F383587
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 280 | 164 | 280 | 161 |
Family's Representative Sequence
| Representative Sequence | 3300006358|Ga0068871_100066465|Ga0068871_1000664655 |
| Length | 185 |
| Sequence | LAFTQAKTSGVVSTDEEILTVSATHTKTEDKRQLLRHTVATIAYRGGKAVTSVPDGFNFFRVNDTTRTPEQILAHIGDLFDWALSLARGKQAWNNSTPKAWDDEVARFFGALKAFDDYLASDDELGCSAEKLFQGPIADALTHVGQISMLRRMAGGPVKAENYFVAEIEAGRVGPEQSSKRYEFE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 55 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 56 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 57 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 58 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 59 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 62 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 108 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 110 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 111 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 112 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 113 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 114 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 115 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 116 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 117 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 118 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 119 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 120 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 121 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 122 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 123 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 124 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 125 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 126 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 127 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 128 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 129 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 130 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 131 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 132 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 145 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 146 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 147 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 148 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 149 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 150 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 152 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 153 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 158 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 159 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 160 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.86 |
| Metatranscriptomes | 2.14 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.07 |
| Rhizosphere | 93.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_10521846 | 2162886012 | Unclassified | 834 |
| 2 | Ga0065712_10075813 | 3300005290 | Bacteria | 3781 |
| 3 | Ga0065712_10114597 | 3300005290 | Bacteria | 1764 |
| 4 | Ga0065715_10119818 | 3300005293 | Bacteria | 2276 |
| 5 | Ga0065715_10201005 | 3300005293 | Bacteria | 1361 |
| 6 | Ga0070670_100177403 | 3300005331 | Bacteria | 1849 |
| 7 | Ga0068869_100281640 | 3300005334 | Bacteria | 1337 |
| 8 | Ga0070680_100000624 | 3300005336 | Bacteria | 24592 |
| 9 | Ga0070680_100669694 | 3300005336 | Unclassified | 892 |
| 10 | Ga0070680_100690163 | 3300005336 | Unclassified | 878 |
| 11 | Ga0068868_100114165 | 3300005338 | Bacteria | 2197 |
| 12 | Ga0070689_100851556 | 3300005340 | Unclassified | 804 |
| 13 | Ga0070668_100265749 | 3300005347 | Bacteria | 1428 |
| 14 | Ga0070671_100324632 | 3300005355 | Bacteria | 1312 |
| 15 | Ga0070671_100350589 | 3300005355 | Bacteria | 1260 |
| 16 | Ga0070674_100795925 | 3300005356 | Bacteria | 816 |
| 17 | Ga0070673_100008405 | 3300005364 | Bacteria | 6863 |
| 18 | Ga0070659_100590991 | 3300005366 | Unclassified | 953 |
| 19 | Ga0070659_100698332 | 3300005366 | Unclassified | 877 |
| 20 | Ga0070667_100219003 | 3300005367 | Bacteria | 1694 |
| 21 | Ga0070703_10003898 | 3300005406 | Bacteria | 4225 |
| 22 | Ga0070709_10069901 | 3300005434 | Bacteria | 2262 |
| 23 | Ga0070709_10244885 | 3300005434 | Unclassified | 1289 |
| 24 | Ga0070709_10310681 | 3300005434 | Bacteria | 1154 |
| 25 | Ga0070709_10465799 | 3300005434 | Unclassified | 954 |
| 26 | Ga0070709_10517011 | 3300005434 | Bacteria | 909 |
| 27 | Ga0070714_100032184 | 3300005435 | Bacteria | 4377 |
| 28 | Ga0070713_100019568 | 3300005436 | Bacteria | 5174 |
| 29 | Ga0070711_100172102 | 3300005439 | Unclassified | 1651 |
| 30 | Ga0070705_100038141 | 3300005440 | Bacteria | 2716 |
| 31 | Ga0070700_100091050 | 3300005441 | Bacteria | 1990 |
| 32 | Ga0070694_100007958 | 3300005444 | Bacteria | 6477 |
| 33 | Ga0070694_100270440 | 3300005444 | Bacteria | 1292 |
| 34 | Ga0070708_100017952 | 3300005445 | Bacteria | 5915 |
| 35 | Ga0070678_100281586 | 3300005456 | Bacteria | 1406 |
| 36 | Ga0070662_100314175 | 3300005457 | Bacteria | 1276 |
| 37 | Ga0070681_10003988 | 3300005458 | Bacteria | 13923 |
| 38 | Ga0070681_10005144 | 3300005458 | Bacteria | 12616 |
