3300005614 Bacteria 1447
47 Ga0068859_100015094 3300005617 Bacteria 7755
48 Ga0068861_100171201 3300005719 Bacteria 1800
49 Ga0068863_100052872 3300005841 Bacteria 3849
50 Ga0068858_100000696 3300005842 Bacteria 35129
51 Ga0068858_100133833 3300005842 Bacteria 2325
52 Ga0068860_100004208 3300005843 Bacteria 14747
53 Ga0068860_100008389 3300005843 Bacteria 10291
54 Ga0068860_100055725 3300005843 Bacteria 3758
55 Ga0068862_100030824 3300005844 Bacteria 4521
56 Ga0081538_10002005 3300005981 Bacteria 20335
57 Ga0081539_10000210 3300005985 Bacteria 136405
58 Ga0070717_10053318 3300006028 Bacteria 3333
59 Ga0070716_100000072 3300006173 Bacteria 38870
60 Ga0070712_100342453 3300006175 Bacteria 1221
61 Ga0075370_10233604 3300006353 Bacteria 1088
62 Ga0075433_10071432 3300006852 Bacteria 3051
63 Ga0097620_100015094 3300006931 Bacteria 7755
64 Ga0099794_10004082 3300007265 Bacteria 5683
65 Ga0099794_10008857 3300007265 Bacteria 4193
66 Ga0099794_10013836 3300007265 Bacteria 3521
67 Ga0099794_10030604 3300007265 Bacteria 2515
68 Ga0099794_10034899 3300007265 Bacteria 2372
69 Ga0099794_10051481 3300007265 Bacteria 1983
70 Ga0099795_10020332 3300007788 Bacteria 2161
71 Ga0105240_10030211 3300009093 Bacteria 7046
72 Ga0105245_10002109 3300009098 Bacteria 17996
73 Ga0105242_10039905 3300009176 Bacteria 3781
74 Ga0105242_10070265 3300009176 Bacteria 2903
75 Ga0105248_10000542 3300009177 Bacteria 43053
76 Ga0105237_10000015 3300009545 Bacteria 266079
77 Ga0105237_10285872 3300009545 Bacteria 1652
78 Ga0105249_10002275 3300009553 Bacteria 16670
79 Ga0099796_10024204 3300010159 Bacteria 1904
80 Ga0157374_10001894 3300013296 Bacteria 17545
81 Ga0157378_10001056 3300013297 Bacteria 25231
82 Ga0157378_10008080 3300013297 Bacteria 9183
83 Ga0157378_10026638 3300013297 Bacteria 5096
84 Ga0163162_10009110 3300013306 Bacteria 9652
85 Ga0163162_10066864 3300013306 Bacteria 3644
86 Ga0163162_10076371 3300013306 Bacteria 3412
87 Ga0213876_10042867 3300021384 Unclassified 2391
88 Ga0228598_1001049 3300024227 Bacteria 6074
89 Ga0207653_10000535 3300025885 Bacteria 14220
90 Ga0207710_10071239 3300025900 Bacteria 1594
91 Ga0207680_10000698 3300025903 Bacteria 15773
92 Ga0207680_10049705 3300025903 Unclassified 2497
93 Ga0207684_10002584 3300025910 Bacteria 18133
94 Ga0207684_10011102 3300025910 Bacteria 7885
95 Ga0207684_10103246 3300025910 Bacteria 2437
96 Ga0207695_10000121 3300025913 Bacteria 234102
97 Ga0207695_10051063 3300025913 Bacteria 4345
98 Ga0207671_10000007 3300025914 Bacteria 825758
99 Ga0207693_10043532 3300025915 Bacteria 3532
100 Ga0207663_10082266 3300025916 Bacteria 2111
101 Ga0207660_10251912 3300025917 Bacteria 1394
102 Ga0207660_10433940 3300025917 Bacteria 1061
103 Ga0207652_10010497 3300025921 Bacteria 7455
104 Ga0207652_10110782 3300025921 Bacteria 2434
105 Ga0207646_10001587 3300025922 Bacteria 27768
106 Ga0207687_10025353 3300025927 Bacteria 3968
107 Ga0207700_10341259 3300025928 Bacteria 1302
108 Ga0207670_10024953 3300025936 Bacteria 3744
109 Ga0207704_10011218 3300025938 Bacteria 4405
110 Ga0207691_10255286 3300025940 Bacteria 1512
111 Ga0207651_10019083 3300025960 Bacteria 4099
112 Ga0207712_10100764 3300025961 Bacteria 2147
113 Ga0207640_10086219 3300025981 Bacteria 2161
114 Ga0207658_10010659 3300025986 Bacteria 6247
115 Ga0207703_10002265 3300026035 Bacteria 16817
116 Ga0207703_10601936 3300026035 Bacteria 1040
117 Ga0207678_10009963 3300026067 Bacteria 8338
118 Ga0207702_10011900 3300026078 Bacteria 7239
119 Ga0207648_10034742 3300026089 Bacteria 4443
120 Ga0207675_100067885 3300026118 Bacteria 3333
121 Ga0209588_1007055 3300027671 Bacteria 3293
122 Ga0209588_1011451 3300027671 Bacteria 2680
123 Ga0209588_1014907 3300027671 Bacteria 2386
124 Ga0265354_1000894 3300028016 Bacteria 4749
