F383586

General Info

Members Datasets Scaffolds Average Seq Length
280 225 560 361

Family's Representative Sequence

Representative Sequence 3300006353|Ga0075370_10054727|Ga0075370_100547272
Length 387
Sequence MTLSPLDDYPVHQIAETIRHVGTSDRNFYDRYYFNCHAGVDGDTEPLFLIIGLGQYPNLGVCDGFAVLRRGEDHIVFRASRALGDDRMDLSVGPLRIEIIEGLHRLRVVLDPSPEAPDLSFDLTFESDGPANLEARHFHRQLERVTFDTQRFVQTGTWSGSLTVDGDVIPVTPETWRGNRDRSWGVRPVGEAEPPGRKADPAIAGSQNFFWIYSIMQFGDFTIVTIVQEDQQGRRILEDATRVWADRSREPEWLGRPDHQLTFISGTREVKSGTLYFRRPGAPGESDHILEITCEPILPNYIGVGTGYGLEQDWRHGMWQGELVVQGLREKVSDIESWKKMLCPVDNLARFTLVEDGVTRTGTGLFEVAVIGPHQRYGFTGIGDVAP

Samples

Sample ID Description Type Environment
1 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
52 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
53 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
103 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
104 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
105 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
106 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
110 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
113 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
114 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
115 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
118 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
119 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
120 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
121 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
122 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
123 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
124 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
131 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
137 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
152 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
153 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
160 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
164 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
167 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
168 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
178 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
179 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
205 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
206 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
207 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
208 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
209 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
210 2547132424 Nocardia nova SH22a Isolate Unclassified
211 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
212 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
213 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
214 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
215 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
216 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
217 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
218 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
