F383587

General Info

Members Datasets Scaffolds Average Seq Length
280 164 280 161

Family's Representative Sequence

Representative Sequence 3300006358|Ga0068871_100066465|Ga0068871_1000664655
Length 185
Sequence LAFTQAKTSGVVSTDEEILTVSATHTKTEDKRQLLRHTVATIAYRGGKAVTSVPDGFNFFRVNDTTRTPEQILAHIGDLFDWALSLARGKQAWNNSTPKAWDDEVARFFGALKAFDDYLASDDELGCSAEKLFQGPIADALTHVGQISMLRRMAGGPVKAENYFVAEIEAGRVGPEQSSKRYEFE

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
115 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
116 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
117 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
118 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
119 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
120 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
122 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
130 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
136 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
137 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
140 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
141 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
159 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
160 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
161 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
162 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
163 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.86
Metatranscriptomes 2.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.07
Rhizosphere 93.57
Stem 0
Stem Tuber 0
Unclassified 0.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_10521846 2162886012 Unclassified 834
2 Ga0065712_10075813 3300005290 Bacteria 3781
3 Ga0065712_10114597 3300005290 Bacteria 1764
4 Ga0065715_10119818 3300005293 Bacteria 2276
5 Ga0065715_10201005 3300005293 Bacteria 1361
6 Ga0070670_100177403 3300005331 Bacteria 1849
7 Ga0068869_100281640 3300005334 Bacteria 1337
8 Ga0070680_100000624 3300005336 Bacteria 24592
9 Ga0070680_100669694 3300005336 Unclassified 892
10 Ga0070680_100690163 3300005336 Unclassified 878
11 Ga0068868_100114165 3300005338 Bacteria 2197
12 Ga0070689_100851556 3300005340 Unclassified 804
13 Ga0070668_100265749 3300005347 Bacteria 1428
14 Ga0070671_100324632 3300005355 Bacteria 1312
15 Ga0070671_100350589 3300005355 Bacteria 1260
16 Ga0070674_100795925 3300005356 Bacteria 816
17 Ga0070673_100008405 3300005364 Bacteria 6863
18 Ga0070659_100590991 3300005366 Unclassified 953
19 Ga0070659_100698332 3300005366 Unclassified 877
20 Ga0070667_100219003 3300005367 Bacteria 1694
21 Ga0070703_10003898 3300005406 Bacteria 4225
22 Ga0070709_10069901 3300005434 Bacteria 2262
23 Ga0070709_10244885 3300005434 Unclassified 1289
24 Ga0070709_10310681 3300005434 Bacteria 1154
25 Ga0070709_10465799 3300005434 Unclassified 954
26 Ga0070709_10517011 3300005434 Bacteria 909
27 Ga0070714_100032184 3300005435 Bacteria 4377
28 Ga0070713_100019568 3300005436 Bacteria 5174
29 Ga0070711_100172102 3300005439 Unclassified 1651
30 Ga0070705_100038141 3300005440 Bacteria 2716
31 Ga0070700_100091050 3300005441 Bacteria 1990
32 Ga0070694_100007958 3300005444 Bacteria 6477
33 Ga0070694_100270440 3300005444 Bacteria 1292
34 Ga0070708_100017952 3300005445 Bacteria 5915
35 Ga0070678_100281586 3300005456 Bacteria 1406
36 Ga0070662_100314175 3300005457 Bacteria 1276
37 Ga0070681_10003988 3300005458 Bacteria 13923
38 Ga0070681_10005144 3300005458 Bacteria 12616
39 Ga0070681_10008950 3300005458 Bacteria 9846
40 Ga0070681_10032714 3300005458 Bacteria 5221
41 Ga0068867_101766134 3300005459 Unclassified 581
42 Ga0070685_10608807 3300005466 Unclassified 787
43 Ga0070706_100001238 3300005467 Bacteria 27332
44 Ga0070706_100029254 3300005467 Bacteria 5076
45 Ga0070706_100049584 3300005467 Bacteria 3874
46 Ga0070707_100949110 3300005468 Bacteria 825
47 Ga0070707_102162026 3300005468 Unclassified 524
48 Ga0070699_101047874 3300005518 Bacteria 748
49 Ga0070679_100000047 3300005530 Bacteria 90654
50 Ga0070679_101942436 3300005530 Archaea 537
51 Ga0070697_100003428 3300005536 Bacteria 12198
52 Ga0070697_100458645 3300005536 Unclassified 1111
53 Ga0068853_100051481 3300005539 Unclassified 3544
54 Ga0070672_100334247 3300005543 Bacteria 1289