125 Ga0265357_1003611 3300028023 Bacteria 1350
126 Ga0265357_1005947 3300028023 Unclassified 1143
127 Ga0268266_10030743 3300028379 Bacteria 4561
128 Ga0268265_10016654 3300028380 Bacteria 5055
129 Ga0268264_10007228 3300028381 Bacteria 9302
130 Ga0265319_1000155 3300028563 Bacteria 51380
131 Ga0265319_1049502 3300028563 Bacteria 1391
132 Ga0265318_10000096 3300028577 Bacteria 81827
133 Ga0265318_10000123 3300028577 Bacteria 71866
134 Ga0265318_10068353 3300028577 Unclassified 1318
135 Ga0265338_10073632 3300028800 Bacteria 2910
136 Ga0265338_10087000 3300028800 Bacteria 2598
137 Ga0265770_1001558 3300030878 Bacteria 3145
138 Ga0265330_10001136 3300031235 Bacteria 15912
139 Ga0265332_10001591 3300031238 Bacteria 12440
140 Ga0265332_10026182 3300031238 Bacteria 2558
141 Ga0265328_10001651 3300031239 Bacteria 10254
142 Ga0265320_10001593 3300031240 Bacteria 16270
143 Ga0265320_10004943 3300031240 Bacteria 8646
144 Ga0265320_10031151 3300031240 Bacteria 2743
145 Ga0265325_10000768 3300031241 Bacteria 23225
146 Ga0265325_10013313 3300031241 Bacteria 4685
147 Ga0265325_10051156 3300031241 Bacteria 2125
148 Ga0265329_10000084 3300031242 Bacteria 43535
149 Ga0265329_10001887 3300031242 Bacteria 9882
150 Ga0265340_10061771 3300031247 Bacteria 1791
151 Ga0265339_10002389 3300031249 Bacteria 13476
152 Ga0265331_10000047 3300031250 Bacteria 183230
153 Ga0265331_10003352 3300031250 Bacteria 10399
154 Ga0265331_10083688 3300031250 Bacteria 1479
155 Ga0265316_10009006 3300031344 Bacteria 9206
156 Ga0265316_10046302 3300031344 Bacteria 3447
157 Ga0265316_10109479 3300031344 Bacteria 2093
158 Ga0307408_100021831 3300031548 Bacteria 4339
159 Ga0307408_100077387 3300031548 Bacteria 2477
160 Ga0265313_10007149 3300031595 Bacteria 7688
161 Ga0265313_10008632 3300031595 Bacteria 6738
162 Ga0316579_10000389 3300031691 Bacteria 13864
163 Ga0265314_10006231 3300031711 Bacteria 10591
164 Ga0265314_10065422 3300031711 Bacteria 2456
165 Ga0265314_10127069 3300031711 Bacteria 1595
166 Ga0265342_10000158 3300031712 Bacteria 76866
167 Ga0265342_10005352 3300031712 Bacteria 9811
168 Ga0316576_10001163 3300031727 Bacteria 13786
169 Ga0316576_10090080 3300031727 Unclassified 2284
170 Ga0316578_10023154 3300031728 Unclassified 3474
171 Ga0316577_10004975 3300031733 Bacteria 6930
172 Ga0307413_10103010 3300031824 Bacteria 1891
173 Ga0307410_10047285 3300031852 Bacteria 2875
174 Ga0307416_100017463 3300032002 Bacteria 5024
175 Ga0307416_100103921 3300032002 Bacteria 2482
176 Ga0307416_100300709 3300032002 Bacteria 1595
177 Ga0316583_10002275 3300032133 Bacteria 6614
178 Ga0316585_10000267 3300032137 Bacteria 11327
179 Ga0316580_10000617 3300032139 Bacteria 8358
180 Ga0316596_1026334 3300033541 Bacteria 1499
181 Ga0316212_1002653 3300033547 Bacteria 2554
182 Ga0373926_0002147 3300035083 Bacteria 6208
183 Ga0373953_0021306 3300035117 Bacteria 2430
184 Ga0373954_0007475 3300035118 Bacteria 4782
185 Ga0316574_0001135 3300035398 Bacteria 12225
186 Ga0316574_0032409 3300035398 Bacteria 3176
187 Ga0373937_0027783 3300036401 Bacteria 5119
188 Ga0373937_0124571 3300036401 Unclassified 2403
189 Ga0373937_0207690 3300036401 Bacteria 1842
190 Ga0373937_0302740 3300036401 Bacteria 1511
191 Ga0316582_0004775 3300036647 Bacteria 6906
192 Ga0316584_0001640 3300036712 Bacteria 13659
193 Ga0395905_0000396 3300037471 Bacteria 61743
194 Ga0316581_0000792 3300037588 Bacteria 6547
195 Ga0436364_0625534 3300037853 Bacteria 6784
196 Ga0436365_1550865 3300039437 Bacteria 4172
197 Ga0451577_0124459 3300042876 Bacteria 2310
198 Ga0451577_0376465 3300042876 Bacteria 1288
199 Ga0453683_0003755 3300044673 Bacteria 11081
200 Ga0453683_0068284 3300044673 Bacteria 2222
201 Ga0451576_0167909 3300045051 Bacteria 2290