219 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
220 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
221 2922554459 Rhodococcus sp. 66b Isolate Unclassified
222 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
223 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
224 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
225 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.5
Metatranscriptomes 0.36
Isolates 7.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.07
Nodule 0
Rhizoplane 4.64
Rhizosphere 87.14
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075370_10054727 3300006353 Bacteria 2266
2 Ga0070683_100033592 3300005329 Bacteria 4679
3 Ga0070683_100416748 3300005329 Bacteria 1281
4 Ga0070690_100040234 3300005330 Bacteria 2956
5 Ga0070666_10032151 3300005335 Bacteria 3466
6 Ga0070680_100000063 3300005336 Bacteria 55957
7 Ga0070680_100264901 3300005336 Bacteria 1454
8 Ga0070682_100171164 3300005337 Bacteria 1509
9 Ga0070691_10067317 3300005341 Bacteria 1732
10 Ga0070687_100120932 3300005343 Bacteria 1497
11 Ga0070692_10184285 3300005345 Bacteria 1212
12 Ga0070675_100022088 3300005354 Bacteria 5084
13 Ga0070671_100245733 3300005355 Bacteria 1519
14 Ga0070673_100121380 3300005364 Bacteria 2180
15 Ga0070703_10005764 3300005406 Bacteria 3470
16 Ga0070714_100048854 3300005435 Bacteria 3600
17 Ga0070701_10024032 3300005438 Bacteria 2944
18 Ga0070700_100049431 3300005441 Bacteria 2611
19 Ga0070700_100173300 3300005441 Bacteria 1495
20 Ga0070708_100198716 3300005445 Bacteria 1876
21 Ga0070663_100022615 3300005455 Bacteria 4206
22 Ga0070662_100322530 3300005457 Bacteria 1260
23 Ga0070681_10021332 3300005458 Bacteria 6494
24 Ga0070681_10209738 3300005458 Bacteria 1864
25 Ga0068867_100107874 3300005459 Bacteria 2135
26 Ga0070685_10056949 3300005466 Bacteria 2274
27 Ga0070707_100290889 3300005468 Bacteria 1587
28 Ga0070699_100005793 3300005518 Bacteria 10809
29 Ga0070679_100000048 3300005530 Bacteria 89533
30 Ga0070679_100392255 3300005530 Bacteria 1334
31 Ga0070684_100009675 3300005535 Bacteria 7604
32 Ga0070697_100003945 3300005536 Bacteria 11400
33 Ga0068855_100003842 3300005563 Bacteria 18362
34 Ga0070664_100030477 3300005564 Bacteria 4500
35 Ga0068854_100004296 3300005578 Bacteria 8979
36 Ga0068854_100024177 3300005578 Bacteria 4157
37 Ga0068856_100170182 3300005614 Bacteria 2190
38 Ga0068852_100029591 3300005616 Bacteria 4501
39 Ga0068866_10039768 3300005718 Bacteria 2324
40 Ga0068861_100040719 3300005719 Bacteria 3476
41 Ga0068860_100489223 3300005843 Bacteria 1227
42 Ga0081455_10004752 3300005937 Bacteria 15099
43 Ga0075363_100005552 3300006048 Bacteria 5623
44 Ga0070715_10031020 3300006163 Bacteria 2166
45 Ga0075428_100000002 3300006844 Bacteria 546374
46 Ga0075434_100204542 3300006871 Bacteria 1995
47 Ga0075435_100179967 3300007076 Bacteria 1786
48 Ga0105240_10012678 3300009093 Bacteria 11617
49 Ga0111539_10184470 3300009094 Bacteria 2437
50 Ga0105243_10001522 3300009148 Bacteria 20250
51 Ga0105243_10056404 3300009148 Bacteria 3124
52 Ga0105243_10462230 3300009148 Bacteria 1193
53 Ga0105241_10000451 3300009174 Bacteria 30933