| 39 | Ga0070681_10008950 | 3300005458 | Bacteria | 9846 |
| 40 | Ga0070681_10032714 | 3300005458 | Bacteria | 5221 |
| 41 | Ga0068867_101766134 | 3300005459 | Unclassified | 581 |
| 42 | Ga0070685_10608807 | 3300005466 | Unclassified | 787 |
| 43 | Ga0070706_100001238 | 3300005467 | Bacteria | 27332 |
| 44 | Ga0070706_100029254 | 3300005467 | Bacteria | 5076 |
| 45 | Ga0070706_100049584 | 3300005467 | Bacteria | 3874 |
| 46 | Ga0070707_100949110 | 3300005468 | Bacteria | 825 |
| 47 | Ga0070707_102162026 | 3300005468 | Unclassified | 524 |
| 48 | Ga0070699_101047874 | 3300005518 | Bacteria | 748 |
| 49 | Ga0070679_100000047 | 3300005530 | Bacteria | 90654 |
| 50 | Ga0070679_101942436 | 3300005530 | Archaea | 537 |
| 51 | Ga0070697_100003428 | 3300005536 | Bacteria | 12198 |
| 52 | Ga0070697_100458645 | 3300005536 | Unclassified | 1111 |
| 53 | Ga0068853_100051481 | 3300005539 | Unclassified | 3544 |
| 54 | Ga0070672_100334247 | 3300005543 | Bacteria | 1289 |
| 55 | Ga0070672_101049058 | 3300005543 | Unclassified | 723 |
| 56 | Ga0070686_100119863 | 3300005544 | Bacteria | 1805 |
| 57 | Ga0070695_100001564 | 3300005545 | Bacteria | 12776 |
| 58 | Ga0070695_100052159 | 3300005545 | Unclassified | 2627 |
| 59 | Ga0070695_100788437 | 3300005545 | Unclassified | 760 |
| 60 | Ga0070696_100008100 | 3300005546 | Bacteria | 7024 |
| 61 | Ga0070696_100535612 | 3300005546 | Unclassified | 936 |
| 62 | Ga0070693_100000089 | 3300005547 | Bacteria | 38952 |
| 63 | Ga0070693_100203509 | 3300005547 | Bacteria | 1287 |
| 64 | Ga0068855_100163464 | 3300005563 | Bacteria | 2525 |
| 65 | Ga0070664_100241798 | 3300005564 | Bacteria | 1621 |
| 66 | Ga0070664_100243106 | 3300005564 | Bacteria | 1616 |
| 67 | Ga0068854_100330156 | 3300005578 | Bacteria | 1242 |
| 68 | Ga0068854_100502695 | 3300005578 | Bacteria | 1021 |
| 69 | Ga0068856_100059313 | 3300005614 | Bacteria | 3780 |
| 70 | Ga0068856_100182810 | 3300005614 | Bacteria | 2110 |
| 71 | Ga0070702_100858535 | 3300005615 | Unclassified | 707 |
| 72 | Ga0068859_100115183 | 3300005617 | Bacteria | 2753 |
| 73 | Ga0068859_100123694 | 3300005617 | Unclassified | 2654 |
| 74 | Ga0068859_100268752 | 3300005617 | Bacteria | 1797 |
| 75 | Ga0068859_100380103 | 3300005617 | Bacteria | 1508 |
| 76 | Ga0068859_102119599 | 3300005617 | Bacteria | 621 |
| 77 | Ga0068864_100077420 | 3300005618 | Bacteria | 2908 |
| 78 | Ga0068864_100972465 | 3300005618 | Archaea | 841 |
| 79 | Ga0068866_10019072 | 3300005718 | Unclassified | 3115 |
| 80 | Ga0068863_100305775 | 3300005841 | Bacteria | 1543 |
| 81 | Ga0068858_100071439 | 3300005842 | Bacteria | 3220 |
| 82 | Ga0068858_101339234 | 3300005842 | Archaea | 705 |
| 83 | Ga0068860_100573212 | 3300005843 | Bacteria | 1132 |
| 84 | Ga0068862_101113642 | 3300005844 | Archaea | 785 |
| 85 | Ga0068862_101675422 | 3300005844 | Bacteria | 644 |
| 86 | Ga0070717_10273541 | 3300006028 | Bacteria | 1496 |
| 87 | Ga0070716_100128320 | 3300006173 | Bacteria | 1599 |
| 88 | Ga0070716_100574222 | 3300006173 | Bacteria | 844 |
| 89 | Ga0068871_100066465 | 3300006358 | Bacteria | 2955 |
| 90 | Ga0068871_100083716 | 3300006358 | Unclassified | 2646 |
| 91 | Ga0075428_100287780 | 3300006844 | Bacteria | 1768 |
| 92 | Ga0075428_100401740 | 3300006844 | Bacteria | 1468 |
| 93 | Ga0075428_101191094 | 3300006844 | Unclassified | 803 |
| 94 | Ga0075431_101310327 | 3300006847 | Unclassified | 685 |
| 95 | Ga0075433_10065060 | 3300006852 | Bacteria | 3198 |
| 96 | Ga0075433_10087683 | 3300006852 | Bacteria | 2748 |
| 97 | Ga0075433_10140312 | 3300006852 | Unclassified | 2148 |
| 98 | Ga0075433_10373747 | 3300006852 | Bacteria | 1259 |
| 99 | Ga0075433_10438370 | 3300006852 | Bacteria | 1152 |
| 100 | Ga0075433_10903248 | 3300006852 | Unclassified | 770 |
| 101 | Ga0075434_100189547 | 3300006871 | Bacteria | 2076 |
| 102 | Ga0075429_100579634 | 3300006880 | Unclassified | 983 |
| 103 | Ga0097620_100115187 | 3300006931 | Bacteria | 2753 |
| 104 | Ga0097620_100123702 | 3300006931 | Unclassified | 2654 |
| 105 | Ga0097620_100268785 | 3300006931 | Bacteria | 1797 |
| 106 | Ga0097620_100380113 | 3300006931 | Bacteria | 1508 |
| 107 | Ga0097620_102119683 | 3300006931 | Bacteria | 621 |
| 108 | Ga0075435_100025360 | 3300007076 | Bacteria | 4615 |
| 109 | Ga0075435_100571474 | 3300007076 | Bacteria | 980 |
| 110 | Ga0075435_100648105 | 3300007076 | Bacteria | 917 |
| 111 | Ga0075435_101281665 | 3300007076 | Bacteria | 642 |
| 112 | Ga0111539_10059246 | 3300009094 | Bacteria | 4541 |
| 113 | Ga0111539_10715100 | 3300009094 | Bacteria | 1166 |
| 114 | Ga0105245_10041472 | 3300009098 | Bacteria | 4103 |
| 115 | Ga0105245_11732896 | 3300009098 | Unclassified | 677 |
| 116 | Ga0114129_10003112 | 3300009147 | Bacteria | 23271 |
| 117 | Ga0114129_10024362 | 3300009147 | Bacteria | 8575 |
| 118 | Ga0114129_10136144 | 3300009147 | Bacteria | 3370 |
| 119 | Ga0105241_10009115 | 3300009174 | Bacteria | 7303 |
| 120 | Ga0105248_10040548 | 3300009177 | Bacteria | 5220 |
| 121 | Ga0105248_10404619 | 3300009177 | Bacteria | 1537 |
| 122 | Ga0105248_11295911 | 3300009177 | Bacteria | 824 |
| 123 | Ga0105248_12286723 | 3300009177 | Bacteria | 615 |
| 124 | Ga0105237_10106226 | 3300009545 | Bacteria | 2799 |