55 Ga0070672_101049058 3300005543 Unclassified 723
56 Ga0070686_100119863 3300005544 Bacteria 1805
57 Ga0070695_100001564 3300005545 Bacteria 12776
58 Ga0070695_100052159 3300005545 Unclassified 2627
59 Ga0070695_100788437 3300005545 Unclassified 760
60 Ga0070696_100008100 3300005546 Bacteria 7024
61 Ga0070696_100535612 3300005546 Unclassified 936
62 Ga0070693_100000089 3300005547 Bacteria 38952
63 Ga0070693_100203509 3300005547 Bacteria 1287
64 Ga0068855_100163464 3300005563 Bacteria 2525
65 Ga0070664_100241798 3300005564 Bacteria 1621
66 Ga0070664_100243106 3300005564 Bacteria 1616
67 Ga0068854_100330156 3300005578 Bacteria 1242
68 Ga0068854_100502695 3300005578 Bacteria 1021
69 Ga0068856_100059313 3300005614 Bacteria 3780
70 Ga0068856_100182810 3300005614 Bacteria 2110
71 Ga0070702_100858535 3300005615 Unclassified 707
72 Ga0068859_100115183 3300005617 Bacteria 2753
73 Ga0068859_100123694 3300005617 Unclassified 2654
74 Ga0068859_100268752 3300005617 Bacteria 1797
75 Ga0068859_100380103 3300005617 Bacteria 1508
76 Ga0068859_102119599 3300005617 Bacteria 621
77 Ga0068864_100077420 3300005618 Bacteria 2908
78 Ga0068864_100972465 3300005618 Archaea 841
79 Ga0068866_10019072 3300005718 Unclassified 3115
80 Ga0068863_100305775 3300005841 Bacteria 1543
81 Ga0068858_100071439 3300005842 Bacteria 3220
82 Ga0068858_101339234 3300005842 Archaea 705
83 Ga0068860_100573212 3300005843 Bacteria 1132
84 Ga0068862_101113642 3300005844 Archaea 785
85 Ga0068862_101675422 3300005844 Bacteria 644
86 Ga0070717_10273541 3300006028 Bacteria 1496
87 Ga0070716_100128320 3300006173 Bacteria 1599
88 Ga0070716_100574222 3300006173 Bacteria 844
89 Ga0068871_100066465 3300006358 Bacteria 2955
90 Ga0068871_100083716 3300006358 Unclassified 2646
91 Ga0075428_100287780 3300006844 Bacteria 1768
92 Ga0075428_100401740 3300006844 Bacteria 1468
93 Ga0075428_101191094 3300006844 Unclassified 803
94 Ga0075431_101310327 3300006847 Unclassified 685
95 Ga0075433_10065060 3300006852 Bacteria 3198
96 Ga0075433_10087683 3300006852 Bacteria 2748
97 Ga0075433_10140312 3300006852 Unclassified 2148
98 Ga0075433_10373747 3300006852 Bacteria 1259
99 Ga0075433_10438370 3300006852 Bacteria 1152
100 Ga0075433_10903248 3300006852 Unclassified 770
101 Ga0075434_100189547 3300006871 Bacteria 2076
102 Ga0075429_100579634 3300006880 Unclassified 983
103 Ga0097620_100115187 3300006931 Bacteria 2753
104 Ga0097620_100123702 3300006931 Unclassified 2654
105 Ga0097620_100268785 3300006931 Bacteria 1797
106 Ga0097620_100380113 3300006931 Bacteria 1508
107 Ga0097620_102119683 3300006931 Bacteria 621
108 Ga0075435_100025360 3300007076 Bacteria 4615
109 Ga0075435_100571474 3300007076 Bacteria 980
110 Ga0075435_100648105 3300007076 Bacteria 917
111 Ga0075435_101281665 3300007076 Bacteria 642
112 Ga0111539_10059246 3300009094 Bacteria 4541
113 Ga0111539_10715100 3300009094 Bacteria 1166
114 Ga0105245_10041472 3300009098 Bacteria 4103
115 Ga0105245_11732896 3300009098 Unclassified 677
116 Ga0114129_10003112 3300009147 Bacteria 23271
117 Ga0114129_10024362 3300009147 Bacteria 8575
118 Ga0114129_10136144 3300009147 Bacteria 3370
119 Ga0105241_10009115 3300009174 Bacteria 7303
120 Ga0105248_10040548 3300009177 Bacteria 5220
121 Ga0105248_10404619 3300009177 Bacteria 1537
122 Ga0105248_11295911 3300009177 Bacteria 824
123 Ga0105248_12286723 3300009177 Bacteria 615
124 Ga0105237_10106226 3300009545 Bacteria 2799
125 Ga0105249_10051419 3300009553 Bacteria 3759
126 Ga0105249_10215666 3300009553 Bacteria 1886
127 Ga0105239_10749385 3300010375 Unclassified 1118
128 Ga0105239_11822018 3300010375 Unclassified 705
129 Ga0157369_10410565 3300013105 Unclassified 1404
130 Ga0157369_11609155 3300013105 Unclassified 660
131 Ga0157374_10028184 3300013296 Bacteria 5071
132 Ga0157374_10952637 3300013296 Bacteria 877
133 Ga0157378_10039678 3300013297 Unclassified 4176
134 Ga0157378_10231574 3300013297 Unclassified 1761
135 Ga0157378_10396033 3300013297 Bacteria 1359
136 Ga0163162_10070244 3300013306 Unclassified 3553
137 Ga0163162_10383371 3300013306 Bacteria 1539
138 Ga0163162_10595574 3300013306 Bacteria 1232
139 Ga0157372_10027228 3300013307 Bacteria 6223
140 Ga0157372_11761167 3300013307 Unclassified 712