54 Ga0105241_10016609 3300009174 Bacteria 5401
55 Ga0105248_10337887 3300009177 Bacteria 1696
56 Ga0105237_10029824 3300009545 Bacteria 5541
57 Ga0105238_10158271 3300009551 Bacteria 2240
58 Ga0105249_10217971 3300009553 Bacteria 1876
59 Ga0105239_10019774 3300010375 Bacteria 7433
60 Ga0105239_10341976 3300010375 Bacteria 1689
61 Ga0157342_1000358 3300012507 Bacteria 2679
62 Ga0157326_1005421 3300012513 Bacteria 1349
63 Ga0157338_1000247 3300012515 Bacteria 2887
64 Ga0157371_10066904 3300013102 Bacteria 2544
65 Ga0157378_10500053 3300013297 Bacteria 1214
66 Ga0163162_10554422 3300013306 Bacteria 1277
67 Ga0157372_10214082 3300013307 Bacteria 2233
68 Ga0157375_10119947 3300013308 Bacteria 2738
69 Ga0163163_10121716 3300014325 Bacteria 2643
70 Ga0157377_10115669 3300014745 Bacteria 1618
71 Ga0157379_10072391 3300014968 Bacteria 3083
72 Ga0163161_10068205 3300017792 Bacteria 2598
73 Ga0206354_11682289 3300020081 Bacteria 1220
74 Ga0207653_10008898 3300025885 Bacteria 3131
75 Ga0207642_10022386 3300025899 Bacteria 2505
76 Ga0207710_10010820 3300025900 Bacteria 3842
77 Ga0207688_10031104 3300025901 Bacteria 2945
78 Ga0207647_10132366 3300025904 Bacteria 1465
79 Ga0207699_10011294 3300025906 Bacteria 4505
80 Ga0207645_10048822 3300025907 Bacteria 2703
81 Ga0207645_10087897 3300025907 Bacteria 1997
82 Ga0207684_10079694 3300025910 Bacteria 2786
83 Ga0207654_10032156 3300025911 Bacteria 2896
84 Ga0207707_10000185 3300025912 Bacteria 65663
85 Ga0207695_10006392 3300025913 Bacteria 15327
86 Ga0207671_10000084 3300025914 Bacteria 143562
87 Ga0207671_10286681 3300025914 Bacteria 1300
88 Ga0207663_10041496 3300025916 Bacteria 2804
89 Ga0207660_10002281 3300025917 Bacteria 12637
90 Ga0207657_10006126 3300025919 Bacteria 12501
91 Ga0207652_10000575 3300025921 Bacteria 36922
92 Ga0207646_10049208 3300025922 Bacteria 3776
93 Ga0207694_10003303 3300025924 Bacteria 12832
94 Ga0207659_10112995 3300025926 Bacteria 2068
95 Ga0207700_10016034 3300025928 Bacteria 4966
96 Ga0207706_10032270 3300025933 Bacteria 4664
97 Ga0207686_10034313 3300025934 Bacteria 3036
98 Ga0207686_10122851 3300025934 Bacteria 1769
99 Ga0207670_10172069 3300025936 Bacteria 1625
100 Ga0207665_10003662 3300025939 Bacteria 10263
101 Ga0207661_10377894 3300025944 Bacteria 1282
102 Ga0207667_10050316 3300025949 Bacteria 4397
103 Ga0207651_10091971 3300025960 Bacteria 2223
104 Ga0207640_10087306 3300025981 Bacteria 2150
105 Ga0207658_10331902 3300025986 Bacteria 1319
106 Ga0207678_10004846 3300026067 Bacteria 12088
107 Ga0207708_10027044 3300026075 Bacteria 4343
108 Ga0207708_10257714 3300026075 Bacteria 1407
109 Ga0207702_10287765 3300026078 Bacteria 1556
110 Ga0207648_10075321 3300026089 Bacteria 2942
111 Ga0207674_10002311 3300026116 Bacteria 24151
112 Ga0207675_100016192 3300026118 Bacteria 6962
113 Ga0207683_10001679 3300026121 Bacteria 19814
114 Ga0268266_10341041 3300028379 Bacteria 1406
115 Ga0265338_10019845 3300028800 Bacteria 7104
116 Ga0265338_10025401 3300028800 Bacteria 6010
117 Ga0265320_10028026 3300031240 Bacteria 2929
118 Ga0265325_10000193 3300031241 Bacteria 43575
119 Ga0265325_10047585 3300031241 Bacteria 2219