202 Ga0495592_0036307 3300046454 Bacteria 3712
203 Ga0495603_0160770 3300046455 Bacteria 1303
204 Ga0495651_0000075 3300046462 Bacteria 73020
205 Ga0495651_0001555 3300046462 Bacteria 17737
206 Ga0495651_0013164 3300046462 Bacteria 6393
207 Ga0495653_0003265 3300046463 Bacteria 13013
208 Ga0495653_0046187 3300046463 Bacteria 3373
209 Ga0495580_0000901 3300046472 Bacteria 25876
210 Ga0495580_0024462 3300046472 Bacteria 4421
211 Ga0495582_0034102 3300046473 Bacteria 2798
212 Ga0495582_0166716 3300046473 Bacteria 1253
213 Ga0495664_0016525 3300046477 Bacteria 4206
214 Ga0495608_0095095 3300046511 Bacteria 1925
215 Ga0495608_0118572 3300046511 Bacteria 1698
216 Ga0495608_0129140 3300046511 Bacteria 1618
217 Ga0495618_0078450 3300046514 Bacteria 2105
218 Ga0495628_0000283 3300046516 Bacteria 45481
219 Ga0495628_0012244 3300046516 Bacteria 7232
220 Ga0495628_0053980 3300046516 Bacteria 3169
221 Ga0495630_0024549 3300046517 Bacteria 4456
222 Ga0495630_0052237 3300046517 Bacteria 3059
223 Ga0495652_0001131 3300046529 Bacteria 30078
224 Ga0495652_0004816 3300046529 Bacteria 12835
225 Ga0495665_0000672 3300046531 Bacteria 17541
226 Ga0495586_0042830 3300046535 Bacteria 2438
227 Ga0495587_0003629 3300046536 Bacteria 10271
228 Ga0495587_0113901 3300046536 Bacteria 1552
229 Ga0495667_0000317 3300046559 Bacteria 30459
230 Ga0495667_0008999 3300046559 Bacteria 6784
231 Ga0495635_0001513 3300046663 Bacteria 15559
232 Ga0495635_0141561 3300046663 Bacteria 1638
233 Ga0495599_0011134 3300046678 Bacteria 5520
234 Ga0495599_0135584 3300046678 Bacteria 1528
235 Ga0495623_0000369 3300046679 Bacteria 29555
236 Ga0495646_0000366 3300046680 Bacteria 23389
237 Ga0495646_0189324 3300046680 Bacteria 1125
238 Ga0495647_0009641 3300046681 Bacteria 3276
239 Ga0495658_0175612 3300046683 Bacteria 1327
240 Ga0495613_0019999 3300046689 Bacteria 4989
241 Ga0495613_0205635 3300046689 Unclassified 1386
242 Ga0495600_0140620 3300046809 Bacteria 1566
243 Ga0495604_0000278 3300047317 Bacteria 45825
244 Ga0495604_0017137 3300047317 Bacteria 5794
245 Ga0495674_0006748 3300047319 Bacteria 10989
246 Ga0495674_0009819 3300047319 Bacteria 9085
247 Ga0495674_0095636 3300047319 Bacteria 2532
248 Ga0495676_0102959 3300047321 Bacteria 2109
249 Ga0495680_0000274 3300047322 Bacteria 57527
250 Ga0495680_0012201 3300047322 Bacteria 7578
251 Ga0495675_0000599 3300047444 Bacteria 23250
252 Ga0495675_0002088 3300047444 Bacteria 11915
253 Ga0495675_0054012 3300047444 Bacteria 2550
254 Ga0495684_0078203 3300047471 Bacteria 2510
255 Ga0495593_0031615 3300047673 Bacteria 2890
256 Ga0495602_0044484 3300048088 Bacteria 4027
257 Ga0496102_0023341 3300048905 Bacteria 5492
258 Ga0496102_0029220 3300048905 Bacteria 4931
259 Ga0496103_0152667 3300048906 Bacteria 1480
260 Ga0496106_0178663 3300048909 Bacteria 1684
261 Ga0496107_0108044 3300048910 Bacteria 2043
262 Ga0501034_0008838 3300049571 Bacteria 10594
263 Ga0501034_0383649 3300049571 Bacteria 1330
264 Ga0501036_0134237 3300049572 Bacteria 2089
265 Ga0501042_0182583 3300049578 Bacteria 1514
266 Ga0501048_0077076 3300049582 Bacteria 2353
267 Ga0501072_0061537 3300049588 Bacteria 2961
268 Ga0501073_0016084 3300049589 Bacteria 5424
269 Ga0501076_0131216 3300049592 Bacteria 2032
270 Ga0501077_0054375 3300049593 Bacteria 2543
271 Ga0501044_0082016 3300049823 Bacteria 3264
272 Ga0501044_0187754 3300049823 Bacteria 2031
273 nmdc:mga0k408_49348_c1 3300050493 Unclassified 2436
274 nmdc:mga07m45_68689_c1 3300050496 Bacteria 2014
275 nmdc:mga08y16_506302_c1 3300050511 Bacteria 1226
276 nmdc:mga0a205_99694_c1 3300050515 Bacteria 2803
277 Ga0495612_0000983 3300053078 Bacteria 11728
278 Ga0501084_0107875 3300054114 Bacteria 2339
279 Ga0501084_0184319 3300054114 Bacteria 1762
280 Ga0590075_006521 3300059424 Bacteria 2766