| 125 | Ga0105249_10051419 | 3300009553 | Bacteria | 3759 |
| 126 | Ga0105249_10215666 | 3300009553 | Bacteria | 1886 |
| 127 | Ga0105239_10749385 | 3300010375 | Unclassified | 1118 |
| 128 | Ga0105239_11822018 | 3300010375 | Unclassified | 705 |
| 129 | Ga0157369_10410565 | 3300013105 | Unclassified | 1404 |
| 130 | Ga0157369_11609155 | 3300013105 | Unclassified | 660 |
| 131 | Ga0157374_10028184 | 3300013296 | Bacteria | 5071 |
| 132 | Ga0157374_10952637 | 3300013296 | Bacteria | 877 |
| 133 | Ga0157378_10039678 | 3300013297 | Unclassified | 4176 |
| 134 | Ga0157378_10231574 | 3300013297 | Unclassified | 1761 |
| 135 | Ga0157378_10396033 | 3300013297 | Bacteria | 1359 |
| 136 | Ga0163162_10070244 | 3300013306 | Unclassified | 3553 |
| 137 | Ga0163162_10383371 | 3300013306 | Bacteria | 1539 |
| 138 | Ga0163162_10595574 | 3300013306 | Bacteria | 1232 |
| 139 | Ga0157372_10027228 | 3300013307 | Bacteria | 6223 |
| 140 | Ga0157372_11761167 | 3300013307 | Unclassified | 712 |
| 141 | Ga0157375_10031904 | 3300013308 | Bacteria | 4990 |
| 142 | Ga0157375_10037836 | 3300013308 | Bacteria | 4627 |
| 143 | Ga0157375_11000467 | 3300013308 | Bacteria | 976 |
| 144 | Ga0163163_10006642 | 3300014325 | Bacteria | 10133 |
| 145 | Ga0163163_10172502 | 3300014325 | Unclassified | 2209 |
| 146 | Ga0157379_10400903 | 3300014968 | Unclassified | 1261 |
| 147 | Ga0157379_10412996 | 3300014968 | Bacteria | 1242 |
| 148 | Ga0157379_11418289 | 3300014968 | Bacteria | 674 |
| 149 | Ga0157376_10111341 | 3300014969 | Bacteria | 2410 |
| 150 | Ga0157376_10130022 | 3300014969 | Unclassified | 2245 |
| 151 | Ga0157376_10597776 | 3300014969 | Unclassified | 1098 |
| 152 | Ga0207653_10003848 | 3300025885 | Bacteria | 4726 |
| 153 | Ga0207699_10059936 | 3300025906 | Bacteria | 2283 |
| 154 | Ga0207699_10474098 | 3300025906 | Unclassified | 901 |
| 155 | Ga0207643_10148970 | 3300025908 | Bacteria | 1402 |
| 156 | Ga0207684_10013817 | 3300025910 | Bacteria | 6973 |
| 157 | Ga0207684_10020181 | 3300025910 | Bacteria | 5691 |
| 158 | Ga0207684_10070350 | 3300025910 | Bacteria | 2974 |
| 159 | Ga0207707_10000006 | 3300025912 | Bacteria | 374131 |
| 160 | Ga0207707_10100681 | 3300025912 | Bacteria | 2525 |
| 161 | Ga0207707_10175161 | 3300025912 | Bacteria | 1874 |
| 162 | Ga0207707_10456919 | 3300025912 | Unclassified | 1092 |
| 163 | Ga0207671_10046223 | 3300025914 | Bacteria | 3220 |
| 164 | Ga0207663_10159151 | 3300025916 | Bacteria | 1592 |
| 165 | Ga0207663_10183724 | 3300025916 | Bacteria | 1495 |
| 166 | Ga0207663_10584175 | 3300025916 | Unclassified | 876 |
| 167 | Ga0207660_10009129 | 3300025917 | Bacteria | 6421 |
| 168 | Ga0207652_10009231 | 3300025921 | Bacteria | 7934 |
| 169 | Ga0207681_10939965 | 3300025923 | Bacteria | 725 |
| 170 | Ga0207659_10519551 | 3300025926 | Bacteria | 1009 |
| 171 | Ga0207700_10096882 | 3300025928 | Unclassified | 2343 |
| 172 | Ga0207644_10896907 | 3300025931 | Bacteria | 743 |
| 173 | Ga0207706_10521481 | 3300025933 | Bacteria | 1024 |
| 174 | Ga0207709_11323054 | 3300025935 | Unclassified | 596 |
| 175 | Ga0207691_10402810 | 3300025940 | Unclassified | 1167 |
| 176 | Ga0207689_10206588 | 3300025942 | Bacteria | 1622 |
| 177 | Ga0207661_10630697 | 3300025944 | Bacteria | 985 |
| 178 | Ga0207679_10421130 | 3300025945 | Bacteria | 1179 |
| 179 | Ga0207667_10132560 | 3300025949 | Bacteria | 2567 |
| 180 | Ga0207651_10049517 | 3300025960 | Bacteria | 2847 |
| 181 | Ga0207651_10754638 | 3300025960 | Unclassified | 860 |
| 182 | Ga0207712_10545548 | 3300025961 | Bacteria | 997 |
| 183 | Ga0207703_10163610 | 3300026035 | Unclassified | 1951 |
| 184 | Ga0207703_10415683 | 3300026035 | Bacteria | 1250 |
| 185 | Ga0207703_10899198 | 3300026035 | Archaea | 848 |
| 186 | Ga0207639_10238921 | 3300026041 | Unclassified | 1578 |
| 187 | Ga0207702_10045577 | 3300026078 | Bacteria | 3688 |
| 188 | Ga0207641_10514271 | 3300026088 | Bacteria | 1164 |
| 189 | Ga0207641_11331530 | 3300026088 | Unclassified | 719 |
| 190 | Ga0207648_10090127 | 3300026089 | Bacteria | 2679 |
| 191 | Ga0207648_10605245 | 3300026089 | Bacteria | 1010 |
| 192 | Ga0207676_10006361 | 3300026095 | Bacteria | 8345 |
| 193 | Ga0207676_10596746 | 3300026095 | Unclassified | 1060 |
| 194 | Ga0207676_11616034 | 3300026095 | Unclassified | 646 |
| 195 | Ga0265354_1000389 | 3300028016 | Bacteria | 7711 |
| 196 | Ga0268265_10543557 | 3300028380 | Bacteria | 1102 |
| 197 | Ga0265770_1000783 | 3300030878 | Bacteria | 4437 |
| 198 | Ga0265770_1001509 | 3300030878 | Unclassified | 3190 |
| 199 | Ga0265765_1000392 | 3300030879 | Bacteria | 3341 |
| 200 | Ga0265765_1006108 | 3300030879 | Unclassified | 1276 |
| 201 | Ga0265760_10003521 | 3300031090 | Bacteria | 4542 |
| 202 | Ga0265760_10003802 | 3300031090 | Bacteria | 4375 |
| 203 | Ga0265316_10505744 | 3300031344 | Unclassified | 863 |
| 204 | Ga0307415_100843080 | 3300032126 | Bacteria | 840 |
| 205 | Ga0307415_101112852 | 3300032126 | Bacteria | 740 |
| 206 | Ga0316212_1000583 | 3300033547 | Bacteria | 4546 |
| 207 | Ga0373945_0109792 | 3300035116 | Bacteria | 1087 |
| 208 | Ga0373954_0013909 | 3300035118 | Bacteria | 3587 |
| 209 | Ga0373954_0047945 | 3300035118 | Bacteria | 2001 |
| 210 | Ga0373956_0188594 | 3300035119 | Unclassified | 976 |
| 211 | Ga0373957_0256570 | 3300035120 | Bacteria | 736 |