120 Ga0265329_10037827 3300031242 Bacteria 1554
121 Ga0265340_10000075 3300031247 Bacteria 47375
122 Ga0265339_10001575 3300031249 Bacteria 16860
123 Ga0265339_10055629 3300031249 Bacteria 2145
124 Ga0265327_10000018 3300031251 Bacteria 439197
125 Ga0265327_10000332 3300031251 Bacteria 89606
126 Ga0265327_10000477 3300031251 Bacteria 70613
127 Ga0265316_10030874 3300031344 Bacteria 4387
128 Ga0265313_10022924 3300031595 Bacteria 3375
129 Ga0265313_10024078 3300031595 Bacteria 3260
130 Ga0316579_10048880 3300031691 Bacteria 1977
131 Ga0265314_10093969 3300031711 Bacteria 1945
132 Ga0316578_10007358 3300031728 Bacteria 5514
133 Ga0373944_0001125 3300035089 Bacteria 6658
134 Ga0373952_0011265 3300035092 Bacteria 1742
135 Ga0373923_0001703 3300035111 Bacteria 6447
136 Ga0373936_0001553 3300035113 Bacteria 8365
137 Ga0373939_0015230 3300035114 Bacteria 2009
138 Ga0373945_0000037 3300035116 Bacteria 27472
139 Ga0373954_0005083 3300035118 Bacteria 5673
140 Ga0373956_0003137 3300035119 Bacteria 6683
141 Ga0373957_0033127 3300035120 Bacteria 1907
142 Ga0373946_0000148 3300035171 Bacteria 21418
143 Ga0373955_0007368 3300035172 Bacteria 5055
144 Ga0373955_0077927 3300035172 Bacteria 1867
145 Ga0316574_0022458 3300035398 Bacteria 3755
146 Ga0373931_0010119 3300035691 Bacteria 4524
147 Ga0373927_0011718 3300035695 Bacteria 5837
148 Ga0373933_0025546 3300035724 Bacteria 3388
149 Ga0373947_0003766 3300035725 Bacteria 8946
150 Ga0373937_0035000 3300036401 Bacteria 4568
151 Ga0373937_0144846 3300036401 Bacteria 2223
152 Ga0316582_0075725 3300036647 Bacteria 2187
153 Ga0316584_0052218 3300036712 Bacteria 3057
154 Ga0373925_0001109 3300037068 Bacteria 23991
155 Ga0373925_0200652 3300037068 Bacteria 1586
156 Ga0436364_0507161 3300037853 Bacteria 2357
157 Ga0400483_104869 3300039062 Bacteria 3378
158 Ga0400483_264986 3300039062 Bacteria 2610
159 Ga0436365_0229625 3300039437 Bacteria 76076
160 Ga0466969_0005944 3300044656 Bacteria 6493
161 Ga0466966_0060653 3300044684 Bacteria 2387
162 Ga0466961_0053614 3300044693 Bacteria 2573
163 Ga0466961_0080922 3300044693 Bacteria 2056
164 Ga0466968_0105087 3300044735 Bacteria 1264
165 Ga0466970_0005782 3300044765 Bacteria 6148
166 Ga0466970_0069461 3300044765 Bacteria 1894
167 Ga0466957_0008093 3300044842 Bacteria 5966
168 Ga0466957_0159574 3300044842 Bacteria 1464
169 Ga0466958_0180563 3300045836 Bacteria 1339
170 Ga0466967_0090875 3300045976 Bacteria 2774
171 Ga0495603_0011946 3300046455 Bacteria 5254
172 Ga0495629_0001409 3300046459 Bacteria 18957
173 Ga0495641_0014536 3300046461 Bacteria 4253
174 Ga0495651_0008200 3300046462 Bacteria 8008
175 Ga0495651_0077270 3300046462 Bacteria 2520
176 Ga0495653_0040457 3300046463 Bacteria 3642
177 Ga0495580_0005683 3300046472 Bacteria 10258
178 Ga0495580_0169410 3300046472 Bacteria 1510
179 Ga0495582_0004237 3300046473 Bacteria 8069
180 Ga0495639_0006402 3300046475 Bacteria 5064
181 Ga0495662_0000105 3300046476 Bacteria 30869
182 Ga0495594_0003576 3300046499 Bacteria 7996
183 Ga0495608_0003532 3300046511 Bacteria 11200
184 Ga0495618_0016762 3300046514 Bacteria 4487