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300007265 Ga0099794_10013836 Ga0099794_100138362 304
2 3300027671 Ga0209588_1007055 Ga0209588_10070552 304
3 3300007265 Ga0099794_10034899 Ga0099794_100348993 305
4 3300027671 Ga0209588_1014907 Ga0209588_10149072 305
5 3300005434 Ga0070709_10148571 Ga0070709_101485712 306
6 3300006173 Ga0070716_100000072 Ga0070716_10000007217 306
7 3300046473 Ga0495582_0034102 Ga0495582_0034102_189_1139 306
8 3300046689 Ga0495613_0205635 Ga0495613_0205635_126_1076 306
9 3300035398 Ga0316574_0032409 Ga0316574_0032409_1852_2775 307
10 3300031548 Ga0307408_100077387 Ga0307408_1000773872 308
11 3300048906 Ga0496103_0152667 Ga0496103_0152667_328_1254 308
12 3300049571 Ga0501034_0008838 Ga0501034_0008838_9392_10318 308
13 3300049571 Ga0501034_0383649 Ga0501034_0383649_338_1264 308
14 3300005468 Ga0070707_100001973 Ga0070707_10000197315 309
15 3300025913 Ga0207695_10000121 Ga0207695_1000012128 309
16 3300031250 Ga0265331_10083688 Ga0265331_100836882 309
17 3300031691 Ga0316579_10000389 Ga0316579_100003899 309
18 3300031727 Ga0316576_10001163 Ga0316576_100011637 309
19 3300031727 Ga0316576_10090080 Ga0316576_100900802 309
20 3300031728 Ga0316578_10023154 Ga0316578_100231542 309
21 3300031733 Ga0316577_10004975 Ga0316577_100049754 309
22 3300032133 Ga0316583_10002275 Ga0316583_100022752 309
23 3300032137 Ga0316585_10000267 Ga0316585_100002676 309
24 3300032139 Ga0316580_10000617 Ga0316580_100006172 309
25 3300033541 Ga0316596_1026334 Ga0316596_10263342 309
26 3300035398 Ga0316574_0001135 Ga0316574_0001135_4674_5615 309
27 3300036647 Ga0316582_0004775 Ga0316582_0004775_5115_6056 309
28 3300036712 Ga0316584_0001640 Ga0316584_0001640_6889_7830 309
29 3300037471 Ga0395905_0000396 Ga0395905_0000396_661_1590 309
30 3300037588 Ga0316581_0000792 Ga0316581_0000792_158_1099 309
31 3300044673 Ga0453683_0003755 Ga0453683_0003755_1703_2644 309
32 3300049589 Ga0501073_0016084 Ga0501073_0016084_515_1450 309
33 3300049823 Ga0501044_0082016 Ga0501044_0082016_241_1176 309
34 3300005330 Ga0070690_100000030 Ga0070690_10000003055 310
35 3300005335 Ga0070666_10007482 Ga0070666_100074824 310
36 3300005340 Ga0070689_100036094 Ga0070689_1000360944 310
37 3300005364 Ga0070673_100045844 Ga0070673_1000458445 310
38 3300005365 Ga0070688_100056597 Ga0070688_1000565972 310
39 3300005367 Ga0070667_100001955 Ga0070667_1000019553 310
40 3300005455 Ga0070663_100037413 Ga0070663_1000374135 310
41 3300005459 Ga0068867_100002678 Ga0068867_1000026783 310
42 3300005518 Ga0070699_100295353 Ga0070699_1002953531 310
43 3300005543 Ga0070672_100011959 Ga0070672_1000119594 310
44 3300005548 Ga0070665_100022006 Ga0070665_1000220065 310
45 3300005564 Ga0070664_100081690 Ga0070664_1000816902 310
46 3300005614 Ga0068856_100004024 Ga0068856_10000402412 310
47 3300005617 Ga0068859_100015094 Ga0068859_1000150947 310
48 3300005842 Ga0068858_100000696 Ga0068858_10000069620 310
49 3300005843 Ga0068860_100004208 Ga0068860_1000042082 310
50 3300006931 Ga0097620_100015094 Ga0097620_1000150943 310
51 3300009177 Ga0105248_10000542 Ga0105248_1000054231 310
52 3300025903 Ga0207680_10000698 Ga0207680_1000069814 310
53 3300025910 Ga0207684_10103246 Ga0207684_101032462 310
54 3300025936 Ga0207670_10024953 Ga0207670_100249532 310
55 3300025938 Ga0207704_10011218 Ga0207704_100112184 310
56 3300025960 Ga0207651_10019083 Ga0207651_100190835 310
57 3300025986 Ga0207658_10010659 Ga0207658_100106593 310
58 3300026035 Ga0207703_10002265 Ga0207703_1000226511 310
59 3300026067 Ga0207678_10009963 Ga0207678_100099632 310
60 3300026078 Ga0207702_10011900 Ga0207702_100119005 310
61 3300026089 Ga0207648_10034742 Ga0207648_100347425 310
62 3300028381 Ga0268264_10007228 Ga0268264_100072282 310
63 3300028563 Ga0265319_1049502 Ga0265319_10495021 310
64 3300028577 Ga0265318_10000096 Ga0265318_1000009619 310
65 3300031235 Ga0265330_10001136 Ga0265330_1000113610 310
66 3300031238 Ga0265332_10001591 Ga0265332_100015915 310
67 3300031239 Ga0265328_10001651 Ga0265328_100016514 310
68 3300031240 Ga0265320_10004943 Ga0265320_100049434 310
69 3300031242 Ga0265329_10001887 Ga0265329_100018876 310
70 3300031250 Ga0265331_10003352 Ga0265331_100033523 310
71 3300031344 Ga0265316_10009006 Ga0265316_100090064 310
72 3300031711 Ga0265314_10006231 Ga0265314_100062316 310