| 212 | Ga0373946_0087212 | 3300035171 | Unclassified | 1377 |
| 213 | Ga0373924_0482009 | 3300035410 | Unclassified | 557 |
| 214 | Ga0373931_0090917 | 3300035691 | Bacteria | 1700 |
| 215 | Ga0373933_0095944 | 3300035724 | Unclassified | 1835 |
| 216 | Ga0373947_0125916 | 3300035725 | Bacteria | 1631 |
| 217 | Ga0373947_0223221 | 3300035725 | Bacteria | 1239 |
| 218 | Ga0373937_0060366 | 3300036401 | Bacteria | 3485 |
| 219 | Ga0373937_0115469 | 3300036401 | Bacteria | 2499 |
| 220 | Ga0373937_0140434 | 3300036401 | Unclassified | 2260 |
| 221 | Ga0373937_0167436 | 3300036401 | Bacteria | 2061 |
| 222 | Ga0373937_0414330 | 3300036401 | Unclassified | 1278 |
| 223 | Ga0373925_0157556 | 3300037068 | Bacteria | 1787 |
| 224 | Ga0373925_0743168 | 3300037068 | Unclassified | 809 |
| 225 | Ga0395905_0214731 | 3300037471 | Bacteria | 1802 |
| 226 | Ga0395905_0739885 | 3300037471 | Bacteria | 886 |
| 227 | Ga0242419_010570 | 3300038698 | Unclassified | 707 |
| 228 | Ga0451577_0029436 | 3300042876 | Bacteria | 4964 |
| 229 | Ga0453683_0356438 | 3300044673 | Unclassified | 940 |
| 230 | Ga0453684_0190446 | 3300044712 | Bacteria | 2400 |
| 231 | Ga0451576_0230652 | 3300045051 | Bacteria | 1934 |
| 232 | Ga0495580_0100604 | 3300046472 | Unclassified | 2011 |
| 233 | Ga0495582_0257646 | 3300046473 | Bacteria | 1001 |
| 234 | Ga0495582_0398430 | 3300046473 | Unclassified | 794 |
| 235 | Ga0495582_0528674 | 3300046473 | Bacteria | 682 |
| 236 | Ga0495628_0464140 | 3300046516 | Bacteria | 918 |
| 237 | Ga0495630_0594926 | 3300046517 | Unclassified | 848 |
| 238 | Ga0495586_0383227 | 3300046535 | Bacteria | 809 |
| 239 | Ga0495598_0038029 | 3300046537 | Bacteria | 1391 |
| 240 | Ga0495667_0860587 | 3300046559 | Unclassified | 557 |
| 241 | Ga0495659_0074348 | 3300046664 | Bacteria | 1278 |
| 242 | Ga0495646_0221243 | 3300046680 | Bacteria | 1024 |
| 243 | Ga0495604_0730638 | 3300047317 | Unclassified | 627 |
| 244 | Ga0495674_0618522 | 3300047319 | Bacteria | 857 |
| 245 | Ga0495602_0423354 | 3300048088 | Unclassified | 945 |
| 246 | Ga0496101_0073139 | 3300048904 | Bacteria | 2518 |
| 247 | Ga0496102_0045891 | 3300048905 | Bacteria | 3967 |
| 248 | Ga0496102_0070807 | 3300048905 | Unclassified | 3202 |
| 249 | Ga0496103_0004416 | 3300048906 | Bacteria | 8531 |
| 250 | Ga0496104_0070224 | 3300048907 | Bacteria | 3329 |
| 251 | Ga0496104_0786457 | 3300048907 | Unclassified | 858 |
| 252 | Ga0496104_1002831 | 3300048907 | Bacteria | 739 |
| 253 | Ga0496105_0093446 | 3300048908 | Unclassified | 2484 |
| 254 | Ga0496105_0491741 | 3300048908 | Bacteria | 964 |
| 255 | Ga0496106_0147698 | 3300048909 | Unclassified | 1853 |
| 256 | Ga0496108_0213128 | 3300048911 | Unclassified | 1677 |
| 257 | Ga0496108_0288401 | 3300048911 | Bacteria | 1429 |
| 258 | Ga0496108_0650438 | 3300048911 | Bacteria | 916 |
| 259 | Ga0496110_0041110 | 3300048913 | Bacteria | 4033 |
| 260 | Ga0496112_0062674 | 3300048915 | Unclassified | 3668 |
| 261 | Ga0496112_0249435 | 3300048915 | Bacteria | 1727 |
| 262 | Ga0496112_0346298 | 3300048915 | Unclassified | 1429 |
| 263 | Ga0501077_0131633 | 3300049593 | Bacteria | 1586 |
| 264 | Ga0501080_1138867 | 3300049742 | Unclassified | 672 |
| 265 | nmdc:mga05p37_4227_c1 | 3300050507 | Bacteria | 16779 |
| 266 | nmdc:mga05p37_554120_c1 | 3300050507 | Bacteria | 1308 |
| 267 | nmdc:mga05p37_9155_c1 | 3300050507 | Bacteria | 11705 |
| 268 | nmdc:mga08y16_610096_c1 | 3300050511 | Bacteria | 1099 |
| 269 | nmdc:mga0n895_137217_c1 | 3300050512 | Bacteria | 2473 |
| 270 | nmdc:mga0rr50_1046964_c1 | 3300050513 | Bacteria | 695 |
| 271 | nmdc:mga0rr50_623142_c1 | 3300050513 | Bacteria | 920 |
| 272 | nmdc:mga0a205_1172851_c1 | 3300050515 | Unclassified | 616 |
| 273 | nmdc:mga0a205_1184812_c1 | 3300050515 | Unclassified | 612 |
| 274 | nmdc:mga0a205_238042_c1 | 3300050515 | Bacteria | 1702 |
| 275 | Ga0495601_0127597 | 3300053077 | Bacteria | 1655 |
| 276 | Ga0495595_0119419 | 3300053084 | Unclassified | 1283 |
| 277 | Ga0495619_0038177 | 3300053085 | Unclassified | 3132 |
| 278 | Ga0495619_0815386 | 3300053085 | Unclassified | 631 |
| 279 | Ga0501084_1100855 | 3300054114 | Unclassified | 667 |
| 280 | Ga0501082_0578935 | 3300060353 | Unclassified | 982 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013307 | Ga0157372_11761167 | Ga0157372_117611671 | 149 |
| 2 | 3300037068 | Ga0373925_0157556 | Ga0373925_0157556_1123_1578 | 151 |
| 3 | 3300046473 | Ga0495582_0257646 | Ga0495582_0257646_113_568 | 151 |
| 4 | 3300042876 | Ga0451577_0029436 | Ga0451577_0029436_1242_1700 | 152 |
| 5 | 3300044712 | Ga0453684_0190446 | Ga0453684_0190446_613_1071 | 152 |
| 6 | 3300025944 | Ga0207661_10630697 | Ga0207661_106306971 | 154 |
| 7 | 3300009177 | Ga0105248_10404619 | Ga0105248_104046192 | 155 |
| 8 | 3300046537 | Ga0495598_0038029 | Ga0495598_0038029_745_1215 | 156 |
| 9 | 3300005290 | Ga0065712_10075813 | Ga0065712_100758133 | 157 |
| 10 | 3300005293 | Ga0065715_10201005 | Ga0065715_102010052 | 157 |
| 11 | 3300005366 | Ga0070659_100590991 | Ga0070659_1005909911 | 157 |
| 12 | 3300005458 | Ga0070681_10003988 | Ga0070681_100039886 | 157 |
| 13 | 3300005530 | Ga0070679_101942436 | Ga0070679_1019424361 | 157 |
| 14 | 3300005536 | Ga0070697_100458645 | Ga0070697_1004586452 | 157 |