185 Ga0495628_0024870 3300046516 Bacteria 4898
186 Ga0495628_0373068 3300046516 Bacteria 1046
187 Ga0495630_0000458 3300046517 Bacteria 30835
188 Ga0495652_0033416 3300046529 Bacteria 4490
189 Ga0495652_0040239 3300046529 Bacteria 4039
190 Ga0495665_0000634 3300046531 Bacteria 17918
191 Ga0495665_0005499 3300046531 Bacteria 6823
192 Ga0495640_0001207 3300046533 Bacteria 20212
193 Ga0495587_0002000 3300046536 Bacteria 13591
194 Ga0495587_0033781 3300046536 Bacteria 3086
195 Ga0495587_0186495 3300046536 Bacteria 1175
196 Ga0495645_0003900 3300046543 Bacteria 10167
197 Ga0495667_0022161 3300046559 Bacteria 4280
198 Ga0495668_0000204 3300046616 Bacteria 86683
199 Ga0495668_0000736 3300046616 Bacteria 39225
200 Ga0495635_0001353 3300046663 Bacteria 16310
201 Ga0495588_0040110 3300046674 Bacteria 2387
202 Ga0495657_0005413 3300046675 Bacteria 10106
203 Ga0495623_0020114 3300046679 Bacteria 4315
204 Ga0495658_0059457 3300046683 Bacteria 2189
205 Ga0495613_0017173 3300046689 Bacteria 5388
206 Ga0495613_0055791 3300046689 Bacteria 2902
207 Ga0495624_0006358 3300046690 Bacteria 8388
208 Ga0495600_0022596 3300046809 Bacteria 4039
209 Ga0495600_0048822 3300046809 Bacteria 2761
210 Ga0495600_0291200 3300046809 Bacteria 1032
211 Ga0495581_0001060 3300047315 Bacteria 14908
212 Ga0495604_0013878 3300047317 Bacteria 6426
213 Ga0495604_0028280 3300047317 Bacteria 4459
214 Ga0495674_0007962 3300047319 Bacteria 10116
215 Ga0495680_0004542 3300047322 Bacteria 13260
216 Ga0495680_0140750 3300047322 Bacteria 1765
217 Ga0495683_0000352 3300047323 Bacteria 38035
218 Ga0495675_0019410 3300047444 Bacteria 4319
219 Ga0495593_0000457 3300047673 Bacteria 22884
220 Ga0495602_0020027 3300048088 Bacteria 6621
221 Ga0495602_0113860 3300048088 Bacteria 2191
222 Ga0495614_0001573 3300048089 Bacteria 9908
223 Ga0496102_0223001 3300048905 Bacteria 1777
224 Ga0496103_0050881 3300048906 Bacteria 2563
225 Ga0496104_0135095 3300048907 Bacteria 2369
226 Ga0496105_0030860 3300048908 Bacteria 4393
227 Ga0496107_0058442 3300048910 Bacteria 2788
228 Ga0496108_0020851 3300048911 Bacteria 5390
229 Ga0496108_0075281 3300048911 Bacteria 2852
230 Ga0496109_0101893 3300048912 Bacteria 2665
231 Ga0496110_0035191 3300048913 Bacteria 4343
232 Ga0496111_0012407 3300048914 Bacteria 5768
233 Ga0496112_0232344 3300048915 Bacteria 1798
234 Ga0496115_0029749 3300048918 Bacteria 4292
235 Ga0496115_0185110 3300048918 Bacteria 1721
236 Ga0496125_0016435 3300048928 Bacteria 7104
237 Ga0496125_0139823 3300048928 Bacteria 1685
238 Ga0496126_0000055 3300048929 Bacteria 297958
239 Ga0501033_0001753 3300049570 Bacteria 18996
240 Ga0501034_0106769 3300049571 Bacteria 2793
241 Ga0501034_0112860 3300049571 Bacteria 2708
242 Ga0501047_0122345 3300049581 Bacteria 2484
243 Ga0501069_0035014 3300049585 Bacteria 2765
244 Ga0501070_0017775 3300049586 Bacteria 5971
245 Ga0501070_0051621 3300049586 Bacteria 3413
246 Ga0501070_0124133 3300049586 Bacteria 2134
247 Ga0501070_0167684 3300049586 Bacteria 1809
248 Ga0501074_0005974 3300049590 Bacteria 8782
249 Ga0501079_0003273 3300049741 Bacteria 11866
250 Ga0501080_0002610 3300049742 Bacteria 15781