73 3300031712 Ga0265342_10005352 Ga0265342_100053526 310
74 3300046455 Ga0495603_0160770 Ga0495603_0160770_197_1129 310
75 3300046472 Ga0495580_0000901 Ga0495580_0000901_8204_9136 310
76 3300046473 Ga0495582_0166716 Ga0495582_0166716_109_1041 310
77 3300046681 Ga0495647_0009641 Ga0495647_0009641_686_1618 310
78 3300046683 Ga0495658_0175612 Ga0495658_0175612_210_1142 310
79 3300005530 Ga0070679_100451353 Ga0070679_1004513532 311
80 3300006028 Ga0070717_10053318 Ga0070717_100533183 311
81 3300013306 Ga0163162_10066864 Ga0163162_100668642 311
82 3300025903 Ga0207680_10049705 Ga0207680_100497052 311
83 3300025917 Ga0207660_10251912 Ga0207660_102519121 311
84 3300025921 Ga0207652_10110782 Ga0207652_101107821 311
85 3300031241 Ga0265325_10000768 Ga0265325_1000076818 311
86 3300031824 Ga0307413_10103010 Ga0307413_101030102 311
87 3300031852 Ga0307410_10047285 Ga0307410_100472853 311
88 3300032002 Ga0307416_100103921 Ga0307416_1001039212 311
89 3300035117 Ga0373953_0021306 Ga0373953_0021306_970_1917 311
90 3300036401 Ga0373937_0027783 Ga0373937_0027783_1324_2271 311
91 3300046472 Ga0495580_0024462 Ga0495580_0024462_2347_3282 311
92 3300049572 Ga0501036_0134237 Ga0501036_0134237_426_1361 311
93 3300049578 Ga0501042_0182583 Ga0501042_0182583_426_1403 311
94 3300049582 Ga0501048_0077076 Ga0501048_0077076_1122_2057 311
95 3300049588 Ga0501072_0061537 Ga0501072_0061537_1952_2887 311
96 3300049592 Ga0501076_0131216 Ga0501076_0131216_1039_1974 311
97 3300054114 Ga0501084_0107875 Ga0501084_0107875_1145_2080 311
98 3300003203 JGI25406J46586_10018483 JGI25406J46586_100184833 312
99 3300005406 Ga0070703_10038827 Ga0070703_100388272 312
100 3300005434 Ga0070709_10022722 Ga0070709_100227222 312
101 3300005436 Ga0070713_100005164 Ga0070713_1000051642 312
102 3300005439 Ga0070711_100119211 Ga0070711_1001192112 312
103 3300005440 Ga0070705_100007116 Ga0070705_1000071163 312
104 3300005444 Ga0070694_100006424 Ga0070694_1000064244 312
105 3300005444 Ga0070694_100010330 Ga0070694_1000103302 312
106 3300005445 Ga0070708_100000117 Ga0070708_10000011710 312
107 3300005445 Ga0070708_100015558 Ga0070708_1000155584 312
108 3300005455 Ga0070663_100016721 Ga0070663_1000167212 312
109 3300005467 Ga0070706_100001122 Ga0070706_1000011229 312
110 3300005467 Ga0070706_100032964 Ga0070706_1000329642 312
111 3300005468 Ga0070707_100006142 Ga0070707_1000061426 312
112 3300005471 Ga0070698_100000039 Ga0070698_10000003948 312
113 3300005471 Ga0070698_100017863 Ga0070698_1000178634 312
114 3300005518 Ga0070699_100009200 Ga0070699_1000092005 312
115 3300005518 Ga0070699_100252249 Ga0070699_1002522492 312
116 3300005530 Ga0070679_100021605 Ga0070679_1000216053 312
117 3300005536 Ga0070697_100002374 Ga0070697_1000023748 312
118 3300005536 Ga0070697_100003296 Ga0070697_1000032967 312
119 3300005536 Ga0070697_100003459 Ga0070697_1000034596 312
120 3300005536 Ga0070697_100328222 Ga0070697_1003282221 312
121 3300005543 Ga0070672_100237268 Ga0070672_1002372682 312
122 3300005545 Ga0070695_100000093 Ga0070695_10000009332 312
123 3300005545 Ga0070695_100055504 Ga0070695_1000555042 312
124 3300005546 Ga0070696_100077521 Ga0070696_1000775212 312
125 3300005547 Ga0070693_100001159 Ga0070693_10000115910 312
126 3300005549 Ga0070704_100000727 Ga0070704_10000072710 312
127 3300005614 Ga0068856_100372355 Ga0068856_1003723551 312
128 3300005719 Ga0068861_100171201 Ga0068861_1001712013 312
129 3300005841 Ga0068863_100052872 Ga0068863_1000528725 312
130 3300005842 Ga0068858_100133833 Ga0068858_1001338333 312
131 3300005843 Ga0068860_100008389 Ga0068860_1000083895 312
132 3300005843 Ga0068860_100055725 Ga0068860_1000557252 312
133 3300005844 Ga0068862_100030824 Ga0068862_1000308243 312
134 3300005981 Ga0081538_10002005 Ga0081538_100020057 312
135 3300005985 Ga0081539_10000210 Ga0081539_1000021099 312
136 3300006175 Ga0070712_100342453 Ga0070712_1003424531 312
137 3300006353 Ga0075370_10233604 Ga0075370_102336041 312
138 3300006852 Ga0075433_10071432 Ga0075433_100714323 312
139 3300007265 Ga0099794_10004082 Ga0099794_100040825 312
140 3300007265 Ga0099794_10008857 Ga0099794_100088573 312
141 3300007265 Ga0099794_10030604 Ga0099794_100306041 312
142 3300007265 Ga0099794_10051481 Ga0099794_100514812 312