141 Ga0157375_10031904 3300013308 Bacteria 4990
142 Ga0157375_10037836 3300013308 Bacteria 4627
143 Ga0157375_11000467 3300013308 Bacteria 976
144 Ga0163163_10006642 3300014325 Bacteria 10133
145 Ga0163163_10172502 3300014325 Unclassified 2209
146 Ga0157379_10400903 3300014968 Unclassified 1261
147 Ga0157379_10412996 3300014968 Bacteria 1242
148 Ga0157379_11418289 3300014968 Bacteria 674
149 Ga0157376_10111341 3300014969 Bacteria 2410
150 Ga0157376_10130022 3300014969 Unclassified 2245
151 Ga0157376_10597776 3300014969 Unclassified 1098
152 Ga0207653_10003848 3300025885 Bacteria 4726
153 Ga0207699_10059936 3300025906 Bacteria 2283
154 Ga0207699_10474098 3300025906 Unclassified 901
155 Ga0207643_10148970 3300025908 Bacteria 1402
156 Ga0207684_10013817 3300025910 Bacteria 6973
157 Ga0207684_10020181 3300025910 Bacteria 5691
158 Ga0207684_10070350 3300025910 Bacteria 2974
159 Ga0207707_10000006 3300025912 Bacteria 374131
160 Ga0207707_10100681 3300025912 Bacteria 2525
161 Ga0207707_10175161 3300025912 Bacteria 1874
162 Ga0207707_10456919 3300025912 Unclassified 1092
163 Ga0207671_10046223 3300025914 Bacteria 3220
164 Ga0207663_10159151 3300025916 Bacteria 1592
165 Ga0207663_10183724 3300025916 Bacteria 1495
166 Ga0207663_10584175 3300025916 Unclassified 876
167 Ga0207660_10009129 3300025917 Bacteria 6421
168 Ga0207652_10009231 3300025921 Bacteria 7934
169 Ga0207681_10939965 3300025923 Bacteria 725
170 Ga0207659_10519551 3300025926 Bacteria 1009
171 Ga0207700_10096882 3300025928 Unclassified 2343
172 Ga0207644_10896907 3300025931 Bacteria 743
173 Ga0207706_10521481 3300025933 Bacteria 1024
174 Ga0207709_11323054 3300025935 Unclassified 596
175 Ga0207691_10402810 3300025940 Unclassified 1167
176 Ga0207689_10206588 3300025942 Bacteria 1622
177 Ga0207661_10630697 3300025944 Bacteria 985
178 Ga0207679_10421130 3300025945 Bacteria 1179
179 Ga0207667_10132560 3300025949 Bacteria 2567
180 Ga0207651_10049517 3300025960 Bacteria 2847
181 Ga0207651_10754638 3300025960 Unclassified 860
182 Ga0207712_10545548 3300025961 Bacteria 997
183 Ga0207703_10163610 3300026035 Unclassified 1951
184 Ga0207703_10415683 3300026035 Bacteria 1250
185 Ga0207703_10899198 3300026035 Archaea 848
186 Ga0207639_10238921 3300026041 Unclassified 1578
187 Ga0207702_10045577 3300026078 Bacteria 3688
188 Ga0207641_10514271 3300026088 Bacteria 1164
189 Ga0207641_11331530 3300026088 Unclassified 719
190 Ga0207648_10090127 3300026089 Bacteria 2679
191 Ga0207648_10605245 3300026089 Bacteria 1010
192 Ga0207676_10006361 3300026095 Bacteria 8345
193 Ga0207676_10596746 3300026095 Unclassified 1060
194 Ga0207676_11616034 3300026095 Unclassified 646
195 Ga0265354_1000389 3300028016 Bacteria 7711
196 Ga0268265_10543557 3300028380 Bacteria 1102
197 Ga0265770_1000783 3300030878 Bacteria 4437
198 Ga0265770_1001509 3300030878 Unclassified 3190
199 Ga0265765_1000392 3300030879 Bacteria 3341
200 Ga0265765_1006108 3300030879 Unclassified 1276
201 Ga0265760_10003521 3300031090 Bacteria 4542
202 Ga0265760_10003802 3300031090 Bacteria 4375
203 Ga0265316_10505744 3300031344 Unclassified 863
204 Ga0307415_100843080 3300032126 Bacteria 840
205 Ga0307415_101112852 3300032126 Bacteria 740
206 Ga0316212_1000583 3300033547 Bacteria 4546
207 Ga0373945_0109792 3300035116 Bacteria 1087
208 Ga0373954_0013909 3300035118 Bacteria 3587
209 Ga0373954_0047945 3300035118 Bacteria 2001
210 Ga0373956_0188594 3300035119 Unclassified 976
211 Ga0373957_0256570 3300035120 Bacteria 736
212 Ga0373946_0087212 3300035171 Unclassified 1377
213 Ga0373924_0482009 3300035410 Unclassified 557
214 Ga0373931_0090917 3300035691 Bacteria 1700
215 Ga0373933_0095944 3300035724 Unclassified 1835
216 Ga0373947_0125916 3300035725 Bacteria 1631
217 Ga0373947_0223221 3300035725 Bacteria 1239
218 Ga0373937_0060366 3300036401 Bacteria 3485
219 Ga0373937_0115469 3300036401 Bacteria 2499
220 Ga0373937_0140434 3300036401 Unclassified 2260
221 Ga0373937_0167436 3300036401 Bacteria 2061
222 Ga0373937_0414330 3300036401 Unclassified 1278
223 Ga0373925_0157556 3300037068 Bacteria 1787
224 Ga0373925_0743168 3300037068 Unclassified 809
225 Ga0395905_0214731 3300037471 Bacteria 1802
226 Ga0395905_0739885 3300037471 Bacteria 886