251 Ga0501080_0005958 3300049742 Bacteria 10924
252 Ga0501044_0004882 3300049823 Bacteria 14986
253 Ga0501044_0089435 3300049823 Bacteria 3108
254 Ga0495601_0000721 3300053077 Bacteria 17765
255 Ga0495612_0002556 3300053078 Bacteria 7506
256 Ga0495595_0003502 3300053084 Bacteria 6233
257 Ga0495595_0044041 3300053084 Bacteria 2049
258 Ga0495619_0115174 3300053085 Bacteria 1839
259 Ga0495619_0208327 3300053085 Bacteria 1354
260 Ga0500616_0000434 3300053153 Bacteria 55298
261 2523385440 2523231044 Bacteria 6434991
262 2548697775 2547132424 Bacteria 8348532
263 2552109388 2551306166 Bacteria 9731570
264 2566996233 2565956761 Bacteria 6601618
265 2566997195 2565956761 Bacteria 6601618
266 2738890686 2738541308 Bacteria 7020677
267 2738890849 2738541308 Bacteria 7020677
268 2739207031 2738543005 Bacteria 5278128
269 2739237732 2738543011 Bacteria 5731169
270 2842891897 2842888712 Bacteria 4279094
271 2889304910 2889300758 Bacteria 5690814
272 2895436711 2895427314 Bacteria 13147766
273 2904536322 2904535858 Bacteria 6308016
274 2904540870 2904535858 Bacteria 6308016
275 2919716034 2919713450 Bacteria 7431245
276 2922558262 2922554459 Bacteria 6683962
277 2928143998 2928142448 Bacteria 5288925
278 2939746490 2939743619 Bacteria 5762299
279 8055068139 8055066027 Bacteria 9479577
280 8055178175 8055172936 Bacteria 9305943
281 Ga0075370_10054727
282 Ga0070683_100033592
283 Ga0070683_100416748
284 Ga0070690_100040234
285 Ga0070666_10032151
286 Ga0070680_100000063
287 Ga0070680_100264901
288 Ga0070682_100171164
289 Ga0070691_10067317
290 Ga0070687_100120932
291 Ga0070692_10184285
292 Ga0070675_100022088
293 Ga0070671_100245733
294 Ga0070673_100121380
295 Ga0070703_10005764
296 Ga0070714_100048854
297 Ga0070701_10024032
298 Ga0070700_100049431
299 Ga0070700_100173300
300 Ga0070708_100198716
301 Ga0070663_100022615
302 Ga0070662_100322530
303 Ga0070681_10021332
304 Ga0070681_10209738
305 Ga0068867_100107874
306 Ga0070685_10056949
307 Ga0070707_100290889
308 Ga0070699_100005793
309 Ga0070679_100000048
310 Ga0070679_100392255
311 Ga0070684_100009675
312 Ga0070697_100003945
313 Ga0068855_100003842
314 Ga0070664_100030477
315 Ga0068854_100004296
316 Ga0068854_100024177
317 Ga0068856_100170182
318 Ga0068852_100029591
319 Ga0068866_10039768
320 Ga0068861_100040719
321 Ga0068860_100489223
322 Ga0081455_10004752
323 Ga0075363_100005552
324 Ga0070715_10031020
325 Ga0075428_100000002
326 Ga0075434_100204542
327 Ga0075435_100179967
328 Ga0105240_10012678
329 Ga0111539_10184470
330 Ga0105243_10001522
331 Ga0105243_10056404
332 Ga0105243_10462230
333 Ga0105241_10000451
334 Ga0105241_10016609
335 Ga0105248_10337887
336 Ga0105237_10029824
337 Ga0105238_10158271
338 Ga0105249_10217971
339 Ga0105239_10019774
340 Ga0105239_10341976
341 Ga0157342_1000358
342 Ga0157326_1005421
343 Ga0157338_1000247
344 Ga0157371_10066904
345 Ga0157378_10500053
346 Ga0163162_10554422
347 Ga0157372_10214082
348 Ga0157375_10119947
349 Ga0163163_10121716
350 Ga0157377_10115669
351 Ga0157379_10072391
352 Ga0163161_10068205
353 Ga0206354_11682289
354 Ga0207653_10008898
355 Ga0207642_10022386
356 Ga0207710_10010820
357 Ga0207688_10031104
358 Ga0207647_10132366
359 Ga0207699_10011294
360 Ga0207645_10048822
361 Ga0207645_10087897
362 Ga0207684_10079694
363 Ga0207654_10032156
364 Ga0207707_10000185
365 Ga0207695_10006392
366 Ga0207671_10000084
367 Ga0207671_10286681
368 Ga0207663_10041496
369 Ga0207660_10002281
370 Ga0207657_10006126
371 Ga0207652_10000575
372 Ga0207646_10049208
373 Ga0207694_10003303
374 Ga0207659_10112995
375 Ga0207700_10016034
376 Ga0207706_10032270
377 Ga0207686_10034313
378 Ga0207686_10122851
379 Ga0207670_10172069
380 Ga0207665_10003662
381 Ga0207661_10377894
382 Ga0207667_10050316
383 Ga0207651_10091971
384 Ga0207640_10087306
385 Ga0207658_10331902
386 Ga0207678_10004846
387 Ga0207708_10027044
388 Ga0207708_10257714
389 Ga0207702_10287765
390 Ga0207648_10075321
391 Ga0207674_10002311
392 Ga0207675_100016192
393 Ga0207683_10001679
394 Ga0268266_10341041
395 Ga0265338_10019845
396 Ga0265338_10025401
397 Ga0265320_10028026
398 Ga0265325_10000193
399 Ga0265325_10047585
400 Ga0265329_10037827
401 Ga0265340_10000075
402 Ga0265339_10001575
403 Ga0265339_10055629
404 Ga0265327_10000018
405 Ga0265327_10000332
406 Ga0265327_10000477
407 Ga0265316_10030874
408 Ga0265313_10022924
409 Ga0265313_10024078
410 Ga0316579_10048880
411 Ga0265314_10093969
412 Ga0316578_10007358
413 Ga0373944_0001125
414 Ga0373952_0011265
415 Ga0373923_0001703
416 Ga0373936_0001553
417 Ga0373939_0015230
418 Ga0373945_0000037
419 Ga0373954_0005083
420 Ga0373956_0003137
421 Ga0373957_0033127
422 Ga0373946_0000148
423 Ga0373955_0007368
424 Ga0373955_0077927
425 Ga0316574_0022458
426 Ga0373931_0010119
427 Ga0373927_0011718
428 Ga0373933_0025546
429 Ga0373947_0003766
430 Ga0373937_0035000
431 Ga0373937_0144846
432 Ga0316582_0075725
433 Ga0316584_0052218
434 Ga0373925_0001109
435 Ga0373925_0200652
436 Ga0436364_0507161
437 Ga0400483_104869
438 Ga0400483_264986
439 Ga0436365_0229625
440 Ga0466969_0005944
441 Ga0466966_0060653
442 Ga0466961_0053614
443 Ga0466961_0080922
444 Ga0466968_0105087
445 Ga0466970_0005782
446 Ga0466970_0069461
447 Ga0466957_0008093
448 Ga0466957_0159574
449 Ga0466958_0180563
450 Ga0466967_0090875
451 Ga0495603_0011946
452 Ga0495629_0001409
453 Ga0495641_0014536
454 Ga0495651_0008200
455 Ga0495651_0077270
456 Ga0495653_0040457
457 Ga0495580_0005683
458 Ga0495580_0169410
459 Ga0495582_0004237
460 Ga0495639_0006402
461 Ga0495662_0000105
462 Ga0495594_0003576
463 Ga0495608_0003532
464 Ga0495618_0016762
465 Ga0495628_0024870
466 Ga0495628_0373068
467 Ga0495630_0000458
468 Ga0495652_0033416
469 Ga0495652_0040239
470 Ga0495665_0000634
471 Ga0495665_0005499
472 Ga0495640_0001207
473 Ga0495587_0002000
474 Ga0495587_0033781
475 Ga0495587_0186495
476 Ga0495645_0003900
477 Ga0495667_0022161
478 Ga0495668_0000204
479 Ga0495668_0000736
480 Ga0495635_0001353
481 Ga0495588_0040110
482 Ga0495657_0005413
483 Ga0495623_0020114
484 Ga0495658_0059457
485 Ga0495613_0017173
486 Ga0495613_0055791
487 Ga0495624_0006358
488 Ga0495600_0022596
489 Ga0495600_0048822
490 Ga0495600_0291200
491 Ga0495581_0001060
492 Ga0495604_0013878
493 Ga0495604_0028280
494 Ga0495674_0007962
495 Ga0495680_0004542
496 Ga0495680_0140750
497 Ga0495683_0000352
498 Ga0495675_0019410
499 Ga0495593_0000457
500 Ga0495602_0020027
501 Ga0495602_0113860
502 Ga0495614_0001573
503 Ga0496102_0223001
504 Ga0496103_0050881
505 Ga0496104_0135095
506 Ga0496105_0030860
507 Ga0496107_0058442
508 Ga0496108_0020851
509 Ga0496108_0075281
510 Ga0496109_0101893
511 Ga0496110_0035191
512 Ga0496111_0012407
513 Ga0496112_0232344
514 Ga0496115_0029749
515 Ga0496115_0185110
516 Ga0496125_0016435
517 Ga0496125_0139823
518 Ga0496126_0000055
519 Ga0501033_0001753
520 Ga0501034_0106769
521 Ga0501034_0112860
522 Ga0501047_0122345
523 Ga0501069_0035014
524 Ga0501070_0017775
525 Ga0501070_0051621
526 Ga0501070_0124133
527 Ga0501070_0167684
528 Ga0501074_0005974
529 Ga0501079_0003273
530 Ga0501080_0002610
531 Ga0501080_0005958
532 Ga0501044_0004882
533 Ga0501044_0089435
534 Ga0495601_0000721
535 Ga0495612_0002556
536 Ga0495595_0003502
537 Ga0495595_0044041
538 Ga0495619_0115174
539 Ga0495619_0208327
540 Ga0500616_0000434
541 2523385440
542 2548697775
543 2552109388
544 2566996233
545 2566997195
546 2738890686
547 2738890849
548 2739207031
549 2739237732
550 2842891897
551 2889304910
552 2895436711
553 2904536322
554 2904540870
555 2919716034
556 2922558262
557 2928143998
558 2939746490
559 8055068139
560 8055178175

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hdj-assembly1.cif.gz_B the crystal structure of probable ornithine cyclodeaminase from bordetella pertussis tohama i 0.7468 41 78
2i99-assembly1.cif.gz_B crystal structure of human mu_crystallin at 2.6 angstrom 0.7449 32 78
2ich-assembly2.cif.gz_B crystal structure of a putative atth (ne1406) from nitrosomonas europaea at 2.00 a resolution 0.6416 33 344
2ich-assembly2.cif.gz_B crystal structure of a putative atth (ne1406) from nitrosomonas europaea at 2.00 a resolution 0.5946 33 344
2ich-assembly1.cif.gz_A crystal structure of a putative atth (ne1406) from nitrosomonas europaea at 2.00 a resolution 0.5407 3 342
ID Description Score Start End Superfamily
af_O53319_32_180_3.40.960.10 Alpha Beta;3-Layer(aba) Sandwich;Endonuclease; Chain A;VSR Endonuclease 0.9564 33 173 3.40.960.10
af_O53319_32_180_3.40.960.10 Alpha Beta;3-Layer(aba) Sandwich;Endonuclease; Chain A;VSR Endonuclease 0.8947 33 173 3.40.960.10
af_Q8I7C6_238_319_2.20.140.10 Mainly Beta;Single Sheet;q64v53_bacfr protein fold;WGR domain 0.7868 43 80 2.20.140.10
3hdjB01 Alpha Beta;2-Layer Sandwich;ornithine cyclodeaminase, domain 1;ornithine cyclodeaminase, domain 1 0.7468 41 78 3.30.1780.10
af_A0A0G2K4Q7_1684_2098_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7447 42 82 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A6N9Y3X2-F1-model_v4 deleted 0.9642 84 152
AF-A0A6N9Y3X2-F1-model_v4 deleted 0.9509 84 152
AF-A0A352CA30-F1-model_v4 phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (Phosphoribosyl-aminoimidazole synthetase) 0.9335 21 166 GO:0004637
GO:0004641
GO:0005524
GO:0005829
GO:0006189
GO:0046084
AF-A0A1V3XZL1-F1-model_v4 Uncharacterized protein 0.9157 193 349
AF-A0A6J7AMN5-F1-model_v4 Unannotated protein 0.9114 37 348

Map