143 3300007788 Ga0099795_10020332 Ga0099795_100203322 312
144 3300009093 Ga0105240_10030211 Ga0105240_100302112 312
145 3300009098 Ga0105245_10002109 Ga0105245_1000210914 312
146 3300009176 Ga0105242_10039905 Ga0105242_100399056 312
147 3300009176 Ga0105242_10070265 Ga0105242_100702652 312
148 3300009545 Ga0105237_10000015 Ga0105237_10000015175 312
149 3300009545 Ga0105237_10285872 Ga0105237_102858722 312
150 3300009553 Ga0105249_10002275 Ga0105249_100022753 312
151 3300010159 Ga0099796_10024204 Ga0099796_100242041 312
152 3300013296 Ga0157374_10001894 Ga0157374_100018947 312
153 3300013297 Ga0157378_10001056 Ga0157378_100010567 312
154 3300013297 Ga0157378_10008080 Ga0157378_100080803 312
155 3300013297 Ga0157378_10026638 Ga0157378_100266382 312
156 3300013306 Ga0163162_10009110 Ga0163162_100091109 312
157 3300013306 Ga0163162_10076371 Ga0163162_100763714 312
158 3300021384 Ga0213876_10042867 Ga0213876_100428672 312
159 3300024227 Ga0228598_1001049 Ga0228598_10010491 312
160 3300025885 Ga0207653_10000535 Ga0207653_100005355 312
161 3300025900 Ga0207710_10071239 Ga0207710_100712391 312
162 3300025910 Ga0207684_10002584 Ga0207684_1000258410 312
163 3300025910 Ga0207684_10011102 Ga0207684_100111024 312
164 3300025913 Ga0207695_10051063 Ga0207695_100510633 312
165 3300025914 Ga0207671_10000007 Ga0207671_10000007605 312
166 3300025915 Ga0207693_10043532 Ga0207693_100435322 312
167 3300025916 Ga0207663_10082266 Ga0207663_100822662 312
168 3300025917 Ga0207660_10433940 Ga0207660_104339401 312
169 3300025921 Ga0207652_10010497 Ga0207652_100104973 312
170 3300025922 Ga0207646_10001587 Ga0207646_1000158719 312
171 3300025927 Ga0207687_10025353 Ga0207687_100253533 312
172 3300025928 Ga0207700_10341259 Ga0207700_103412592 312
173 3300025940 Ga0207691_10255286 Ga0207691_102552861 312
174 3300025961 Ga0207712_10100764 Ga0207712_101007644 312
175 3300025981 Ga0207640_10086219 Ga0207640_100862192 312
176 3300026035 Ga0207703_10601936 Ga0207703_106019361 312
177 3300026118 Ga0207675_100067885 Ga0207675_1000678852 312
178 3300027671 Ga0209588_1011451 Ga0209588_10114512 312
179 3300028016 Ga0265354_1000894 Ga0265354_10008943 312
180 3300028023 Ga0265357_1003611 Ga0265357_10036112 312
181 3300028023 Ga0265357_1005947 Ga0265357_10059472 312
182 3300028379 Ga0268266_10030743 Ga0268266_100307431 312
183 3300028380 Ga0268265_10016654 Ga0268265_100166543 312
184 3300028563 Ga0265319_1000155 Ga0265319_10001555 312
185 3300028577 Ga0265318_10000123 Ga0265318_100001232 312
186 3300028577 Ga0265318_10068353 Ga0265318_100683531 312
187 3300028800 Ga0265338_10073632 Ga0265338_100736322 312
188 3300028800 Ga0265338_10087000 Ga0265338_100870002 312
189 3300030878 Ga0265770_1001558 Ga0265770_10015583 312
190 3300031238 Ga0265332_10026182 Ga0265332_100261821 312
191 3300031240 Ga0265320_10001593 Ga0265320_100015935 312
192 3300031240 Ga0265320_10031151 Ga0265320_100311512 312
193 3300031241 Ga0265325_10013313 Ga0265325_100133133 312
194 3300031241 Ga0265325_10051156 Ga0265325_100511562 312
195 3300031242 Ga0265329_10000084 Ga0265329_1000008439 312
196 3300031247 Ga0265340_10061771 Ga0265340_100617711 312
197 3300031249 Ga0265339_10002389 Ga0265339_100023893 312
198 3300031250 Ga0265331_10000047 Ga0265331_1000004777 312
199 3300031344 Ga0265316_10046302 Ga0265316_100463023 312
200 3300031344 Ga0265316_10109479 Ga0265316_101094792 312
201 3300031548 Ga0307408_100021831 Ga0307408_1000218313 312
202 3300031595 Ga0265313_10007149 Ga0265313_100071492 312
203 3300031595 Ga0265313_10008632 Ga0265313_100086324 312
204 3300031711 Ga0265314_10065422 Ga0265314_100654222 312
205 3300031711 Ga0265314_10127069 Ga0265314_101270691 312
206 3300031712 Ga0265342_10000158 Ga0265342_1000015856 312
207 3300032002 Ga0307416_100017463 Ga0307416_1000174634 312
208 3300032002 Ga0307416_100300709 Ga0307416_1003007092 312
209 3300033547 Ga0316212_1002653 Ga0316212_10026532 312
210 3300035083 Ga0373926_0002147 Ga0373926_0002147_2437_3384 312
211 3300035118 Ga0373954_0007475 Ga0373954_0007475_1631_2578 312
212 3300036401 Ga0373937_0124571 Ga0373937_0124571_1170_2117 312
213 3300036401 Ga0373937_0207690 Ga0373937_0207690_99_1046 312
214 3300036401 Ga0373937_0302740 Ga0373937_0302740_17_1168 312
215 3300037853 Ga0436364_0625534 Ga0436364_0625534_3197_4183 312