227 Ga0242419_010570 3300038698 Unclassified 707
228 Ga0451577_0029436 3300042876 Bacteria 4964
229 Ga0453683_0356438 3300044673 Unclassified 940
230 Ga0453684_0190446 3300044712 Bacteria 2400
231 Ga0451576_0230652 3300045051 Bacteria 1934
232 Ga0495580_0100604 3300046472 Unclassified 2011
233 Ga0495582_0257646 3300046473 Bacteria 1001
234 Ga0495582_0398430 3300046473 Unclassified 794
235 Ga0495582_0528674 3300046473 Bacteria 682
236 Ga0495628_0464140 3300046516 Bacteria 918
237 Ga0495630_0594926 3300046517 Unclassified 848
238 Ga0495586_0383227 3300046535 Bacteria 809
239 Ga0495598_0038029 3300046537 Bacteria 1391
240 Ga0495667_0860587 3300046559 Unclassified 557
241 Ga0495659_0074348 3300046664 Bacteria 1278
242 Ga0495646_0221243 3300046680 Bacteria 1024
243 Ga0495604_0730638 3300047317 Unclassified 627
244 Ga0495674_0618522 3300047319 Bacteria 857
245 Ga0495602_0423354 3300048088 Unclassified 945
246 Ga0496101_0073139 3300048904 Bacteria 2518
247 Ga0496102_0045891 3300048905 Bacteria 3967
248 Ga0496102_0070807 3300048905 Unclassified 3202
249 Ga0496103_0004416 3300048906 Bacteria 8531
250 Ga0496104_0070224 3300048907 Bacteria 3329
251 Ga0496104_0786457 3300048907 Unclassified 858
252 Ga0496104_1002831 3300048907 Bacteria 739
253 Ga0496105_0093446 3300048908 Unclassified 2484
254 Ga0496105_0491741 3300048908 Bacteria 964
255 Ga0496106_0147698 3300048909 Unclassified 1853
256 Ga0496108_0213128 3300048911 Unclassified 1677
257 Ga0496108_0288401 3300048911 Bacteria 1429
258 Ga0496108_0650438 3300048911 Bacteria 916
259 Ga0496110_0041110 3300048913 Bacteria 4033
260 Ga0496112_0062674 3300048915 Unclassified 3668
261 Ga0496112_0249435 3300048915 Bacteria 1727
262 Ga0496112_0346298 3300048915 Unclassified 1429
263 Ga0501077_0131633 3300049593 Bacteria 1586
264 Ga0501080_1138867 3300049742 Unclassified 672
265 nmdc:mga05p37_4227_c1 3300050507 Bacteria 16779
266 nmdc:mga05p37_554120_c1 3300050507 Bacteria 1308
267 nmdc:mga05p37_9155_c1 3300050507 Bacteria 11705
268 nmdc:mga08y16_610096_c1 3300050511 Bacteria 1099
269 nmdc:mga0n895_137217_c1 3300050512 Bacteria 2473
270 nmdc:mga0rr50_1046964_c1 3300050513 Bacteria 695
271 nmdc:mga0rr50_623142_c1 3300050513 Bacteria 920
272 nmdc:mga0a205_1172851_c1 3300050515 Unclassified 616
273 nmdc:mga0a205_1184812_c1 3300050515 Unclassified 612
274 nmdc:mga0a205_238042_c1 3300050515 Bacteria 1702
275 Ga0495601_0127597 3300053077 Bacteria 1655
276 Ga0495595_0119419 3300053084 Unclassified 1283
277 Ga0495619_0038177 3300053085 Unclassified 3132
278 Ga0495619_0815386 3300053085 Unclassified 631
279 Ga0501084_1100855 3300054114 Unclassified 667
280 Ga0501082_0578935 3300060353 Unclassified 982

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013307 Ga0157372_11761167 Ga0157372_117611671 149
2 3300037068 Ga0373925_0157556 Ga0373925_0157556_1123_1578 151
3 3300046473 Ga0495582_0257646 Ga0495582_0257646_113_568 151
4 3300042876 Ga0451577_0029436 Ga0451577_0029436_1242_1700 152
5 3300044712 Ga0453684_0190446 Ga0453684_0190446_613_1071 152
6 3300025944 Ga0207661_10630697 Ga0207661_106306971 154
7 3300009177 Ga0105248_10404619 Ga0105248_104046192 155
8 3300046537 Ga0495598_0038029 Ga0495598_0038029_745_1215 156
9 3300005290 Ga0065712_10075813 Ga0065712_100758133 157
10 3300005293 Ga0065715_10201005 Ga0065715_102010052 157
11 3300005366 Ga0070659_100590991 Ga0070659_1005909911 157
12 3300005458 Ga0070681_10003988 Ga0070681_100039886 157
13 3300005530 Ga0070679_101942436 Ga0070679_1019424361 157
14 3300005536 Ga0070697_100458645 Ga0070697_1004586452 157
15 3300005544 Ga0070686_100119863 Ga0070686_1001198632 157
16 3300005546 Ga0070696_100535612 Ga0070696_1005356121 157
17 3300005563 Ga0068855_100163464 Ga0068855_1001634642 157
18 3300005618 Ga0068864_100972465 Ga0068864_1009724651 157
19 3300005843 Ga0068860_100573212 Ga0068860_1005732122 157
20 3300006844 Ga0075428_100287780 Ga0075428_1002877802 157
21 3300006844 Ga0075428_101191094 Ga0075428_1011910942 157
22 3300006847 Ga0075431_101310327 Ga0075431_1013103272 157
23 3300009147 Ga0114129_10024362 Ga0114129_100243626 157
24 3300009177 Ga0105248_12286723 Ga0105248_122867231 157
25 3300009553 Ga0105249_10215666 Ga0105249_102156663 157
26 3300010375 Ga0105239_10749385 Ga0105239_107493852 157
27 3300010375 Ga0105239_11822018 Ga0105239_118220181 157
28 3300013105 Ga0157369_10410565 Ga0157369_104105652 157
29 3300013296 Ga0157374_10952637 Ga0157374_109526372 157
30 3300013308 Ga0157375_11000467 Ga0157375_110004672 157
31 3300014968 Ga0157379_10412996 Ga0157379_104129962 157
32 3300025912 Ga0207707_10456919 Ga0207707_104569192 157
33 3300025916 Ga0207663_10183724 Ga0207663_101837242 157
34 3300025931 Ga0207644_10896907 Ga0207644_108969072 157
35 3300025949 Ga0207667_10132560 Ga0207667_101325602 157
36 3300026095 Ga0207676_10006361 Ga0207676_100063614 157
37 3300035116 Ga0373945_0109792 Ga0373945_0109792_346_819 157
38 3300035120 Ga0373957_0256570 Ga0373957_0256570_138_611 157
39 3300035171 Ga0373946_0087212 Ga0373946_0087212_128_601 157
40 3300035410 Ga0373924_0482009 Ga0373924_0482009_21_494 157
41 3300035725 Ga0373947_0125916 Ga0373947_0125916_371_844 157
42 3300036401 Ga0373937_0060366 Ga0373937_0060366_1397_1870 157
43 3300036401 Ga0373937_0414330 Ga0373937_0414330_437_910 157
44 3300046473 Ga0495582_0528674 Ga0495582_0528674_65_538 157
45 3300046516 Ga0495628_0464140 Ga0495628_0464140_341_814 157
46 3300046517 Ga0495630_0594926 Ga0495630_0594926_272_745 157
47 3300046535 Ga0495586_0383227 Ga0495586_0383227_239_712 157
48 3300046664 Ga0495659_0074348 Ga0495659_0074348_542_1015 157
49 3300046680 Ga0495646_0221243 Ga0495646_0221243_93_566 157
50 3300047317 Ga0495604_0730638 Ga0495604_0730638_15_488 157
51 3300047319 Ga0495674_0618522 Ga0495674_0618522_166_639 157
52 3300048088 Ga0495602_0423354 Ga0495602_0423354_307_780 157
53 3300048907 Ga0496104_1002831 Ga0496104_1002831_193_666 157
54 3300048908 Ga0496105_0093446 Ga0496105_0093446_54_527 157
55 3300048911 Ga0496108_0288401 Ga0496108_0288401_77_550 157
56 3300048911 Ga0496108_0650438 Ga0496108_0650438_429_902 157
57 3300048913 Ga0496110_0041110 Ga0496110_0041110_115_588 157
58 3300048915 Ga0496112_0062674 Ga0496112_0062674_1621_2094 157
59 3300048915 Ga0496112_0346298 Ga0496112_0346298_477_950 157
60 3300050507 nmdc:mga05p37_9155_c1 nmdc:mga05p37_9155_c1_7199_7672 157
61 3300053077 Ga0495601_0127597 Ga0495601_0127597_1037_1510 157
62 3300053084 Ga0495595_0119419 Ga0495595_0119419_523_996 157
63 3300053085 Ga0495619_0038177 Ga0495619_0038177_1428_1901 157
64 3300053085 Ga0495619_0815386 Ga0495619_0815386_104_577 157
65 3300005364 Ga0070673_100008405 Ga0070673_1000084055 158
66 3300005617 Ga0068859_100115183 Ga0068859_1001151832 158
67 3300005617 Ga0068859_100268752 Ga0068859_1002687521 158
68 3300005844 Ga0068862_101113642 Ga0068862_1011136422 158
69 3300006844 Ga0075428_100401740 Ga0075428_1004017402 158
70 3300006852 Ga0075433_10140312 Ga0075433_101403122 158
71 3300006931 Ga0097620_100115187 Ga0097620_1001151872 158
72 3300006931 Ga0097620_100268785 Ga0097620_1002687851 158
73 3300009094 Ga0111539_10715100 Ga0111539_107151002 158
74 3300009147 Ga0114129_10003112 Ga0114129_1000311210 158
75 3300014325 Ga0163163_10172502 Ga0163163_101725022 158
76 3300014968 Ga0157379_10400903 Ga0157379_104009031 158
77 3300025960 Ga0207651_10049517 Ga0207651_100495172 158
78 3300026035 Ga0207703_10163610 Ga0207703_101636102 158
79 3300026035 Ga0207703_10899198 Ga0207703_108991981 158
80 3300026089 Ga0207648_10090127 Ga0207648_100901273 158
81 3300035691 Ga0373931_0090917 Ga0373931_0090917_822_1298 158
82 3300049593 Ga0501077_0131633 Ga0501077_0131633_346_822 158
83 3300049742 Ga0501080_1138867 Ga0501080_1138867_35_511 158
84 3300050507 nmdc:mga05p37_4227_c1 nmdc:mga05p37_4227_c1_7341_7817 158
85 3300050511 nmdc:mga08y16_610096_c1 nmdc:mga08y16_610096_c1_423_899 158
86 3300054114 Ga0501084_1100855 Ga0501084_1100855_91_567 158
87 3300005336 Ga0070680_100669694 Ga0070680_1006696942 159
88 3300005458 Ga0070681_10008950 Ga0070681_100089507 159
89 3300005458 Ga0070681_10032714 Ga0070681_100327144 159
90 3300005543 Ga0070672_101049058 Ga0070672_1010490582 159
91 3300009094 Ga0111539_10059246 Ga0111539_100592463 159
92 3300009098 Ga0105245_10041472 Ga0105245_100414725 159
93 3300009177 Ga0105248_11295911 Ga0105248_112959112 159
94 3300013297 Ga0157378_10396033 Ga0157378_103960332 159
95 3300013306 Ga0163162_10383371 Ga0163162_103833712 159
96 3300013308 Ga0157375_10031904 Ga0157375_100319045 159
97 3300014969 Ga0157376_10597776 Ga0157376_105977762 159
98 3300025912 Ga0207707_10100681 Ga0207707_101006813 159
99 3300025923 Ga0207681_10939965 Ga0207681_109399651 159
100 3300026089 Ga0207648_10605245 Ga0207648_106052452 159
101 3300028380 Ga0268265_10543557 Ga0268265_105435572 159
102 3300035725 Ga0373947_0223221 Ga0373947_0223221_30_509 159
103 3300037471 Ga0395905_0214731 Ga0395905_0214731_1255_1734 159
104 3300048915 Ga0496112_0249435 Ga0496112_0249435_156_635 159
105 3300005331 Ga0070670_100177403 Ga0070670_1001774032 160
106 3300005340 Ga0070689_100851556 Ga0070689_1008515562 160
107 3300005347 Ga0070668_100265749 Ga0070668_1002657492 160
108 3300005441 Ga0070700_100091050 Ga0070700_1000910502 160
109 3300005457 Ga0070662_100314175 Ga0070662_1003141752 160
110 3300005543 Ga0070672_100334247 Ga0070672_1003342472 160
111 3300005564 Ga0070664_100243106 Ga0070664_1002431061 160
112 3300005617 Ga0068859_100380103 Ga0068859_1003801032 160
113 3300006852 Ga0075433_10087683 Ga0075433_100876832 160
114 3300006880 Ga0075429_100579634 Ga0075429_1005796342 160
115 3300006931 Ga0097620_100380113 Ga0097620_1003801132 160
116 3300007076 Ga0075435_100025360 Ga0075435_1000253603 160
117 3300025933 Ga0207706_10521481 Ga0207706_105214812 160
118 3300025940 Ga0207691_10402810 Ga0207691_104028102 160
119 3300026095 Ga0207676_11616034 Ga0207676_116160342 160
120 3300031344 Ga0265316_10505744 Ga0265316_105057442 160
121 3300032126 Ga0307415_101112852 Ga0307415_1011128521 160
122 3300060353 Ga0501082_0578935 Ga0501082_0578935_354_836 160
123 3300005467 Ga0070706_100029254 Ga0070706_1000292544 161
124 3300005467 Ga0070706_100049584 Ga0070706_1000495842 161
125 3300005617 Ga0068859_102119599 Ga0068859_1021195991 161
126 3300006931 Ga0097620_102119683 Ga0097620_1021196831 161
127 3300007076 Ga0075435_100648105 Ga0075435_1006481051 161
128 3300025910 Ga0207684_10020181 Ga0207684_100201814 161
129 3300025910 Ga0207684_10070350 Ga0207684_100703503 161
130 3300044673 Ga0453683_0356438 Ga0453683_0356438_311_796 161
131 3300050513 nmdc:mga0rr50_1046964_c1 nmdc:mga0rr50_1046964_c1_117_602 161
132 3300005336 Ga0070680_100000624 Ga0070680_1000006248 162
133 3300005336 Ga0070680_100690163 Ga0070680_1006901632 162
134 3300005356 Ga0070674_100795925 Ga0070674_1007959252 162
135 3300005366 Ga0070659_100698332 Ga0070659_1006983321 162
136 3300005406 Ga0070703_10003898 Ga0070703_100038982 162
137 3300005434 Ga0070709_10069901 Ga0070709_100699012 162
138 3300005434 Ga0070709_10244885 Ga0070709_102448852 162
139 3300005434 Ga0070709_10465799 Ga0070709_104657991 162
140 3300005434 Ga0070709_10517011 Ga0070709_105170112 162
141 3300005435 Ga0070714_100032184 Ga0070714_1000321842 162
142 3300005436 Ga0070713_100019568 Ga0070713_1000195682 162
143 3300005439 Ga0070711_100172102 Ga0070711_1001721021 162
144 3300005440 Ga0070705_100038141 Ga0070705_1000381412 162
145 3300005444 Ga0070694_100007958 Ga0070694_1000079585 162
146 3300005444 Ga0070694_100270440 Ga0070694_1002704401 162
147 3300005445 Ga0070708_100017952 Ga0070708_1000179524 162
148 3300005458 Ga0070681_10005144 Ga0070681_100051449 162
149 3300005467 Ga0070706_100001238 Ga0070706_1000012384 162
150 3300005468 Ga0070707_100949110 Ga0070707_1009491102 162
151 3300005468 Ga0070707_102162026 Ga0070707_1021620261 162
152 3300005518 Ga0070699_101047874 Ga0070699_1010478742 162
153 3300005530 Ga0070679_100000047 Ga0070679_1000000479 162
154 3300005536 Ga0070697_100003428 Ga0070697_10000342811 162
155 3300005539 Ga0068853_100051481 Ga0068853_1000514812 162
156 3300005545 Ga0070695_100001564 Ga0070695_1000015642 162
157 3300005545 Ga0070695_100052159 Ga0070695_1000521591 162
158 3300005545 Ga0070695_100788437 Ga0070695_1007884371 162
159 3300005546 Ga0070696_100008100 Ga0070696_1000081003 162
160 3300005547 Ga0070693_100000089 Ga0070693_10000008915 162
161 3300005578 Ga0068854_100502695 Ga0068854_1005026951 162
162 3300005614 Ga0068856_100059313 Ga0068856_1000593133 162
163 3300005614 Ga0068856_100182810 Ga0068856_1001828101 162
164 3300005844 Ga0068862_101675422 Ga0068862_1016754221 162
165 3300006173 Ga0070716_100128320 Ga0070716_1001283202 162
166 3300006852 Ga0075433_10065060 Ga0075433_100650605 162
167 3300006852 Ga0075433_10373747 Ga0075433_103737471 162
168 3300006852 Ga0075433_10438370 Ga0075433_104383701 162
169 3300006871 Ga0075434_100189547 Ga0075434_1001895473 162
170 3300007076 Ga0075435_100571474 Ga0075435_1005714741 162
171 3300007076 Ga0075435_101281665 Ga0075435_1012816651 162
172 3300009098 Ga0105245_11732896 Ga0105245_117328961 162
173 3300009147 Ga0114129_10136144 Ga0114129_101361443 162
174 3300009174 Ga0105241_10009115 Ga0105241_100091155 162
175 3300009545 Ga0105237_10106226 Ga0105237_101062262 162
176 3300009553 Ga0105249_10051419 Ga0105249_100514192 162
177 3300013297 Ga0157378_10231574 Ga0157378_102315741 162
178 3300013306 Ga0163162_10595574 Ga0163162_105955743 162
179 3300013307 Ga0157372_10027228 Ga0157372_100272281 162
180 3300014968 Ga0157379_11418289 Ga0157379_114182891 162
181 3300025885 Ga0207653_10003848 Ga0207653_100038484 162
182 3300025906 Ga0207699_10059936 Ga0207699_100599362 162
183 3300025906 Ga0207699_10474098 Ga0207699_104740981 162
184 3300025910 Ga0207684_10013817 Ga0207684_100138175 162
185 3300025912 Ga0207707_10000006 Ga0207707_10000006304 162
186 3300025912 Ga0207707_10175161 Ga0207707_101751613 162
187 3300025914 Ga0207671_10046223 Ga0207671_100462232 162
188 3300025916 Ga0207663_10159151 Ga0207663_101591512 162
189 3300025917 Ga0207660_10009129 Ga0207660_100091291 162
190 3300025921 Ga0207652_10009231 Ga0207652_100092319 162
191 3300025928 Ga0207700_10096882 Ga0207700_100968822 162
192 3300025935 Ga0207709_11323054 Ga0207709_113230541 162
193 3300025961 Ga0207712_10545548 Ga0207712_105455482 162
194 3300026041 Ga0207639_10238921 Ga0207639_102389213 162
195 3300026078 Ga0207702_10045577 Ga0207702_100455774 162
196 3300026088 Ga0207641_11331530 Ga0207641_113315302 162
197 3300028016 Ga0265354_1000389 Ga0265354_10003893 162
198 3300030878 Ga0265770_1000783 Ga0265770_10007835 162
199 3300030878 Ga0265770_1001509 Ga0265770_10015095 162
200 3300030879 Ga0265765_1000392 Ga0265765_10003925 162
201 3300030879 Ga0265765_1006108 Ga0265765_10061082 162
202 3300031090 Ga0265760_10003521 Ga0265760_100035214 162
203 3300031090 Ga0265760_10003802 Ga0265760_100038025 162
204 3300033547 Ga0316212_1000583 Ga0316212_10005833 162
205 3300035118 Ga0373954_0013909 Ga0373954_0013909_297_785 162
206 3300035118 Ga0373954_0047945 Ga0373954_0047945_1268_1756 162
207 3300035119 Ga0373956_0188594 Ga0373956_0188594_71_559 162
208 3300035724 Ga0373933_0095944 Ga0373933_0095944_1047_1535 162
209 3300036401 Ga0373937_0115469 Ga0373937_0115469_1593_2081 162
210 3300036401 Ga0373937_0167436 Ga0373937_0167436_1491_1979 162
211 3300037068 Ga0373925_0743168 Ga0373925_0743168_153_641 162
212 3300037471 Ga0395905_0739885 Ga0395905_0739885_83_571 162
213 3300038698 Ga0242419_010570 Ga0242419_010570_40_528 162
214 3300045051 Ga0451576_0230652 Ga0451576_0230652_403_891 162
215 3300046472 Ga0495580_0100604 Ga0495580_0100604_132_620 162
216 3300046559 Ga0495667_0860587 Ga0495667_0860587_49_537 162
217 3300048904 Ga0496101_0073139 Ga0496101_0073139_1967_2455 162
218 3300048905 Ga0496102_0045891 Ga0496102_0045891_2646_3134 162
219 3300048905 Ga0496102_0070807 Ga0496102_0070807_296_784 162
220 3300048906 Ga0496103_0004416 Ga0496103_0004416_6937_7425 162
221 3300048907 Ga0496104_0070224 Ga0496104_0070224_2829_3317 162
222 3300048907 Ga0496104_0786457 Ga0496104_0786457_84_572 162
223 3300048908 Ga0496105_0491741 Ga0496105_0491741_65_553 162
224 3300048909 Ga0496106_0147698 Ga0496106_0147698_777_1265 162
225 3300048911 Ga0496108_0213128 Ga0496108_0213128_565_1053 162
226 3300050507 nmdc:mga05p37_554120_c1 nmdc:mga05p37_554120_c1_341_829 162
227 3300050512 nmdc:mga0n895_137217_c1 nmdc:mga0n895_137217_c1_458_946 162
228 3300050513 nmdc:mga0rr50_623142_c1 nmdc:mga0rr50_623142_c1_90_578 162
229 3300050515 nmdc:mga0a205_1184812_c1 nmdc:mga0a205_1184812_c1_18_506 162
230 3300050515 nmdc:mga0a205_238042_c1 nmdc:mga0a205_238042_c1_204_692 162
231 3300005842 Ga0068858_101339234 Ga0068858_1013392341 163
232 3300006028 Ga0070717_10273541 Ga0070717_102735413 163
233 3300025916 Ga0207663_10584175 Ga0207663_105841751 163
234 2162886012 MBSR1b_contig_10521846 MBSR1b_0509.00000510 164
235 3300005290 Ga0065712_10114597 Ga0065712_101145973 164
236 3300005293 Ga0065715_10119818 Ga0065715_101198184 164
237 3300005334 Ga0068869_100281640 Ga0068869_1002816401 164
238 3300005338 Ga0068868_100114165 Ga0068868_1001141654 164
239 3300005355 Ga0070671_100324632 Ga0070671_1003246322 164
240 3300005355 Ga0070671_100350589 Ga0070671_1003505892 164
241 3300005367 Ga0070667_100219003 Ga0070667_1002190032 164
242 3300005434 Ga0070709_10310681 Ga0070709_103106812 164
243 3300005456 Ga0070678_100281586 Ga0070678_1002815862 164
244 3300005459 Ga0068867_101766134 Ga0068867_1017661341 164
245 3300005466 Ga0070685_10608807 Ga0070685_106088071 164
246 3300005547 Ga0070693_100203509 Ga0070693_1002035092 164
247 3300005564 Ga0070664_100241798 Ga0070664_1002417982 164
248 3300005578 Ga0068854_100330156 Ga0068854_1003301562 164
249 3300005615 Ga0070702_100858535 Ga0070702_1008585351 164
250 3300005617 Ga0068859_100123694 Ga0068859_1001236942 164
251 3300005618 Ga0068864_100077420 Ga0068864_1000774202 164
252 3300005718 Ga0068866_10019072 Ga0068866_100190724 164
253 3300005841 Ga0068863_100305775 Ga0068863_1003057753 164
254 3300005842 Ga0068858_100071439 Ga0068858_1000714392 164
255 3300006173 Ga0070716_100574222 Ga0070716_1005742222 164
256 3300006358 Ga0068871_100066465 Ga0068871_1000664655 164
257 3300006358 Ga0068871_100083716 Ga0068871_1000837163 164
258 3300006852 Ga0075433_10903248 Ga0075433_109032481 164
259 3300006931 Ga0097620_100123702 Ga0097620_1001237023 164
260 3300009177 Ga0105248_10040548 Ga0105248_100405484 164
261 3300013105 Ga0157369_11609155 Ga0157369_116091551 164
262 3300013296 Ga0157374_10028184 Ga0157374_100281845 164
263 3300013297 Ga0157378_10039678 Ga0157378_100396785 164
264 3300013306 Ga0163162_10070244 Ga0163162_100702444 164
265 3300013308 Ga0157375_10037836 Ga0157375_100378362 164
266 3300014325 Ga0163163_10006642 Ga0163163_100066425 164
267 3300014969 Ga0157376_10111341 Ga0157376_101113413 164
268 3300014969 Ga0157376_10130022 Ga0157376_101300222 164
269 3300025908 Ga0207643_10148970 Ga0207643_101489702 164
270 3300025926 Ga0207659_10519551 Ga0207659_105195512 164
271 3300025942 Ga0207689_10206588 Ga0207689_102065882 164
272 3300025945 Ga0207679_10421130 Ga0207679_104211302 164
273 3300025960 Ga0207651_10754638 Ga0207651_107546382 164
274 3300026035 Ga0207703_10415683 Ga0207703_104156832 164
275 3300026088 Ga0207641_10514271 Ga0207641_105142712 164
276 3300026095 Ga0207676_10596746 Ga0207676_105967462 164
277 3300032126 Ga0307415_100843080 Ga0307415_1008430801 164
278 3300036401 Ga0373937_0140434 Ga0373937_0140434_664_1161 164
279 3300046473 Ga0495582_0398430 Ga0495582_0398430_86_583 164
280 3300050515 nmdc:mga0a205_1172851_c1 nmdc:mga0a205_1172851_c1_43_546 164

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hkv-assembly1.cif.gz_A-2 crystal structure of a putative member of the dinb family (exig_1237) from exiguobacterium sibiricum 255-15 at 1.70 a resolution 0.8011 10 138
8fx9-assembly1.cif.gz_A-2 crystal strucutre of mycobacterium tuberculosis mycothiol-s-transferase enzyme 0.7801 1 132
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.7789 14 134
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.778 21 137
3dka-assembly1.cif.gz_B crystal structure of a dinb-like protein (yjoa, bsu12410) from bacillus subtilis at 2.30 a resolution 0.7454 12 137
ID Description Score Start End Superfamily
af_O53728_4_171_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8229 9 133 1.20.120.450
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7839 10 135 1.20.120.450
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7684 17 130 1.20.120.450
af_O05777_10_164_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7298 11 130 1.20.120.450
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7188 10 135 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A537JVW4-F1-model_v4 DinB family protein 0.9826 9 126
AF-A0A2V7V500-F1-model_v4 DinB-like domain-containing protein 0.9709 3 164
AF-A0A2V9YUY0-F1-model_v4 DinB-like domain-containing protein 0.9695 14 164
AF-A0A2V9KQC7-F1-model_v4 DinB-like domain-containing protein 0.9691 7 164
AF-A0A321LFL3-F1-model_v4 DinB-like domain-containing protein 0.967 5 164

Feature Viewer

pLDDT pTM Quality
92.93 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map