| 15 | 3300005544 | Ga0070686_100119863 | Ga0070686_1001198632 | 157 |
| 16 | 3300005546 | Ga0070696_100535612 | Ga0070696_1005356121 | 157 |
| 17 | 3300005563 | Ga0068855_100163464 | Ga0068855_1001634642 | 157 |
| 18 | 3300005618 | Ga0068864_100972465 | Ga0068864_1009724651 | 157 |
| 19 | 3300005843 | Ga0068860_100573212 | Ga0068860_1005732122 | 157 |
| 20 | 3300006844 | Ga0075428_100287780 | Ga0075428_1002877802 | 157 |
| 21 | 3300006844 | Ga0075428_101191094 | Ga0075428_1011910942 | 157 |
| 22 | 3300006847 | Ga0075431_101310327 | Ga0075431_1013103272 | 157 |
| 23 | 3300009147 | Ga0114129_10024362 | Ga0114129_100243626 | 157 |
| 24 | 3300009177 | Ga0105248_12286723 | Ga0105248_122867231 | 157 |
| 25 | 3300009553 | Ga0105249_10215666 | Ga0105249_102156663 | 157 |
| 26 | 3300010375 | Ga0105239_10749385 | Ga0105239_107493852 | 157 |
| 27 | 3300010375 | Ga0105239_11822018 | Ga0105239_118220181 | 157 |
| 28 | 3300013105 | Ga0157369_10410565 | Ga0157369_104105652 | 157 |
| 29 | 3300013296 | Ga0157374_10952637 | Ga0157374_109526372 | 157 |
| 30 | 3300013308 | Ga0157375_11000467 | Ga0157375_110004672 | 157 |
| 31 | 3300014968 | Ga0157379_10412996 | Ga0157379_104129962 | 157 |
| 32 | 3300025912 | Ga0207707_10456919 | Ga0207707_104569192 | 157 |
| 33 | 3300025916 | Ga0207663_10183724 | Ga0207663_101837242 | 157 |
| 34 | 3300025931 | Ga0207644_10896907 | Ga0207644_108969072 | 157 |
| 35 | 3300025949 | Ga0207667_10132560 | Ga0207667_101325602 | 157 |
| 36 | 3300026095 | Ga0207676_10006361 | Ga0207676_100063614 | 157 |
| 37 | 3300035116 | Ga0373945_0109792 | Ga0373945_0109792_346_819 | 157 |
| 38 | 3300035120 | Ga0373957_0256570 | Ga0373957_0256570_138_611 | 157 |
| 39 | 3300035171 | Ga0373946_0087212 | Ga0373946_0087212_128_601 | 157 |
| 40 | 3300035410 | Ga0373924_0482009 | Ga0373924_0482009_21_494 | 157 |
| 41 | 3300035725 | Ga0373947_0125916 | Ga0373947_0125916_371_844 | 157 |
| 42 | 3300036401 | Ga0373937_0060366 | Ga0373937_0060366_1397_1870 | 157 |
| 43 | 3300036401 | Ga0373937_0414330 | Ga0373937_0414330_437_910 | 157 |
| 44 | 3300046473 | Ga0495582_0528674 | Ga0495582_0528674_65_538 | 157 |
| 45 | 3300046516 | Ga0495628_0464140 | Ga0495628_0464140_341_814 | 157 |
| 46 | 3300046517 | Ga0495630_0594926 | Ga0495630_0594926_272_745 | 157 |
| 47 | 3300046535 | Ga0495586_0383227 | Ga0495586_0383227_239_712 | 157 |
| 48 | 3300046664 | Ga0495659_0074348 | Ga0495659_0074348_542_1015 | 157 |
| 49 | 3300046680 | Ga0495646_0221243 | Ga0495646_0221243_93_566 | 157 |
| 50 | 3300047317 | Ga0495604_0730638 | Ga0495604_0730638_15_488 | 157 |
| 51 | 3300047319 | Ga0495674_0618522 | Ga0495674_0618522_166_639 | 157 |
| 52 | 3300048088 | Ga0495602_0423354 | Ga0495602_0423354_307_780 | 157 |
| 53 | 3300048907 | Ga0496104_1002831 | Ga0496104_1002831_193_666 | 157 |
| 54 | 3300048908 | Ga0496105_0093446 | Ga0496105_0093446_54_527 | 157 |
| 55 | 3300048911 | Ga0496108_0288401 | Ga0496108_0288401_77_550 | 157 |
| 56 | 3300048911 | Ga0496108_0650438 | Ga0496108_0650438_429_902 | 157 |
| 57 | 3300048913 | Ga0496110_0041110 | Ga0496110_0041110_115_588 | 157 |
| 58 | 3300048915 | Ga0496112_0062674 | Ga0496112_0062674_1621_2094 | 157 |
| 59 | 3300048915 | Ga0496112_0346298 | Ga0496112_0346298_477_950 | 157 |
| 60 | 3300050507 | nmdc:mga05p37_9155_c1 | nmdc:mga05p37_9155_c1_7199_7672 | 157 |
| 61 | 3300053077 | Ga0495601_0127597 | Ga0495601_0127597_1037_1510 | 157 |
| 62 | 3300053084 | Ga0495595_0119419 | Ga0495595_0119419_523_996 | 157 |
| 63 | 3300053085 | Ga0495619_0038177 | Ga0495619_0038177_1428_1901 | 157 |
| 64 | 3300053085 | Ga0495619_0815386 | Ga0495619_0815386_104_577 | 157 |
| 65 | 3300005364 | Ga0070673_100008405 | Ga0070673_1000084055 | 158 |
| 66 | 3300005617 | Ga0068859_100115183 | Ga0068859_1001151832 | 158 |
| 67 | 3300005617 | Ga0068859_100268752 | Ga0068859_1002687521 | 158 |
| 68 | 3300005844 | Ga0068862_101113642 | Ga0068862_1011136422 | 158 |
| 69 | 3300006844 | Ga0075428_100401740 | Ga0075428_1004017402 | 158 |
| 70 | 3300006852 | Ga0075433_10140312 | Ga0075433_101403122 | 158 |
| 71 | 3300006931 | Ga0097620_100115187 | Ga0097620_1001151872 | 158 |
| 72 | 3300006931 | Ga0097620_100268785 | Ga0097620_1002687851 | 158 |
| 73 | 3300009094 | Ga0111539_10715100 | Ga0111539_107151002 | 158 |
| 74 | 3300009147 | Ga0114129_10003112 | Ga0114129_1000311210 | 158 |
| 75 | 3300014325 | Ga0163163_10172502 | Ga0163163_101725022 | 158 |
| 76 | 3300014968 | Ga0157379_10400903 | Ga0157379_104009031 | 158 |
| 77 | 3300025960 | Ga0207651_10049517 | Ga0207651_100495172 | 158 |
| 78 | 3300026035 | Ga0207703_10163610 | Ga0207703_101636102 | 158 |
| 79 | 3300026035 | Ga0207703_10899198 | Ga0207703_108991981 | 158 |
| 80 | 3300026089 | Ga0207648_10090127 | Ga0207648_100901273 | 158 |
| 81 | 3300035691 | Ga0373931_0090917 | Ga0373931_0090917_822_1298 | 158 |
| 82 | 3300049593 | Ga0501077_0131633 | Ga0501077_0131633_346_822 | 158 |
| 83 | 3300049742 | Ga0501080_1138867 | Ga0501080_1138867_35_511 | 158 |
| 84 | 3300050507 | nmdc:mga05p37_4227_c1 | nmdc:mga05p37_4227_c1_7341_7817 | 158 |
| 85 | 3300050511 | nmdc:mga08y16_610096_c1 | nmdc:mga08y16_610096_c1_423_899 | 158 |
| 86 | 3300054114 | Ga0501084_1100855 | Ga0501084_1100855_91_567 | 158 |
| 87 | 3300005336 | Ga0070680_100669694 | Ga0070680_1006696942 | 159 |