216 3300039437 Ga0436365_1550865 Ga0436365_1550865_1448_2389 312
217 3300042876 Ga0451577_0124459 Ga0451577_0124459_245_1198 312
218 3300042876 Ga0451577_0376465 Ga0451577_0376465_20_976 312
219 3300044673 Ga0453683_0068284 Ga0453683_0068284_403_1356 312
220 3300045051 Ga0451576_0167909 Ga0451576_0167909_702_1646 312
221 3300046454 Ga0495592_0036307 Ga0495592_0036307_596_1543 312
222 3300046462 Ga0495651_0000075 Ga0495651_0000075_48862_49809 312
223 3300046462 Ga0495651_0001555 Ga0495651_0001555_5890_6837 312
224 3300046462 Ga0495651_0013164 Ga0495651_0013164_1099_2250 312
225 3300046463 Ga0495653_0003265 Ga0495653_0003265_9273_10220 312
226 3300046463 Ga0495653_0046187 Ga0495653_0046187_29_1180 312
227 3300046477 Ga0495664_0016525 Ga0495664_0016525_3065_4012 312
228 3300046511 Ga0495608_0095095 Ga0495608_0095095_354_1301 312
229 3300046511 Ga0495608_0118572 Ga0495608_0118572_458_1609 312
230 3300046511 Ga0495608_0129140 Ga0495608_0129140_492_1439 312
231 3300046514 Ga0495618_0078450 Ga0495618_0078450_17_1168 312
232 3300046516 Ga0495628_0000283 Ga0495628_0000283_44247_45398 312
233 3300046516 Ga0495628_0012244 Ga0495628_0012244_3844_4791 312
234 3300046516 Ga0495628_0053980 Ga0495628_0053980_2149_3096 312
235 3300046517 Ga0495630_0024549 Ga0495630_0024549_1598_2545 312
236 3300046517 Ga0495630_0052237 Ga0495630_0052237_1370_2317 312
237 3300046529 Ga0495652_0001131 Ga0495652_0001131_28845_29996 312
238 3300046529 Ga0495652_0004816 Ga0495652_0004816_9624_10571 312
239 3300046531 Ga0495665_0000672 Ga0495665_0000672_7102_8049 312
240 3300046535 Ga0495586_0042830 Ga0495586_0042830_1282_2229 312
241 3300046536 Ga0495587_0003629 Ga0495587_0003629_29_1180 312
242 3300046536 Ga0495587_0113901 Ga0495587_0113901_212_1159 312
243 3300046559 Ga0495667_0000317 Ga0495667_0000317_7154_8101 312
244 3300046559 Ga0495667_0008999 Ga0495667_0008999_79_1230 312
245 3300046663 Ga0495635_0001513 Ga0495635_0001513_12228_13175 312
246 3300046663 Ga0495635_0141561 Ga0495635_0141561_423_1574 312
247 3300046678 Ga0495599_0011134 Ga0495599_0011134_4287_5438 312
248 3300046678 Ga0495599_0135584 Ga0495599_0135584_23_970 312
249 3300046679 Ga0495623_0000369 Ga0495623_0000369_17864_18811 312
250 3300046680 Ga0495646_0000366 Ga0495646_0000366_12300_13247 312
251 3300046680 Ga0495646_0189324 Ga0495646_0189324_149_1096 312
252 3300046689 Ga0495613_0019999 Ga0495613_0019999_343_1290 312
253 3300046809 Ga0495600_0140620 Ga0495600_0140620_139_1086 312
254 3300047317 Ga0495604_0000278 Ga0495604_0000278_3724_4875 312
255 3300047317 Ga0495604_0017137 Ga0495604_0017137_167_1114 312
256 3300047319 Ga0495674_0006748 Ga0495674_0006748_8251_9402 312
257 3300047319 Ga0495674_0009819 Ga0495674_0009819_7585_8532 312
258 3300047319 Ga0495674_0095636 Ga0495674_0095636_473_1420 312
259 3300047321 Ga0495676_0102959 Ga0495676_0102959_827_1774 312
260 3300047322 Ga0495680_0000274 Ga0495680_0000274_3879_4826 312
261 3300047322 Ga0495680_0012201 Ga0495680_0012201_6370_7521 312
262 3300047444 Ga0495675_0000599 Ga0495675_0000599_16703_17854 312
263 3300047444 Ga0495675_0002088 Ga0495675_0002088_1834_2781 312
264 3300047444 Ga0495675_0054012 Ga0495675_0054012_998_1945 312
265 3300047471 Ga0495684_0078203 Ga0495684_0078203_50_1039 312
266 3300047673 Ga0495593_0031615 Ga0495593_0031615_1370_2317 312
267 3300048088 Ga0495602_0044484 Ga0495602_0044484_1555_2496 312
268 3300048905 Ga0496102_0023341 Ga0496102_0023341_3181_4125 312
269 3300048905 Ga0496102_0029220 Ga0496102_0029220_442_1386 312
270 3300048909 Ga0496106_0178663 Ga0496106_0178663_344_1288 312
271 3300048910 Ga0496107_0108044 Ga0496107_0108044_734_1678 312
272 3300049593 Ga0501077_0054375 Ga0501077_0054375_1215_2162 312
273 3300049823 Ga0501044_0187754 Ga0501044_0187754_52_1002 312
274 3300050493 nmdc:mga0k408_49348_c1 nmdc:mga0k408_49348_c1_1061_2002 312
275 3300050496 nmdc:mga07m45_68689_c1 nmdc:mga07m45_68689_c1_13_966 312
276 3300050511 nmdc:mga08y16_506302_c1 nmdc:mga08y16_506302_c1_134_1096 312
277 3300050515 nmdc:mga0a205_99694_c1 nmdc:mga0a205_99694_c1_1376_2320 312
278 3300053078 Ga0495612_0000983 Ga0495612_0000983_1639_2586 312
279 3300054114 Ga0501084_0184319 Ga0501084_0184319_430_1377 312
280 3300059424 Ga0590075_006521 Ga0590075_006521_1315_2313 312

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

71

306

0.9

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

72

369

0.87

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

72

312

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lk3-assembly1.cif.gz_E crystal structure of human udp-xylose synthase r236a substitution 0.9812 2 311
4lk3-assembly1.cif.gz_D crystal structure of human udp-xylose synthase r236a substitution 0.979 2 311
4m55-assembly1.cif.gz_D crystal structure of human udp-xylose synthase r236h substitution 0.978 2 308
4lk3-assembly1.cif.gz_C crystal structure of human udp-xylose synthase r236a substitution 0.9769 2 311
4lk3-assembly1.cif.gz_B crystal structure of human udp-xylose synthase r236a substitution 0.9756 2 311
ID Description Score Start End Superfamily
4lk3E00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9812 2 311 3.40.50.720
af_A0A1D6N7M5_279_504_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9807 90 310 3.40.50.720
af_Q4E0S3_8_323_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9793 1 310 3.40.50.720
af_A0A0R0KMW5_231_418_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9751 123 309 3.40.50.720
af_Q4E0S3_8_323_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9701 1 310 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A535DAJ7-F1-model_v4 UDP-glucuronate decarboxylase (EC 4.1.1.35) 0.9929 136 308 GO:0005737
GO:0016020
GO:0033320
GO:0042732
GO:0048040
GO:0070403
AF-A0A7R7THY1-F1-model_v4 deleted 0.9899 1 310
AF-A0A502D1G3-F1-model_v4 SDR family oxidoreductase 0.9897 2 311 GO:0005737
GO:0033320
GO:0042732
GO:0048040
GO:0070403
AF-A0A1V5NRR2-F1-model_v4 UDP-glucuronate decarboxylase (EC 4.1.1.35) 0.9897 188 308 GO:0005737
GO:0016020
GO:0033320
GO:0042732
GO:0048040
GO:0070403
AF-A0A520Y571-F1-model_v4 UDP-glucuronate decarboxylase (EC 4.1.1.35) 0.989 2 312 GO:0005737
GO:0016020
GO:0033320
GO:0042732
GO:0048040
GO:0070403

Feature Viewer

pLDDT pTM Quality
92.49 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map