| 88 | 3300005458 | Ga0070681_10008950 | Ga0070681_100089507 | 159 |
| 89 | 3300005458 | Ga0070681_10032714 | Ga0070681_100327144 | 159 |
| 90 | 3300005543 | Ga0070672_101049058 | Ga0070672_1010490582 | 159 |
| 91 | 3300009094 | Ga0111539_10059246 | Ga0111539_100592463 | 159 |
| 92 | 3300009098 | Ga0105245_10041472 | Ga0105245_100414725 | 159 |
| 93 | 3300009177 | Ga0105248_11295911 | Ga0105248_112959112 | 159 |
| 94 | 3300013297 | Ga0157378_10396033 | Ga0157378_103960332 | 159 |
| 95 | 3300013306 | Ga0163162_10383371 | Ga0163162_103833712 | 159 |
| 96 | 3300013308 | Ga0157375_10031904 | Ga0157375_100319045 | 159 |
| 97 | 3300014969 | Ga0157376_10597776 | Ga0157376_105977762 | 159 |
| 98 | 3300025912 | Ga0207707_10100681 | Ga0207707_101006813 | 159 |
| 99 | 3300025923 | Ga0207681_10939965 | Ga0207681_109399651 | 159 |
| 100 | 3300026089 | Ga0207648_10605245 | Ga0207648_106052452 | 159 |
| 101 | 3300028380 | Ga0268265_10543557 | Ga0268265_105435572 | 159 |
| 102 | 3300035725 | Ga0373947_0223221 | Ga0373947_0223221_30_509 | 159 |
| 103 | 3300037471 | Ga0395905_0214731 | Ga0395905_0214731_1255_1734 | 159 |
| 104 | 3300048915 | Ga0496112_0249435 | Ga0496112_0249435_156_635 | 159 |
| 105 | 3300005331 | Ga0070670_100177403 | Ga0070670_1001774032 | 160 |
| 106 | 3300005340 | Ga0070689_100851556 | Ga0070689_1008515562 | 160 |
| 107 | 3300005347 | Ga0070668_100265749 | Ga0070668_1002657492 | 160 |
| 108 | 3300005441 | Ga0070700_100091050 | Ga0070700_1000910502 | 160 |
| 109 | 3300005457 | Ga0070662_100314175 | Ga0070662_1003141752 | 160 |
| 110 | 3300005543 | Ga0070672_100334247 | Ga0070672_1003342472 | 160 |
| 111 | 3300005564 | Ga0070664_100243106 | Ga0070664_1002431061 | 160 |
| 112 | 3300005617 | Ga0068859_100380103 | Ga0068859_1003801032 | 160 |
| 113 | 3300006852 | Ga0075433_10087683 | Ga0075433_100876832 | 160 |
| 114 | 3300006880 | Ga0075429_100579634 | Ga0075429_1005796342 | 160 |
| 115 | 3300006931 | Ga0097620_100380113 | Ga0097620_1003801132 | 160 |
| 116 | 3300007076 | Ga0075435_100025360 | Ga0075435_1000253603 | 160 |
| 117 | 3300025933 | Ga0207706_10521481 | Ga0207706_105214812 | 160 |
| 118 | 3300025940 | Ga0207691_10402810 | Ga0207691_104028102 | 160 |
| 119 | 3300026095 | Ga0207676_11616034 | Ga0207676_116160342 | 160 |
| 120 | 3300031344 | Ga0265316_10505744 | Ga0265316_105057442 | 160 |
| 121 | 3300032126 | Ga0307415_101112852 | Ga0307415_1011128521 | 160 |
| 122 | 3300060353 | Ga0501082_0578935 | Ga0501082_0578935_354_836 | 160 |
| 123 | 3300005467 | Ga0070706_100029254 | Ga0070706_1000292544 | 161 |
| 124 | 3300005467 | Ga0070706_100049584 | Ga0070706_1000495842 | 161 |
| 125 | 3300005617 | Ga0068859_102119599 | Ga0068859_1021195991 | 161 |
| 126 | 3300006931 | Ga0097620_102119683 | Ga0097620_1021196831 | 161 |
| 127 | 3300007076 | Ga0075435_100648105 | Ga0075435_1006481051 | 161 |
| 128 | 3300025910 | Ga0207684_10020181 | Ga0207684_100201814 | 161 |
| 129 | 3300025910 | Ga0207684_10070350 | Ga0207684_100703503 | 161 |
| 130 | 3300044673 | Ga0453683_0356438 | Ga0453683_0356438_311_796 | 161 |
| 131 | 3300050513 | nmdc:mga0rr50_1046964_c1 | nmdc:mga0rr50_1046964_c1_117_602 | 161 |
| 132 | 3300005336 | Ga0070680_100000624 | Ga0070680_1000006248 | 162 |
| 133 | 3300005336 | Ga0070680_100690163 | Ga0070680_1006901632 | 162 |
| 134 | 3300005356 | Ga0070674_100795925 | Ga0070674_1007959252 | 162 |
| 135 | 3300005366 | Ga0070659_100698332 | Ga0070659_1006983321 | 162 |
| 136 | 3300005406 | Ga0070703_10003898 | Ga0070703_100038982 | 162 |
| 137 | 3300005434 | Ga0070709_10069901 | Ga0070709_100699012 | 162 |
| 138 | 3300005434 | Ga0070709_10244885 | Ga0070709_102448852 | 162 |
| 139 | 3300005434 | Ga0070709_10465799 | Ga0070709_104657991 | 162 |
| 140 | 3300005434 | Ga0070709_10517011 | Ga0070709_105170112 | 162 |
| 141 | 3300005435 | Ga0070714_100032184 | Ga0070714_1000321842 | 162 |
| 142 | 3300005436 | Ga0070713_100019568 | Ga0070713_1000195682 | 162 |
| 143 | 3300005439 | Ga0070711_100172102 | Ga0070711_1001721021 | 162 |
| 144 | 3300005440 | Ga0070705_100038141 | Ga0070705_1000381412 | 162 |
| 145 | 3300005444 | Ga0070694_100007958 | Ga0070694_1000079585 | 162 |
| 146 | 3300005444 | Ga0070694_100270440 | Ga0070694_1002704401 | 162 |
| 147 | 3300005445 | Ga0070708_100017952 | Ga0070708_1000179524 | 162 |
| 148 | 3300005458 | Ga0070681_10005144 | Ga0070681_100051449 | 162 |
| 149 | 3300005467 | Ga0070706_100001238 | Ga0070706_1000012384 | 162 |
| 150 | 3300005468 | Ga0070707_100949110 | Ga0070707_1009491102 | 162 |
| 151 | 3300005468 | Ga0070707_102162026 | Ga0070707_1021620261 | 162 |
| 152 | 3300005518 | Ga0070699_101047874 | Ga0070699_1010478742 | 162 |
| 153 | 3300005530 | Ga0070679_100000047 | Ga0070679_1000000479 | 162 |
| 154 | 3300005536 | Ga0070697_100003428 | Ga0070697_10000342811 | 162 |
| 155 | 3300005539 | Ga0068853_100051481 | Ga0068853_1000514812 | 162 |
| 156 | 3300005545 | Ga0070695_100001564 | Ga0070695_1000015642 | 162 |
| 157 | 3300005545 | Ga0070695_100052159 | Ga0070695_1000521591 | 162 |
| 158 | 3300005545 | Ga0070695_100788437 | Ga0070695_1007884371 | 162 |
| 159 | 3300005546 | Ga0070696_100008100 | Ga0070696_1000081003 | 162 |
| 160 | 3300005547 | Ga0070693_100000089 | Ga0070693_10000008915 | 162 |
| 161 | 3300005578 | Ga0068854_100502695 | Ga0068854_1005026951 | 162 |
| 162 | 3300005614 | Ga0068856_100059313 | Ga0068856_1000593133 | 162 |
| 163 | 3300005614 | Ga0068856_100182810 | Ga0068856_1001828101 | 162 |
| 164 | 3300005844 | Ga0068862_101675422 | Ga0068862_1016754221 | 162 |
| 165 | 3300006173 | Ga0070716_100128320 | Ga0070716_1001283202 | 162 |
| 166 | 3300006852 | Ga0075433_10065060 | Ga0075433_100650605 | 162 |
| 167 | 3300006852 | Ga0075433_10373747 | Ga0075433_103737471 | 162 |
| 168 | 3300006852 | Ga0075433_10438370 | Ga0075433_104383701 | 162 |
| 169 | 3300006871 | Ga0075434_100189547 | Ga0075434_1001895473 | 162 |
| 170 | 3300007076 | Ga0075435_100571474 | Ga0075435_1005714741 | 162 |
| 171 | 3300007076 | Ga0075435_101281665 | Ga0075435_1012816651 | 162 |
| 172 | 3300009098 | Ga0105245_11732896 | Ga0105245_117328961 | 162 |
| 173 | 3300009147 | Ga0114129_10136144 | Ga0114129_101361443 | 162 |
| 174 | 3300009174 | Ga0105241_10009115 | Ga0105241_100091155 | 162 |
| 175 | 3300009545 | Ga0105237_10106226 | Ga0105237_101062262 | 162 |
| 176 | 3300009553 | Ga0105249_10051419 | Ga0105249_100514192 | 162 |
| 177 | 3300013297 | Ga0157378_10231574 | Ga0157378_102315741 | 162 |
| 178 | 3300013306 | Ga0163162_10595574 | Ga0163162_105955743 | 162 |
| 179 | 3300013307 | Ga0157372_10027228 | Ga0157372_100272281 | 162 |
| 180 | 3300014968 | Ga0157379_11418289 | Ga0157379_114182891 | 162 |
| 181 | 3300025885 | Ga0207653_10003848 | Ga0207653_100038484 | 162 |
| 182 | 3300025906 | Ga0207699_10059936 | Ga0207699_100599362 | 162 |
| 183 | 3300025906 | Ga0207699_10474098 | Ga0207699_104740981 | 162 |
| 184 | 3300025910 | Ga0207684_10013817 | Ga0207684_100138175 | 162 |
| 185 | 3300025912 | Ga0207707_10000006 | Ga0207707_10000006304 | 162 |
| 186 | 3300025912 | Ga0207707_10175161 | Ga0207707_101751613 | 162 |
| 187 | 3300025914 | Ga0207671_10046223 | Ga0207671_100462232 | 162 |
| 188 | 3300025916 | Ga0207663_10159151 | Ga0207663_101591512 | 162 |
| 189 | 3300025917 | Ga0207660_10009129 | Ga0207660_100091291 | 162 |
| 190 | 3300025921 | Ga0207652_10009231 | Ga0207652_100092319 | 162 |
| 191 | 3300025928 | Ga0207700_10096882 | Ga0207700_100968822 | 162 |
| 192 | 3300025935 | Ga0207709_11323054 | Ga0207709_113230541 | 162 |
| 193 | 3300025961 | Ga0207712_10545548 | Ga0207712_105455482 | 162 |
| 194 | 3300026041 | Ga0207639_10238921 | Ga0207639_102389213 | 162 |
| 195 | 3300026078 | Ga0207702_10045577 | Ga0207702_100455774 | 162 |
| 196 | 3300026088 | Ga0207641_11331530 | Ga0207641_113315302 | 162 |
| 197 | 3300028016 | Ga0265354_1000389 | Ga0265354_10003893 | 162 |
| 198 | 3300030878 | Ga0265770_1000783 | Ga0265770_10007835 | 162 |
| 199 | 3300030878 | Ga0265770_1001509 | Ga0265770_10015095 | 162 |
| 200 | 3300030879 | Ga0265765_1000392 | Ga0265765_10003925 | 162 |
| 201 | 3300030879 | Ga0265765_1006108 | Ga0265765_10061082 | 162 |
| 202 | 3300031090 | Ga0265760_10003521 | Ga0265760_100035214 | 162 |
| 203 | 3300031090 | Ga0265760_10003802 | Ga0265760_100038025 | 162 |
| 204 | 3300033547 | Ga0316212_1000583 | Ga0316212_10005833 | 162 |
| 205 | 3300035118 | Ga0373954_0013909 | Ga0373954_0013909_297_785 | 162 |
| 206 | 3300035118 | Ga0373954_0047945 | Ga0373954_0047945_1268_1756 | 162 |
| 207 | 3300035119 | Ga0373956_0188594 | Ga0373956_0188594_71_559 | 162 |
| 208 | 3300035724 | Ga0373933_0095944 | Ga0373933_0095944_1047_1535 | 162 |
| 209 | 3300036401 | Ga0373937_0115469 | Ga0373937_0115469_1593_2081 | 162 |
| 210 | 3300036401 | Ga0373937_0167436 | Ga0373937_0167436_1491_1979 | 162 |
| 211 | 3300037068 | Ga0373925_0743168 | Ga0373925_0743168_153_641 | 162 |
| 212 | 3300037471 | Ga0395905_0739885 | Ga0395905_0739885_83_571 | 162 |
| 213 | 3300038698 | Ga0242419_010570 | Ga0242419_010570_40_528 | 162 |
| 214 | 3300045051 | Ga0451576_0230652 | Ga0451576_0230652_403_891 | 162 |
| 215 | 3300046472 | Ga0495580_0100604 | Ga0495580_0100604_132_620 | 162 |
| 216 | 3300046559 | Ga0495667_0860587 | Ga0495667_0860587_49_537 | 162 |
| 217 | 3300048904 | Ga0496101_0073139 | Ga0496101_0073139_1967_2455 | 162 |
| 218 | 3300048905 | Ga0496102_0045891 | Ga0496102_0045891_2646_3134 | 162 |
| 219 | 3300048905 | Ga0496102_0070807 | Ga0496102_0070807_296_784 | 162 |
| 220 | 3300048906 | Ga0496103_0004416 | Ga0496103_0004416_6937_7425 | 162 |
| 221 | 3300048907 | Ga0496104_0070224 | Ga0496104_0070224_2829_3317 | 162 |
| 222 | 3300048907 | Ga0496104_0786457 | Ga0496104_0786457_84_572 | 162 |
| 223 | 3300048908 | Ga0496105_0491741 | Ga0496105_0491741_65_553 | 162 |
| 224 | 3300048909 | Ga0496106_0147698 | Ga0496106_0147698_777_1265 | 162 |
| 225 | 3300048911 | Ga0496108_0213128 | Ga0496108_0213128_565_1053 | 162 |
| 226 | 3300050507 | nmdc:mga05p37_554120_c1 | nmdc:mga05p37_554120_c1_341_829 | 162 |
| 227 | 3300050512 | nmdc:mga0n895_137217_c1 | nmdc:mga0n895_137217_c1_458_946 | 162 |
| 228 | 3300050513 | nmdc:mga0rr50_623142_c1 | nmdc:mga0rr50_623142_c1_90_578 | 162 |
| 229 | 3300050515 | nmdc:mga0a205_1184812_c1 | nmdc:mga0a205_1184812_c1_18_506 | 162 |
| 230 | 3300050515 | nmdc:mga0a205_238042_c1 | nmdc:mga0a205_238042_c1_204_692 | 162 |
| 231 | 3300005842 | Ga0068858_101339234 | Ga0068858_1013392341 | 163 |
| 232 | 3300006028 | Ga0070717_10273541 | Ga0070717_102735413 | 163 |
| 233 | 3300025916 | Ga0207663_10584175 | Ga0207663_105841751 | 163 |
| 234 | 2162886012 | MBSR1b_contig_10521846 | MBSR1b_0509.00000510 | 164 |
| 235 | 3300005290 | Ga0065712_10114597 | Ga0065712_101145973 | 164 |
| 236 | 3300005293 | Ga0065715_10119818 | Ga0065715_101198184 | 164 |
| 237 | 3300005334 | Ga0068869_100281640 | Ga0068869_1002816401 | 164 |
| 238 | 3300005338 | Ga0068868_100114165 | Ga0068868_1001141654 | 164 |
| 239 | 3300005355 | Ga0070671_100324632 | Ga0070671_1003246322 | 164 |
| 240 | 3300005355 | Ga0070671_100350589 | Ga0070671_1003505892 | 164 |
| 241 | 3300005367 | Ga0070667_100219003 | Ga0070667_1002190032 | 164 |
| 242 | 3300005434 | Ga0070709_10310681 | Ga0070709_103106812 | 164 |
| 243 | 3300005456 | Ga0070678_100281586 | Ga0070678_1002815862 | 164 |
| 244 | 3300005459 | Ga0068867_101766134 | Ga0068867_1017661341 | 164 |
| 245 | 3300005466 | Ga0070685_10608807 | Ga0070685_106088071 | 164 |
| 246 | 3300005547 | Ga0070693_100203509 | Ga0070693_1002035092 | 164 |
| 247 | 3300005564 | Ga0070664_100241798 | Ga0070664_1002417982 | 164 |
| 248 | 3300005578 | Ga0068854_100330156 | Ga0068854_1003301562 | 164 |
| 249 | 3300005615 | Ga0070702_100858535 | Ga0070702_1008585351 | 164 |
| 250 | 3300005617 | Ga0068859_100123694 | Ga0068859_1001236942 | 164 |
| 251 | 3300005618 | Ga0068864_100077420 | Ga0068864_1000774202 | 164 |
| 252 | 3300005718 | Ga0068866_10019072 | Ga0068866_100190724 | 164 |
| 253 | 3300005841 | Ga0068863_100305775 | Ga0068863_1003057753 | 164 |
| 254 | 3300005842 | Ga0068858_100071439 | Ga0068858_1000714392 | 164 |
| 255 | 3300006173 | Ga0070716_100574222 | Ga0070716_1005742222 | 164 |
| 256 | 3300006358 | Ga0068871_100066465 | Ga0068871_1000664655 | 164 |
| 257 | 3300006358 | Ga0068871_100083716 | Ga0068871_1000837163 | 164 |
| 258 | 3300006852 | Ga0075433_10903248 | Ga0075433_109032481 | 164 |
| 259 | 3300006931 | Ga0097620_100123702 | Ga0097620_1001237023 | 164 |
| 260 | 3300009177 | Ga0105248_10040548 | Ga0105248_100405484 | 164 |
| 261 | 3300013105 | Ga0157369_11609155 | Ga0157369_116091551 | 164 |
| 262 | 3300013296 | Ga0157374_10028184 | Ga0157374_100281845 | 164 |
| 263 | 3300013297 | Ga0157378_10039678 | Ga0157378_100396785 | 164 |
| 264 | 3300013306 | Ga0163162_10070244 | Ga0163162_100702444 | 164 |
| 265 | 3300013308 | Ga0157375_10037836 | Ga0157375_100378362 | 164 |
| 266 | 3300014325 | Ga0163163_10006642 | Ga0163163_100066425 | 164 |
| 267 | 3300014969 | Ga0157376_10111341 | Ga0157376_101113413 | 164 |
| 268 | 3300014969 | Ga0157376_10130022 | Ga0157376_101300222 | 164 |
| 269 | 3300025908 | Ga0207643_10148970 | Ga0207643_101489702 | 164 |
| 270 | 3300025926 | Ga0207659_10519551 | Ga0207659_105195512 | 164 |
| 271 | 3300025942 | Ga0207689_10206588 | Ga0207689_102065882 | 164 |
| 272 | 3300025945 | Ga0207679_10421130 | Ga0207679_104211302 | 164 |
| 273 | 3300025960 | Ga0207651_10754638 | Ga0207651_107546382 | 164 |
| 274 | 3300026035 | Ga0207703_10415683 | Ga0207703_104156832 | 164 |
| 275 | 3300026088 | Ga0207641_10514271 | Ga0207641_105142712 | 164 |
| 276 | 3300026095 | Ga0207676_10596746 | Ga0207676_105967462 | 164 |
| 277 | 3300032126 | Ga0307415_100843080 | Ga0307415_1008430801 | 164 |
| 278 | 3300036401 | Ga0373937_0140434 | Ga0373937_0140434_664_1161 | 164 |
| 279 | 3300046473 | Ga0495582_0398430 | Ga0495582_0398430_86_583 | 164 |
| 280 | 3300050515 | nmdc:mga0a205_1172851_c1 | nmdc:mga0a205_1172851_c1_43_546 | 164 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2hkv-assembly1.cif.gz_A-2 | crystal structure of a putative member of the dinb family (exig_1237) from exiguobacterium sibiricum 255-15 at 1.70 a resolution | 0.8011 | 10 | 138 |
| 8fx9-assembly1.cif.gz_A-2 | crystal strucutre of mycobacterium tuberculosis mycothiol-s-transferase enzyme | 0.7801 | 1 | 132 |
| 6iz2-assembly1.cif.gz_A | crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 | 0.7789 | 14 | 134 |
| 3di5-assembly1.cif.gz_A | crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution | 0.778 | 21 | 137 |
| 3dka-assembly1.cif.gz_B | crystal structure of a dinb-like protein (yjoa, bsu12410) from bacillus subtilis at 2.30 a resolution | 0.7454 | 12 | 137 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53728_4_171_1.20.120.450 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.8229 | 9 | 133 | 1.20.120.450 |
| 2hkvA01 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.7839 | 10 | 135 | 1.20.120.450 |
| af_P71985_5_134_1.20.120.450 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.7684 | 17 | 130 | 1.20.120.450 |
| af_O05777_10_164_1.20.120.450 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.7298 | 11 | 130 | 1.20.120.450 |
| 2hkvA01 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.7188 | 10 | 135 | 1.20.120.450 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537JVW4-F1-model_v4 | DinB family protein | 0.9826 | 9 | 126 |
|
| AF-A0A2V7V500-F1-model_v4 | DinB-like domain-containing protein | 0.9709 | 3 | 164 |
|
| AF-A0A2V9YUY0-F1-model_v4 | DinB-like domain-containing protein | 0.9695 | 14 | 164 |
|
| AF-A0A2V9KQC7-F1-model_v4 | DinB-like domain-containing protein | 0.9691 | 7 | 164 |
|
| AF-A0A321LFL3-F1-model_v4 | DinB-like domain-containing protein | 0.967 | 5 | 164 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar