F383570
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 280 | 182 | 280 | 92 |
Family's Representative Sequence
| Representative Sequence | 3300005985|Ga0081539_10002592|Ga0081539_100025922 |
| Length | 93 |
| Sequence | MTRDVDPIAKVLHDAAELHHAVWRDTDGDDPDWASWYADWLVGHSELPALLDAAPIRSHLVHALVELDREHGPGAGWEAAYARGLVARFAAEE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 20 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 26 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 27 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 28 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 29 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 30 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 31 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 32 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 33 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 34 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 35 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 37 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 38 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 39 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 41 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 42 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 64 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 68 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 94 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 95 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 96 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 97 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 98 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 99 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 100 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 101 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 102 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 103 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 104 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 105 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 106 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 107 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 108 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 109 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 110 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 111 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 112 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 113 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 114 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 115 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 116 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 117 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 118 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 119 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 120 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 121 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 122 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 123 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 124 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 125 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 134 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 135 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 136 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 137 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 138 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 139 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 140 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 141 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 142 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 143 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 174 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 175 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.79 |
| Nodule | 0 |
| Rhizoplane | 7.5 |
| Rhizosphere | 89.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10629055 | 3300005327 | Bacteria | 931 |
| 2 | Ga0070658_10872974 | 3300005327 | Bacteria | 782 |
| 3 | Ga0070683_100220987 | 3300005329 | Bacteria | 1800 |
| 4 | Ga0070683_101016694 | 3300005329 | Bacteria | 796 |
| 5 | Ga0070683_102025040 | 3300005329 | Bacteria | 553 |
| 6 | Ga0070690_100566104 | 3300005330 | Bacteria | 858 |
| 7 | Ga0070670_100064618 | 3300005331 | Bacteria | 3140 |
| 8 | Ga0070670_100409297 | 3300005331 | Bacteria | 1198 |
| 9 | Ga0068868_100123837 | 3300005338 | Bacteria | 2110 |
| 10 | Ga0068868_100750214 | 3300005338 | Bacteria | 877 |
| 11 | Ga0070660_100008163 | 3300005339 | Bacteria | 7317 |
| 12 | Ga0070660_100084956 | 3300005339 | Bacteria | 2488 |
| 13 | Ga0070689_100057789 | 3300005340 | Bacteria | 3012 |
| 14 | Ga0070674_100068014 | 3300005356 | Bacteria | 2508 |
| 15 | Ga0070688_100323192 | 3300005365 | Unclassified | 1122 |
| 16 | Ga0070659_101649557 | 3300005366 | Bacteria | 573 |
| 17 | Ga0070667_101383623 | 3300005367 | Bacteria | 660 |
| 18 | Ga0070709_10743148 | 3300005434 | Unclassified | 766 |
| 19 | Ga0070714_100072342 | 3300005435 | Bacteria | 2984 |
| 20 | Ga0070714_100228759 | 3300005435 | Bacteria | 1712 |
| 21 | Ga0070714_100321275 | 3300005435 | Bacteria | 1448 |
| 22 | Ga0070710_10630996 | 3300005437 | Bacteria | 749 |
| 23 | Ga0070711_101167987 | 3300005439 | Unclassified | 665 |
| 24 | Ga0070678_101319106 | 3300005456 | Bacteria | 672 |
| 25 | Ga0070678_102039226 | 3300005456 | Unclassified | 543 |
| 26 | Ga0070678_102070851 | 3300005456 | Unclassified | 539 |
| 27 | Ga0070662_100232962 | 3300005457 | Bacteria | 1474 |
| 28 | Ga0070681_10024721 | 3300005458 | Bacteria | 6043 |
| 29 | Ga0068867_100056440 | 3300005459 | Unclassified | 2906 |
| 30 | Ga0068867_100650196 | 3300005459 | Bacteria | 925 |
| 31 | Ga0070707_100648862 | 3300005468 | Bacteria | 1018 |
| 32 | Ga0070684_100888753 | 3300005535 | Bacteria | 834 |
| 33 | Ga0070672_101267014 | 3300005543 | Unclassified | 658 |
| 34 | Ga0070665_100383955 | 3300005548 | Bacteria | 1412 |
| 35 | Ga0070704_102277747 | 3300005549 | Unclassified | 504 |
| 36 | Ga0068855_100050746 | 3300005563 | Bacteria | 4888 |
| 37 | Ga0068855_100390816 | 3300005563 | Bacteria | 1526 |
| 38 | Ga0068857_100319313 | 3300005577 | Bacteria | 1434 |
| 39 | Ga0068857_100397506 | 3300005577 | Bacteria | 1282 |
| 40 | Ga0068854_100362328 | 3300005578 | Bacteria | 1190 |
| 41 | Ga0068859_101474832 | 3300005617 | Bacteria | 751 |
| 42 | Ga0068866_10288523 | 3300005718 | Bacteria | 1020 |
| 43 | Ga0068861_100315251 | 3300005719 | Bacteria | 1360 |
| 44 | Ga0068870_10028503 | 3300005840 | Bacteria | 2804 |
| 45 | Ga0068862_100283975 | 3300005844 | Bacteria | 1518 |
| 46 | Ga0081455_10042405 | 3300005937 | Bacteria | 3992 |
| 47 | Ga0081455_10108252 | 3300005937 | Bacteria | 2214 |
| 48 | Ga0081455_10744675 | 3300005937 | Unclassified | 620 |
| 49 | Ga0081539_10002592 | 3300005985 | Bacteria | 24830 |
| 50 | Ga0081539_10003654 | 3300005985 | Bacteria | 18513 |
| 51 | Ga0070717_10549530 | 3300006028 | Bacteria | 1046 |
| 52 | Ga0075365_10001901 | 3300006038 | Bacteria | 9838 |
| 53 | Ga0075364_10037689 | 3300006051 | Bacteria | 3132 |
| 54 | Ga0075367_10526519 | 3300006178 | Bacteria | 750 |
| 55 | Ga0097621_100193084 | 3300006237 | Unclassified | 1764 |
| 56 | Ga0097621_100782367 | 3300006237 | Bacteria | 883 |
| 57 | Ga0068871_100058757 | 3300006358 | Bacteria | 3132 |
| 58 | Ga0075436_100738760 | 3300006914 | Bacteria | 730 |
| 59 | Ga0097620_101475032 | 3300006931 | Bacteria | 751 |
| 60 | Ga0075435_100482329 | 3300007076 | Bacteria | 1071 |
| 61 | Ga0105240_11606901 | 3300009093 | Bacteria | 680 |
| 62 | Ga0111539_10058188 | 3300009094 | Bacteria | 4586 |
| 63 | Ga0105245_10483325 | 3300009098 | Bacteria | 1252 |
| 64 | Ga0105245_10484165 | 3300009098 | Bacteria | 1251 |
| 65 | Ga0105245_11769550 | 3300009098 | Bacteria | 671 |
| 66 | Ga0105245_11880682 | 3300009098 | Unclassified | 652 |
| 67 | Ga0114129_10637481 | 3300009147 | Bacteria | 1377 |
| 68 | Ga0114129_10795203 | 3300009147 | Unclassified | 1207 |
| 69 | Ga0105243_10221651 | 3300009148 | Unclassified | 1672 |
| 70 | Ga0105243_12387007 | 3300009148 | Bacteria | 567 |
| 71 | Ga0105241_12659375 | 3300009174 | Unclassified | 503 |
| 72 | Ga0105242_10002530 | 3300009176 | Bacteria | 14346 |
| 73 | Ga0105242_10147648 | 3300009176 | Bacteria | 2047 |
| 74 | Ga0105242_11135314 | 3300009176 | Unclassified | 797 |
| 75 | Ga0105248_10341896 | 3300009177 | Bacteria | 1685 |
| 76 | Ga0105248_13062204 | 3300009177 | Bacteria | 532 |
| 77 | Ga0105239_10077436 | 3300010375 | Bacteria | 3659 |
| 78 | Ga0105246_10556529 | 3300011119 | Bacteria | 984 |
| 79 | Ga0105246_10961869 | 3300011119 | Bacteria | 770 |
| 80 | Ga0105246_11351292 | 3300011119 | Bacteria | 663 |
| 81 | Ga0157373_10264240 | 3300013100 | Bacteria | 1218 |
| 82 | Ga0157371_10784365 | 3300013102 | Bacteria | 717 |
| 83 | Ga0157374_12886221 | 3300013296 | Unclassified | 508 |
| 84 | Ga0157378_10213267 | 3300013297 | Bacteria | 1832 |
| 85 | Ga0163162_10488671 | 3300013306 | Unclassified | 1362 |
| 86 | Ga0157372_10268363 | 3300013307 | Bacteria | 1982 |
| 87 | Ga0157375_10867609 | 3300013308 | Bacteria | 1048 |
| 88 | Ga0157375_12127781 | 3300013308 | Bacteria | 668 |
| 89 | Ga0163163_10855920 | 3300014325 | Unclassified | 973 |
| 90 | Ga0157380_10530293 | 3300014326 | Unclassified | 1150 |
| 91 | Ga0157380_10965546 | 3300014326 | Unclassified | 883 |
| 92 | Ga0157380_13071136 | 3300014326 | Unclassified | 532 |
| 93 | Ga0182008_10121225 | 3300014497 | Bacteria | 1300 |
| 94 | Ga0182008_10688973 | 3300014497 | Unclassified | 582 |
| 95 | Ga0157377_10875754 | 3300014745 | Bacteria | 669 |
| 96 | Ga0157379_10031562 | 3300014968 | Bacteria | 4721 |
| 97 | Ga0157376_10161512 | 3300014969 | Bacteria | 2032 |
| 98 | Ga0157376_10226361 | 3300014969 | Bacteria | 1735 |
| 99 | Ga0157376_11713436 | 3300014969 | Archaea | 664 |
| 100 | Ga0157376_12711319 | 3300014969 | Bacteria | 535 |
| 101 | Ga0182006_1099422 | 3300015261 | Bacteria | 1034 |
| 102 | Ga0207642_10546170 | 3300025899 | Bacteria | 715 |
| 103 | Ga0207699_10328519 | 3300025906 | Bacteria | 1075 |
| 104 | Ga0207643_10031514 | 3300025908 | Bacteria | 2956 |
| 105 | Ga0207684_11163978 | 3300025910 | Bacteria | 640 |
| 106 | Ga0207707_10044523 | 3300025912 | Bacteria | 3869 |
| 107 | Ga0207693_10337410 | 3300025915 | Bacteria | 1180 |
| 108 | Ga0207693_10958976 | 3300025915 | Bacteria | 654 |
| 109 | Ga0207660_10043974 | 3300025917 | Bacteria | 3141 |
| 110 | Ga0207657_10005654 | 3300025919 | Bacteria | 13046 |
| 111 | Ga0207681_10562031 | 3300025923 | Bacteria | 940 |
| 112 | Ga0207650_10041615 | 3300025925 | Bacteria | 3368 |
| 113 | Ga0207650_10828578 | 3300025925 | Bacteria | 784 |
| 114 | Ga0207659_11368030 | 3300025926 | Unclassified | 607 |
| 115 | Ga0207687_11155794 | 3300025927 | Bacteria | 665 |
| 116 | Ga0207664_10074342 | 3300025929 | Bacteria | 2745 |
| 117 | Ga0207644_10489850 | 3300025931 | Bacteria | 1013 |
| 118 | Ga0207686_11175490 | 3300025934 | Bacteria | 627 |
| 119 | Ga0207709_10365690 | 3300025935 | Bacteria | 1093 |
| 120 | Ga0207704_10626164 | 3300025938 | Bacteria | 884 |
| 121 | Ga0207665_10623836 | 3300025939 | Bacteria | 843 |
| 122 | Ga0207691_10116664 | 3300025940 | Bacteria | 2369 |
| 123 | Ga0207691_10419081 | 3300025940 | Bacteria | 1141 |
| 124 | Ga0207661_10216738 | 3300025944 | Bacteria | 1690 |
| 125 | Ga0207661_10252271 | 3300025944 | Bacteria | 1569 |
| 126 | Ga0207679_10748113 | 3300025945 | Bacteria | 889 |
| 127 | Ga0207667_10026543 | 3300025949 | Bacteria | 6324 |
| 128 | Ga0207667_11241769 | 3300025949 | Bacteria | 723 |
| 129 | Ga0207640_10915194 | 3300025981 | Bacteria | 767 |
| 130 | Ga0207640_11417820 | 3300025981 | Bacteria | 623 |
| 131 | Ga0207675_100391370 | 3300026118 | Bacteria | 1368 |
| 132 | Ga0207683_10804147 | 3300026121 | Bacteria | 873 |
| 133 | Ga0207683_11214093 | 3300026121 | Unclassified | 699 |
| 134 | Ga0207428_10083646 | 3300027907 | Bacteria | 2488 |
| 135 | Ga0307415_101511211 | 3300032126 | Unclassified | 643 |
| 136 | Ga0373961_0266835 | 3300035241 | Unclassified | 624 |
| 137 | Ga0373931_1295888 | 3300035691 | Unclassified | 501 |
| 138 | Ga0395899_0173716 | 3300037312 | Bacteria | 1516 |
| 139 | Ga0395900_0012807 | 3300037418 | Bacteria | 8573 |
| 140 | Ga0395900_0251112 | 3300037418 | Bacteria | 1770 |
| 141 | Ga0395900_0575462 | 3300037418 | Bacteria | 1069 |
| 142 | Ga0395900_0617004 | 3300037418 | Bacteria | 1024 |
| 143 | Ga0395898_0005034 | 3300037466 | Bacteria | 14328 |
| 144 | Ga0395898_0022194 | 3300037466 | Bacteria | 6432 |
| 145 | Ga0395898_0393839 | 3300037466 | Bacteria | 1321 |
| 146 | Ga0395898_0791174 | 3300037466 | Bacteria | 889 |
| 147 | Ga0395905_0017178 | 3300037471 | Bacteria | 6873 |
| 148 | Ga0395905_0238673 | 3300037471 | Bacteria | 1699 |
| 149 | Ga0395905_0426960 | 3300037471 | Bacteria | 1222 |
| 150 | Ga0436364_0691561 | 3300037853 | Bacteria | 635 |
| 151 | Ga0395901_0005619 | 3300038443 | Bacteria | 12695 |
| 152 | Ga0395901_0006209 | 3300038443 | Bacteria | 12108 |
| 153 | Ga0395901_0056634 | 3300038443 | Bacteria | 4078 |
| 154 | Ga0395901_0129604 | 3300038443 | Bacteria | 2650 |
| 155 | Ga0395901_0476166 | 3300038443 | Bacteria | 1274 |
| 156 | Ga0395901_0575239 | 3300038443 | Bacteria | 1139 |
| 157 | Ga0436365_1537269 | 3300039437 | Bacteria | 1258 |
| 158 | Ga0436363_1695102 | 3300039450 | Bacteria | 1748 |
| 159 | Ga0436362_0735028 | 3300039453 | Bacteria | 653 |
| 160 | Ga0439436_0185904 | 3300041404 | Bacteria | 592 |
| 161 | Ga0451802_1153344 | 3300041460 | Bacteria | 712 |
| 162 | Ga0439433_0008239 | 3300041999 | Bacteria | 2257 |
| 163 | Ga0439442_020124 | 3300042002 | Bacteria | 1383 |
| 164 | Ga0439456_018089 | 3300042013 | Unclassified | 1479 |
| 165 | Ga0439462_0037414 | 3300042015 | Bacteria | 1293 |
| 166 | Ga0450923_109405 | 3300042125 | Bacteria | 644 |
| 167 | Ga0439446_0002894 | 3300042156 | Bacteria | 4187 |
| 168 | Ga0439434_0013017 | 3300042435 | Bacteria | 2467 |
| 169 | Ga0466969_0050591 | 3300044656 | Bacteria | 2048 |
| 170 | Ga0466961_0064585 | 3300044693 | Bacteria | 2326 |
| 171 | Ga0466963_0161163 | 3300044694 | Bacteria | 1561 |
| 172 | Ga0466963_0322035 | 3300044694 | Bacteria | 1088 |
| 173 | Ga0466963_0454584 | 3300044694 | Bacteria | 904 |
| 174 | Ga0466964_0003040 | 3300044706 | Bacteria | 6086 |
| 175 | Ga0466968_0045871 | 3300044735 | Bacteria | 1856 |
| 176 | Ga0466970_0340296 | 3300044765 | Bacteria | 850 |
| 177 | Ga0466970_0663162 | 3300044765 | Bacteria | 607 |
| 178 | Ga0466960_0675092 | 3300044901 | Bacteria | 618 |
| 179 | Ga0466959_0033695 | 3300045049 | Bacteria | 3788 |
| 180 | Ga0466959_0333427 | 3300045049 | Bacteria | 1036 |
| 181 | Ga0466958_0018234 | 3300045836 | Bacteria | 4071 |
| 182 | Ga0466958_0380585 | 3300045836 | Unclassified | 910 |
| 183 | Ga0466967_0332941 | 3300045976 | Bacteria | 1466 |
| 184 | Ga0466967_0443294 | 3300045976 | Bacteria | 1268 |
| 185 | Ga0466967_0929058 | 3300045976 | Bacteria | 865 |
| 186 | Ga0466967_1104779 | 3300045976 | Bacteria | 790 |
| 187 | Ga0495603_0766077 | 3300046455 | Bacteria | 551 |
| 188 | Ga0495629_0008509 | 3300046459 | Bacteria | 7556 |
| 189 | Ga0495641_0101366 | 3300046461 | Bacteria | 1285 |
| 190 | Ga0495594_0755564 | 3300046499 | Unclassified | 549 |
| 191 | Ga0495618_0528220 | 3300046514 | Unclassified | 709 |
| 192 | Ga0495586_0253323 | 3300046535 | Bacteria | 1005 |
| 193 | Ga0495624_0565328 | 3300046690 | Unclassified | 679 |
| 194 | Ga0495674_0770177 | 3300047319 | Unclassified | 750 |
| 195 | Ga0496101_0670321 | 3300048904 | Bacteria | 819 |
| 196 | Ga0496102_0155582 | 3300048905 | Bacteria | 2149 |
| 197 | Ga0496102_0195415 | 3300048905 | Archaea | 1907 |
| 198 | Ga0496102_0619987 | 3300048905 | Bacteria | 1005 |
| 199 | Ga0496102_0646145 | 3300048905 | Bacteria | 981 |
| 200 | Ga0496102_0913432 | 3300048905 | Bacteria | 799 |
| 201 | Ga0496102_1033212 | 3300048905 | Unclassified | 742 |
| 202 | Ga0496105_0103596 | 3300048908 | Bacteria | 2350 |
| 203 | Ga0496105_0394924 | 3300048908 | Bacteria | 1099 |
| 204 | Ga0496105_0864064 | 3300048908 | Unclassified | 684 |
| 205 | Ga0496107_0196123 | 3300048910 | Bacteria | 1501 |
| 206 | Ga0496108_0289668 | 3300048911 | Unclassified | 1426 |
| 207 | Ga0496109_0372548 | 3300048912 | Bacteria | 1349 |
| 208 | Ga0496109_0500067 | 3300048912 | Unclassified | 1148 |
| 209 | Ga0496110_0053398 | 3300048913 | Bacteria | 3553 |
| 210 | Ga0496110_0762542 | 3300048913 | Bacteria | 871 |
| 211 | Ga0496112_0014299 | 3300048915 | Bacteria | 7353 |
| 212 | Ga0496113_0840813 | 3300048916 | Bacteria | 728 |
| 213 | Ga0496114_0247675 | 3300048917 | Unclassified | 1568 |
| 214 | Ga0496114_1541938 | 3300048917 | Unclassified | 552 |
| 215 | Ga0501031_0016598 | 3300049568 | Bacteria | 4781 |
| 216 | Ga0501031_0558330 | 3300049568 | Bacteria | 737 |
| 217 | Ga0501032_0075727 | 3300049569 | Bacteria | 2241 |
| 218 | Ga0501036_0028093 | 3300049572 | Bacteria | 4755 |
| 219 | Ga0501037_0047895 | 3300049573 | Bacteria | 3132 |
| 220 | Ga0501038_0021837 | 3300049574 | Bacteria | 5741 |
| 221 | Ga0501039_0095511 | 3300049575 | Bacteria | 2318 |
| 222 | Ga0501039_0881881 | 3300049575 | Archaea | 697 |
| 223 | Ga0501039_1085711 | 3300049575 | Bacteria | 620 |
| 224 | Ga0501040_0033202 | 3300049576 | Bacteria | 3495 |
| 225 | Ga0501040_0071303 | 3300049576 | Bacteria | 2398 |
| 226 | Ga0501040_0133716 | 3300049576 | Bacteria | 1745 |
| 227 | Ga0501041_0154093 | 3300049577 | Bacteria | 1435 |
| 228 | Ga0501042_0000831 | 3300049578 | Bacteria | 17146 |
| 229 | Ga0501043_0137356 | 3300049579 | Bacteria | 1915 |
| 230 | Ga0501046_0025739 | 3300049580 | Bacteria | 4812 |
| 231 | Ga0501047_0372171 | 3300049581 | Bacteria | 1264 |
| 232 | Ga0501048_0401427 | 3300049582 | Archaea | 980 |
| 233 | Ga0501048_0994982 | 3300049582 | Bacteria | 603 |
| 234 | Ga0501067_0011889 | 3300049583 | Bacteria | 4823 |
| 235 | Ga0501067_0074603 | 3300049583 | Bacteria | 1880 |
| 236 | Ga0501068_0001680 | 3300049584 | Bacteria | 11804 |
| 237 | Ga0501068_0403660 | 3300049584 | Bacteria | 881 |
| 238 | Ga0501070_0031945 | 3300049586 | Bacteria | 4409 |
| 239 | Ga0501071_0038363 | 3300049587 | Bacteria | 3423 |
| 240 | Ga0501071_0190584 | 3300049587 | Archaea | 1538 |
| 241 | Ga0501071_0193186 | 3300049587 | Bacteria | 1527 |
| 242 | Ga0501072_0006258 | 3300049588 | Bacteria | 9072 |
| 243 | Ga0501072_0008449 | 3300049588 | Bacteria | 7812 |
| 244 | Ga0501072_0172846 | 3300049588 | Bacteria | 1724 |
| 245 | Ga0501073_0030754 | 3300049589 | Bacteria | 3833 |
| 246 | Ga0501074_0011638 | 3300049590 | Bacteria | 6395 |
| 247 | Ga0501074_0605275 | 3300049590 | Bacteria | 775 |
| 248 | Ga0501074_1143872 | 3300049590 | Bacteria | 546 |
| 249 | Ga0501075_0080695 | 3300049591 | Bacteria | 2462 |
| 250 | Ga0501076_0020130 | 3300049592 | Bacteria | 5105 |
| 251 | Ga0501076_0077718 | 3300049592 | Bacteria | 2663 |
| 252 | Ga0501077_0018169 | 3300049593 | Bacteria | 4446 |
| 253 | Ga0501077_0034916 | 3300049593 | Bacteria | 3201 |
| 254 | Ga0501079_0009137 | 3300049741 | Bacteria | 7503 |
| 255 | Ga0501080_0043372 | 3300049742 | Bacteria | 4188 |
| 256 | Ga0501081_0011795 | 3300049743 | Bacteria | 5724 |
| 257 | Ga0501081_0029185 | 3300049743 | Bacteria | 3726 |
| 258 | Ga0501081_0857695 | 3300049743 | Bacteria | 684 |
| 259 | Ga0501083_0013344 | 3300049744 | Bacteria | 5745 |
| 260 | Ga0501035_0019890 | 3300049822 | Bacteria | 6167 |
| 261 | Ga0501035_1226215 | 3300049822 | Bacteria | 581 |
| 262 | Ga0501044_0077194 | 3300049823 | Bacteria | 3379 |
| 263 | Ga0501044_1179760 | 3300049823 | Bacteria | 634 |
| 264 | Ga0501045_0011323 | 3300049824 | Bacteria | 6261 |
| 265 | nmdc:mga00v17_47389_c1 | 3300050491 | Bacteria | 2603 |
| 266 | nmdc:mga0yw44_9351_c1 | 3300050492 | Bacteria | 4949 |
| 267 | nmdc:mga08y16_82371_c1 | 3300050511 | Bacteria | 3354 |
| 268 | nmdc:mga0rr50_1332710_c1 | 3300050513 | Unclassified | 608 |
| 269 | nmdc:mga08x19_674152_c1 | 3300050514 | Bacteria | 734 |
| 270 | nmdc:mga0a205_248888_c1 | 3300050515 | Bacteria | 1657 |
| 271 | Ga0495619_0131987 | 3300053085 | Bacteria | 1717 |
| 272 | Ga0501084_0006835 | 3300054114 | Bacteria | 9387 |
| 273 | Ga0501084_0093183 | 3300054114 | Bacteria | 2529 |
| 274 | Ga0501082_0056150 | 3300060353 | Bacteria | 3391 |
| 275 | Ga0501082_1200923 | 3300060353 | Unclassified | 663 |
| 276 | Ga0501082_1541428 | 3300060353 | Bacteria | 580 |
| 277 | Ga0501082_1866804 | 3300060353 | Bacteria | 524 |
| 278 | Ga0530510_0003512 | 3300061734 | Bacteria | 10779 |
| 279 | Ga0530510_0055165 | 3300061734 | Bacteria | 2871 |
| 280 | Ga0530510_0210590 | 3300061734 | Archaea | 1444 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009147 | Ga0114129_10795203 | Ga0114129_107952033 | 80 |
| 2 | 3300046455 | Ga0495603_0766077 | Ga0495603_0766077_115_408 | 82 |
| 3 | 3300005937 | Ga0081455_10042405 | Ga0081455_100424053 | 83 |
| 4 | 3300042013 | Ga0439456_018089 | Ga0439456_018089_181_516 | 83 |
| 5 | 3300045836 | Ga0466958_0018234 | Ga0466958_0018234_993_1259 | 83 |
| 6 | 3300045976 | Ga0466967_0929058 | Ga0466967_0929058_551_817 | 83 |
| 7 | 3300049568 | Ga0501031_0016598 | Ga0501031_0016598_488_784 | 83 |
| 8 | 3300049569 | Ga0501032_0075727 | Ga0501032_0075727_314_610 | 83 |
| 9 | 3300049572 | Ga0501036_0028093 | Ga0501036_0028093_114_410 | 83 |
| 10 | 3300049573 | Ga0501037_0047895 | Ga0501037_0047895_797_1093 | 83 |
| 11 | 3300049574 | Ga0501038_0021837 | Ga0501038_0021837_381_677 | 83 |
| 12 | 3300049575 | Ga0501039_1085711 | Ga0501039_1085711_314_610 | 83 |
| 13 | 3300049576 | Ga0501040_0071303 | Ga0501040_0071303_2092_2388 | 83 |
| 14 | 3300049577 | Ga0501041_0154093 | Ga0501041_0154093_302_598 | 83 |
| 15 | 3300049578 | Ga0501042_0000831 | Ga0501042_0000831_4077_4373 | 83 |
| 16 | 3300049579 | Ga0501043_0137356 | Ga0501043_0137356_77_373 | 83 |
| 17 | 3300049580 | Ga0501046_0025739 | Ga0501046_0025739_609_905 | 83 |
| 18 | 3300049581 | Ga0501047_0372171 | Ga0501047_0372171_941_1237 | 83 |
| 19 | 3300049584 | Ga0501068_0001680 | Ga0501068_0001680_10120_10416 | 83 |
| 20 | 3300049586 | Ga0501070_0031945 | Ga0501070_0031945_1750_2046 | 83 |
| 21 | 3300049587 | Ga0501071_0038363 | Ga0501071_0038363_917_1213 | 83 |
| 22 | 3300049588 | Ga0501072_0008449 | Ga0501072_0008449_5878_6174 | 83 |
| 23 | 3300049589 | Ga0501073_0030754 | Ga0501073_0030754_1790_2086 | 83 |
| 24 | 3300049590 | Ga0501074_0011638 | Ga0501074_0011638_1709_2005 | 83 |
| 25 | 3300049591 | Ga0501075_0080695 | Ga0501075_0080695_300_596 | 83 |
| 26 | 3300049592 | Ga0501076_0020130 | Ga0501076_0020130_646_942 | 83 |
| 27 | 3300049593 | Ga0501077_0018169 | Ga0501077_0018169_130_426 | 83 |
| 28 | 3300049741 | Ga0501079_0009137 | Ga0501079_0009137_4351_4647 | 83 |
| 29 | 3300049742 | Ga0501080_0043372 | Ga0501080_0043372_1682_1978 | 83 |
| 30 | 3300049743 | Ga0501081_0011795 | Ga0501081_0011795_1749_2045 | 83 |
| 31 | 3300049744 | Ga0501083_0013344 | Ga0501083_0013344_52_348 | 83 |
| 32 | 3300049822 | Ga0501035_0019890 | Ga0501035_0019890_1872_2168 | 83 |
| 33 | 3300049823 | Ga0501044_0077194 | Ga0501044_0077194_947_1243 | 83 |
| 34 | 3300049824 | Ga0501045_0011323 | Ga0501045_0011323_139_435 | 83 |
| 35 | 3300054114 | Ga0501084_0006835 | Ga0501084_0006835_18_314 | 83 |
| 36 | 3300060353 | Ga0501082_0056150 | Ga0501082_0056150_1801_2097 | 83 |
| 37 | 3300061734 | Ga0530510_0003512 | Ga0530510_0003512_10345_10641 | 83 |
| 38 | 3300038443 | Ga0395901_0056634 | Ga0395901_0056634_2463_2759 | 84 |
| 39 | 3300037853 | Ga0436364_0691561 | Ga0436364_0691561_353_610 | 85 |
| 40 | 3300039437 | Ga0436365_1537269 | Ga0436365_1537269_919_1176 | 85 |
| 41 | 3300039450 | Ga0436363_1695102 | Ga0436363_1695102_582_839 | 85 |
| 42 | 3300039453 | Ga0436362_0735028 | Ga0436362_0735028_100_360 | 86 |
| 43 | 3300044706 | Ga0466964_0003040 | Ga0466964_0003040_3988_4248 | 86 |
| 44 | 3300049583 | Ga0501067_0074603 | Ga0501067_0074603_1372_1632 | 86 |
| 45 | 3300037418 | Ga0395900_0251112 | Ga0395900_0251112_166_429 | 87 |
| 46 | 3300037418 | Ga0395900_0575462 | Ga0395900_0575462_210_473 | 87 |
| 47 | 3300037466 | Ga0395898_0022194 | Ga0395898_0022194_459_722 | 87 |
| 48 | 3300037471 | Ga0395905_0238673 | Ga0395905_0238673_715_978 | 87 |
| 49 | 3300038443 | Ga0395901_0005619 | Ga0395901_0005619_2723_2986 | 87 |
| 50 | 3300005434 | Ga0070709_10743148 | Ga0070709_107431481 | 88 |
| 51 | 3300005435 | Ga0070714_100072342 | Ga0070714_1000723422 | 88 |
| 52 | 3300005437 | Ga0070710_10630996 | Ga0070710_106309961 | 88 |
| 53 | 3300005439 | Ga0070711_101167987 | Ga0070711_1011679872 | 88 |
| 54 | 3300006914 | Ga0075436_100738760 | Ga0075436_1007387602 | 88 |
| 55 | 3300025906 | Ga0207699_10328519 | Ga0207699_103285193 | 88 |
| 56 | 3300025915 | Ga0207693_10337410 | Ga0207693_103374103 | 88 |
| 57 | 3300025939 | Ga0207665_10623836 | Ga0207665_106238361 | 88 |
| 58 | 3300035241 | Ga0373961_0266835 | Ga0373961_0266835_278_544 | 88 |
| 59 | 3300035691 | Ga0373931_1295888 | Ga0373931_1295888_200_466 | 88 |
| 60 | 3300046459 | Ga0495629_0008509 | Ga0495629_0008509_958_1242 | 88 |
| 61 | 3300046499 | Ga0495594_0755564 | Ga0495594_0755564_55_339 | 88 |
| 62 | 3300046514 | Ga0495618_0528220 | Ga0495618_0528220_330_596 | 88 |
| 63 | 3300046535 | Ga0495586_0253323 | Ga0495586_0253323_574_858 | 88 |
| 64 | 3300048913 | Ga0496110_0762542 | Ga0496110_0762542_173_439 | 88 |
| 65 | 3300048917 | Ga0496114_1541938 | Ga0496114_1541938_223_489 | 88 |
| 66 | 3300050513 | nmdc:mga0rr50_1332710_c1 | nmdc:mga0rr50_1332710_c1_239_505 | 88 |
| 67 | 3300050514 | nmdc:mga08x19_674152_c1 | nmdc:mga08x19_674152_c1_213_482 | 88 |
| 68 | 3300050515 | nmdc:mga0a205_248888_c1 | nmdc:mga0a205_248888_c1_240_506 | 88 |
| 69 | 3300053085 | Ga0495619_0131987 | Ga0495619_0131987_655_921 | 88 |
| 70 | 3300060353 | Ga0501082_1200923 | Ga0501082_1200923_233_502 | 88 |
| 71 | 3300037418 | Ga0395900_0617004 | Ga0395900_0617004_656_925 | 89 |
| 72 | 3300044694 | Ga0466963_0161163 | Ga0466963_0161163_627_896 | 89 |
| 73 | 3300044901 | Ga0466960_0675092 | Ga0466960_0675092_103_372 | 89 |
| 74 | 3300045976 | Ga0466967_0443294 | Ga0466967_0443294_191_460 | 89 |
| 75 | 3300005329 | Ga0070683_102025040 | Ga0070683_1020250401 | 90 |
| 76 | 3300005339 | Ga0070660_100008163 | Ga0070660_1000081634 | 90 |
| 77 | 3300005339 | Ga0070660_100084956 | Ga0070660_1000849563 | 90 |
| 78 | 3300005366 | Ga0070659_101649557 | Ga0070659_1016495571 | 90 |
| 79 | 3300005435 | Ga0070714_100321275 | Ga0070714_1003212751 | 90 |
| 80 | 3300005458 | Ga0070681_10024721 | Ga0070681_100247217 | 90 |
| 81 | 3300005563 | Ga0068855_100050746 | Ga0068855_1000507467 | 90 |
| 82 | 3300005563 | Ga0068855_100390816 | Ga0068855_1003908161 | 90 |
| 83 | 3300005937 | Ga0081455_10108252 | Ga0081455_101082523 | 90 |
| 84 | 3300005985 | Ga0081539_10002592 | Ga0081539_100025922 | 90 |
| 85 | 3300009098 | Ga0105245_11880682 | Ga0105245_118806822 | 90 |
| 86 | 3300009174 | Ga0105241_12659375 | Ga0105241_126593752 | 90 |
| 87 | 3300013100 | Ga0157373_10264240 | Ga0157373_102642403 | 90 |
| 88 | 3300013102 | Ga0157371_10784365 | Ga0157371_107843652 | 90 |
| 89 | 3300013307 | Ga0157372_10268363 | Ga0157372_102683632 | 90 |
| 90 | 3300014497 | Ga0182008_10688973 | Ga0182008_106889731 | 90 |
| 91 | 3300025912 | Ga0207707_10044523 | Ga0207707_100445233 | 90 |
| 92 | 3300025915 | Ga0207693_10958976 | Ga0207693_109589762 | 90 |
| 93 | 3300025917 | Ga0207660_10043974 | Ga0207660_100439743 | 90 |
| 94 | 3300025919 | Ga0207657_10005654 | Ga0207657_1000565410 | 90 |
| 95 | 3300025929 | Ga0207664_10074342 | Ga0207664_100743421 | 90 |
| 96 | 3300025949 | Ga0207667_10026543 | Ga0207667_100265433 | 90 |
| 97 | 3300025949 | Ga0207667_11241769 | Ga0207667_112417691 | 90 |
| 98 | 3300025981 | Ga0207640_11417820 | Ga0207640_114178201 | 90 |
| 99 | 3300038443 | Ga0395901_0575239 | Ga0395901_0575239_77_352 | 90 |
| 100 | 3300045976 | Ga0466967_1104779 | Ga0466967_1104779_342_614 | 90 |
| 101 | 3300048905 | Ga0496102_0155582 | Ga0496102_0155582_1660_1932 | 90 |
| 102 | 3300049583 | Ga0501067_0011889 | Ga0501067_0011889_4117_4389 | 90 |
| 103 | 3300049590 | Ga0501074_0605275 | Ga0501074_0605275_199_471 | 90 |
| 104 | 3300061734 | Ga0530510_0055165 | Ga0530510_0055165_2122_2394 | 90 |
| 105 | 3300005327 | Ga0070658_10872974 | Ga0070658_108729741 | 91 |
| 106 | 3300005329 | Ga0070683_101016694 | Ga0070683_1010166942 | 91 |
| 107 | 3300005456 | Ga0070678_101319106 | Ga0070678_1013191061 | 91 |
| 108 | 3300005456 | Ga0070678_102070851 | Ga0070678_1020708511 | 91 |
| 109 | 3300006237 | Ga0097621_100193084 | Ga0097621_1001930845 | 91 |
| 110 | 3300025910 | Ga0207684_11163978 | Ga0207684_111639783 | 91 |
| 111 | 3300025940 | Ga0207691_10419081 | Ga0207691_104190812 | 91 |
| 112 | 3300025944 | Ga0207661_10216738 | Ga0207661_102167381 | 91 |
| 113 | 3300026121 | Ga0207683_10804147 | Ga0207683_108041472 | 91 |
| 114 | 3300044656 | Ga0466969_0050591 | Ga0466969_0050591_652_936 | 91 |
| 115 | 3300044693 | Ga0466961_0064585 | Ga0466961_0064585_177_461 | 91 |
| 116 | 3300044694 | Ga0466963_0322035 | Ga0466963_0322035_447_731 | 91 |
| 117 | 3300044735 | Ga0466968_0045871 | Ga0466968_0045871_121_402 | 91 |
| 118 | 3300044765 | Ga0466970_0340296 | Ga0466970_0340296_360_644 | 91 |
| 119 | 3300044765 | Ga0466970_0663162 | Ga0466970_0663162_284_562 | 91 |
| 120 | 3300045049 | Ga0466959_0033695 | Ga0466959_0033695_2845_3129 | 91 |
| 121 | 3300045049 | Ga0466959_0333427 | Ga0466959_0333427_447_725 | 91 |
| 122 | 3300045836 | Ga0466958_0380585 | Ga0466958_0380585_565_849 | 91 |
| 123 | 3300048905 | Ga0496102_0619987 | Ga0496102_0619987_420_695 | 91 |
| 124 | 3300048905 | Ga0496102_1033212 | Ga0496102_1033212_246_527 | 91 |
| 125 | 3300048917 | Ga0496114_0247675 | Ga0496114_0247675_907_1188 | 91 |
| 126 | 3300005329 | Ga0070683_100220987 | Ga0070683_1002209872 | 92 |
| 127 | 3300005331 | Ga0070670_100064618 | Ga0070670_1000646184 | 92 |
| 128 | 3300005338 | Ga0068868_100750214 | Ga0068868_1007502142 | 92 |
| 129 | 3300005456 | Ga0070678_102039226 | Ga0070678_1020392262 | 92 |
| 130 | 3300005457 | Ga0070662_100232962 | Ga0070662_1002329622 | 92 |
| 131 | 3300005459 | Ga0068867_100650196 | Ga0068867_1006501961 | 92 |
| 132 | 3300005535 | Ga0070684_100888753 | Ga0070684_1008887532 | 92 |
| 133 | 3300005548 | Ga0070665_100383955 | Ga0070665_1003839553 | 92 |
| 134 | 3300005549 | Ga0070704_102277747 | Ga0070704_1022777471 | 92 |
| 135 | 3300005577 | Ga0068857_100319313 | Ga0068857_1003193132 | 92 |
| 136 | 3300005577 | Ga0068857_100397506 | Ga0068857_1003975062 | 92 |
| 137 | 3300005578 | Ga0068854_100362328 | Ga0068854_1003623282 | 92 |
| 138 | 3300005719 | Ga0068861_100315251 | Ga0068861_1003152512 | 92 |
| 139 | 3300005840 | Ga0068870_10028503 | Ga0068870_100285034 | 92 |
| 140 | 3300005844 | Ga0068862_100283975 | Ga0068862_1002839752 | 92 |
| 141 | 3300005937 | Ga0081455_10744675 | Ga0081455_107446752 | 92 |
| 142 | 3300005985 | Ga0081539_10003654 | Ga0081539_100036542 | 92 |
| 143 | 3300006178 | Ga0075367_10526519 | Ga0075367_105265192 | 92 |
| 144 | 3300006237 | Ga0097621_100782367 | Ga0097621_1007823671 | 92 |
| 145 | 3300009093 | Ga0105240_11606901 | Ga0105240_116069012 | 92 |
| 146 | 3300009094 | Ga0111539_10058188 | Ga0111539_100581884 | 92 |
| 147 | 3300009098 | Ga0105245_10483325 | Ga0105245_104833251 | 92 |
| 148 | 3300009098 | Ga0105245_10484165 | Ga0105245_104841651 | 92 |
| 149 | 3300009098 | Ga0105245_11769550 | Ga0105245_117695501 | 92 |
| 150 | 3300009148 | Ga0105243_12387007 | Ga0105243_123870072 | 92 |
| 151 | 3300009176 | Ga0105242_10147648 | Ga0105242_101476484 | 92 |
| 152 | 3300009176 | Ga0105242_11135314 | Ga0105242_111353142 | 92 |
| 153 | 3300009177 | Ga0105248_10341896 | Ga0105248_103418962 | 92 |
| 154 | 3300009177 | Ga0105248_13062204 | Ga0105248_130622041 | 92 |
| 155 | 3300010375 | Ga0105239_10077436 | Ga0105239_100774364 | 92 |
| 156 | 3300011119 | Ga0105246_10556529 | Ga0105246_105565293 | 92 |
| 157 | 3300011119 | Ga0105246_10961869 | Ga0105246_109618692 | 92 |
| 158 | 3300011119 | Ga0105246_11351292 | Ga0105246_113512922 | 92 |
| 159 | 3300013296 | Ga0157374_12886221 | Ga0157374_128862211 | 92 |
| 160 | 3300013308 | Ga0157375_12127781 | Ga0157375_121277812 | 92 |
| 161 | 3300014325 | Ga0163163_10855920 | Ga0163163_108559202 | 92 |
| 162 | 3300014326 | Ga0157380_10965546 | Ga0157380_109655462 | 92 |
| 163 | 3300014326 | Ga0157380_13071136 | Ga0157380_130711361 | 92 |
| 164 | 3300014497 | Ga0182008_10121225 | Ga0182008_101212253 | 92 |
| 165 | 3300014745 | Ga0157377_10875754 | Ga0157377_108757542 | 92 |
| 166 | 3300014969 | Ga0157376_10226361 | Ga0157376_102263612 | 92 |
| 167 | 3300014969 | Ga0157376_11713436 | Ga0157376_117134362 | 92 |
| 168 | 3300014969 | Ga0157376_12711319 | Ga0157376_127113192 | 92 |
| 169 | 3300015261 | Ga0182006_1099422 | Ga0182006_10994221 | 92 |
| 170 | 3300025899 | Ga0207642_10546170 | Ga0207642_105461701 | 92 |
| 171 | 3300025908 | Ga0207643_10031514 | Ga0207643_100315145 | 92 |
| 172 | 3300025923 | Ga0207681_10562031 | Ga0207681_105620311 | 92 |
| 173 | 3300025925 | Ga0207650_10041615 | Ga0207650_100416155 | 92 |
| 174 | 3300025926 | Ga0207659_11368030 | Ga0207659_113680302 | 92 |
| 175 | 3300025927 | Ga0207687_11155794 | Ga0207687_111557941 | 92 |
| 176 | 3300025931 | Ga0207644_10489850 | Ga0207644_104898501 | 92 |
| 177 | 3300025934 | Ga0207686_11175490 | Ga0207686_111754902 | 92 |
| 178 | 3300025935 | Ga0207709_10365690 | Ga0207709_103656902 | 92 |
| 179 | 3300025944 | Ga0207661_10252271 | Ga0207661_102522713 | 92 |
| 180 | 3300025945 | Ga0207679_10748113 | Ga0207679_107481131 | 92 |
| 181 | 3300025981 | Ga0207640_10915194 | Ga0207640_109151942 | 92 |
| 182 | 3300026118 | Ga0207675_100391370 | Ga0207675_1003913703 | 92 |
| 183 | 3300026121 | Ga0207683_11214093 | Ga0207683_112140932 | 92 |
| 184 | 3300027907 | Ga0207428_10083646 | Ga0207428_100836462 | 92 |
| 185 | 3300032126 | Ga0307415_101511211 | Ga0307415_1015112111 | 92 |
| 186 | 3300037312 | Ga0395899_0173716 | Ga0395899_0173716_639_926 | 92 |
| 187 | 3300037418 | Ga0395900_0012807 | Ga0395900_0012807_4370_4654 | 92 |
| 188 | 3300037466 | Ga0395898_0005034 | Ga0395898_0005034_13706_13990 | 92 |
| 189 | 3300037466 | Ga0395898_0393839 | Ga0395898_0393839_57_335 | 92 |
| 190 | 3300037466 | Ga0395898_0791174 | Ga0395898_0791174_189_473 | 92 |
| 191 | 3300037471 | Ga0395905_0017178 | Ga0395905_0017178_19_303 | 92 |
| 192 | 3300037471 | Ga0395905_0426960 | Ga0395905_0426960_738_1025 | 92 |
| 193 | 3300038443 | Ga0395901_0006209 | Ga0395901_0006209_2086_2370 | 92 |
| 194 | 3300038443 | Ga0395901_0129604 | Ga0395901_0129604_315_599 | 92 |
| 195 | 3300038443 | Ga0395901_0476166 | Ga0395901_0476166_239_523 | 92 |
| 196 | 3300041460 | Ga0451802_1153344 | Ga0451802_1153344_32_313 | 92 |
| 197 | 3300044694 | Ga0466963_0454584 | Ga0466963_0454584_103_390 | 92 |
| 198 | 3300045976 | Ga0466967_0332941 | Ga0466967_0332941_1024_1308 | 92 |
| 199 | 3300046461 | Ga0495641_0101366 | Ga0495641_0101366_777_1058 | 92 |
| 200 | 3300046690 | Ga0495624_0565328 | Ga0495624_0565328_33_314 | 92 |
| 201 | 3300047319 | Ga0495674_0770177 | Ga0495674_0770177_223_507 | 92 |
| 202 | 3300048904 | Ga0496101_0670321 | Ga0496101_0670321_101_382 | 92 |
| 203 | 3300048905 | Ga0496102_0646145 | Ga0496102_0646145_91_375 | 92 |
| 204 | 3300048905 | Ga0496102_0913432 | Ga0496102_0913432_332_613 | 92 |
| 205 | 3300048908 | Ga0496105_0103596 | Ga0496105_0103596_1839_2120 | 92 |
| 206 | 3300048908 | Ga0496105_0864064 | Ga0496105_0864064_372_653 | 92 |
| 207 | 3300048910 | Ga0496107_0196123 | Ga0496107_0196123_302_583 | 92 |
| 208 | 3300048911 | Ga0496108_0289668 | Ga0496108_0289668_475_765 | 92 |
| 209 | 3300048912 | Ga0496109_0372548 | Ga0496109_0372548_994_1275 | 92 |
| 210 | 3300048912 | Ga0496109_0500067 | Ga0496109_0500067_724_1005 | 92 |
| 211 | 3300048913 | Ga0496110_0053398 | Ga0496110_0053398_3004_3291 | 92 |
| 212 | 3300048915 | Ga0496112_0014299 | Ga0496112_0014299_308_592 | 92 |
| 213 | 3300048916 | Ga0496113_0840813 | Ga0496113_0840813_33_314 | 92 |
| 214 | 3300049568 | Ga0501031_0558330 | Ga0501031_0558330_435_716 | 92 |
| 215 | 3300049575 | Ga0501039_0095511 | Ga0501039_0095511_1993_2277 | 92 |
| 216 | 3300049575 | Ga0501039_0881881 | Ga0501039_0881881_359_652 | 92 |
| 217 | 3300049576 | Ga0501040_0033202 | Ga0501040_0033202_3079_3363 | 92 |
| 218 | 3300049576 | Ga0501040_0133716 | Ga0501040_0133716_156_449 | 92 |
| 219 | 3300049582 | Ga0501048_0401427 | Ga0501048_0401427_264_557 | 92 |
| 220 | 3300049584 | Ga0501068_0403660 | Ga0501068_0403660_540_824 | 92 |
| 221 | 3300049587 | Ga0501071_0190584 | Ga0501071_0190584_530_823 | 92 |
| 222 | 3300049588 | Ga0501072_0006258 | Ga0501072_0006258_8777_9061 | 92 |
| 223 | 3300049588 | Ga0501072_0172846 | Ga0501072_0172846_736_1020 | 92 |
| 224 | 3300049592 | Ga0501076_0077718 | Ga0501076_0077718_158_442 | 92 |
| 225 | 3300049593 | Ga0501077_0034916 | Ga0501077_0034916_2500_2793 | 92 |
| 226 | 3300049743 | Ga0501081_0029185 | Ga0501081_0029185_2781_3074 | 92 |
| 227 | 3300049743 | Ga0501081_0857695 | Ga0501081_0857695_144_428 | 92 |
| 228 | 3300049822 | Ga0501035_1226215 | Ga0501035_1226215_12_296 | 92 |
| 229 | 3300049823 | Ga0501044_1179760 | Ga0501044_1179760_252_536 | 92 |
| 230 | 3300050511 | nmdc:mga08y16_82371_c1 | nmdc:mga08y16_82371_c1_620_907 | 92 |
| 231 | 3300054114 | Ga0501084_0093183 | Ga0501084_0093183_2141_2422 | 92 |
| 232 | 3300060353 | Ga0501082_1541428 | Ga0501082_1541428_54_341 | 92 |
| 233 | 3300061734 | Ga0530510_0210590 | Ga0530510_0210590_515_808 | 92 |
| 234 | 3300005331 | Ga0070670_100409297 | Ga0070670_1004092971 | 93 |
| 235 | 3300005435 | Ga0070714_100228759 | Ga0070714_1002287592 | 93 |
| 236 | 3300005468 | Ga0070707_100648862 | Ga0070707_1006488621 | 93 |
| 237 | 3300006028 | Ga0070717_10549530 | Ga0070717_105495302 | 93 |
| 238 | 3300006038 | Ga0075365_10001901 | Ga0075365_100019018 | 93 |
| 239 | 3300006051 | Ga0075364_10037689 | Ga0075364_100376893 | 93 |
| 240 | 3300007076 | Ga0075435_100482329 | Ga0075435_1004823292 | 93 |
| 241 | 3300009147 | Ga0114129_10637481 | Ga0114129_106374813 | 93 |
| 242 | 3300025925 | Ga0207650_10828578 | Ga0207650_108285781 | 93 |
| 243 | 3300041404 | Ga0439436_0185904 | Ga0439436_0185904_252_545 | 93 |
| 244 | 3300041999 | Ga0439433_0008239 | Ga0439433_0008239_984_1277 | 93 |
| 245 | 3300042002 | Ga0439442_020124 | Ga0439442_020124_923_1216 | 93 |
| 246 | 3300042015 | Ga0439462_0037414 | Ga0439462_0037414_159_452 | 93 |
| 247 | 3300042125 | Ga0450923_109405 | Ga0450923_109405_260_553 | 93 |
| 248 | 3300042156 | Ga0439446_0002894 | Ga0439446_0002894_345_638 | 93 |
| 249 | 3300042435 | Ga0439434_0013017 | Ga0439434_0013017_1691_1984 | 93 |
| 250 | 3300048905 | Ga0496102_0195415 | Ga0496102_0195415_507_791 | 93 |
| 251 | 3300048908 | Ga0496105_0394924 | Ga0496105_0394924_771_1052 | 93 |
| 252 | 3300049582 | Ga0501048_0994982 | Ga0501048_0994982_281_565 | 93 |
| 253 | 3300049587 | Ga0501071_0193186 | Ga0501071_0193186_646_930 | 93 |
| 254 | 3300049590 | Ga0501074_1143872 | Ga0501074_1143872_219_503 | 93 |
| 255 | 3300050491 | nmdc:mga00v17_47389_c1 | nmdc:mga00v17_47389_c1_149_430 | 93 |
| 256 | 3300050492 | nmdc:mga0yw44_9351_c1 | nmdc:mga0yw44_9351_c1_3185_3466 | 93 |
| 257 | 3300060353 | Ga0501082_1866804 | Ga0501082_1866804_112_396 | 93 |
| 258 | 3300005330 | Ga0070690_100566104 | Ga0070690_1005661042 | 94 |
| 259 | 3300005338 | Ga0068868_100123837 | Ga0068868_1001238374 | 94 |
| 260 | 3300005340 | Ga0070689_100057789 | Ga0070689_1000577893 | 94 |
| 261 | 3300005356 | Ga0070674_100068014 | Ga0070674_1000680142 | 94 |
| 262 | 3300005365 | Ga0070688_100323192 | Ga0070688_1003231922 | 94 |
| 263 | 3300005367 | Ga0070667_101383623 | Ga0070667_1013836231 | 94 |
| 264 | 3300005459 | Ga0068867_100056440 | Ga0068867_1000564401 | 94 |
| 265 | 3300005543 | Ga0070672_101267014 | Ga0070672_1012670141 | 94 |
| 266 | 3300005617 | Ga0068859_101474832 | Ga0068859_1014748322 | 94 |
| 267 | 3300005718 | Ga0068866_10288523 | Ga0068866_102885232 | 94 |
| 268 | 3300006358 | Ga0068871_100058757 | Ga0068871_1000587573 | 94 |
| 269 | 3300006931 | Ga0097620_101475032 | Ga0097620_1014750322 | 94 |
| 270 | 3300009148 | Ga0105243_10221651 | Ga0105243_102216511 | 94 |
| 271 | 3300009176 | Ga0105242_10002530 | Ga0105242_1000253014 | 94 |
| 272 | 3300013297 | Ga0157378_10213267 | Ga0157378_102132672 | 94 |
| 273 | 3300013306 | Ga0163162_10488671 | Ga0163162_104886712 | 94 |
| 274 | 3300013308 | Ga0157375_10867609 | Ga0157375_108676092 | 94 |
| 275 | 3300014326 | Ga0157380_10530293 | Ga0157380_105302933 | 94 |
| 276 | 3300014968 | Ga0157379_10031562 | Ga0157379_100315624 | 94 |
| 277 | 3300014969 | Ga0157376_10161512 | Ga0157376_101615123 | 94 |
| 278 | 3300025938 | Ga0207704_10626164 | Ga0207704_106261642 | 94 |
| 279 | 3300025940 | Ga0207691_10116664 | Ga0207691_101166643 | 94 |
| 280 | 3300005327 | Ga0070658_10629055 | Ga0070658_106290552 | 95 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3lg7-assembly1.cif.gz_B | crystal structure of hiv epitope-scaffold 4e10_s0_1ez3a_002_c | 0.3683 | 6 | 94 |
| 4fbs-assembly1.cif.gz_A | structure of monomeric nt from euprosthenops australis major ampullate spidroin 1 (masp1) | 0.3591 | 3 | 92 |
| 4fbs-assembly1.cif.gz_A | structure of monomeric nt from euprosthenops australis major ampullate spidroin 1 (masp1) | 0.3471 | 3 | 92 |
| 6ypi-assembly1.cif.gz_A | structure of the engineered metallo-diels-alderase da7 w16g,k58q,l77r,t78r | 0.3257 | 4 | 94 |
| 6ypi-assembly1.cif.gz_A | structure of the engineered metallo-diels-alderase da7 w16g,k58q,l77r,t78r | 0.3164 | 4 | 94 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9VQ27_10_86_1.10.10.60 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.5349 | 1 | 76 | 1.10.10.60 |
| af_I1NAJ9_422_483_1.10.10.60 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.5152 | 3 | 73 | 1.10.10.60 |
| af_Q9VQ27_10_86_1.10.10.60 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.5106 | 1 | 76 | 1.10.10.60 |
| af_I1NAJ9_422_483_1.10.10.60 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.5048 | 3 | 73 | 1.10.10.60 |
| af_Q9UT77_462_524_1.10.10.410 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; | 0.4906 | 4 | 64 | 1.10.10.410 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538LD28-F1-model_v4 | Uncharacterized protein | 0.9549 | 10 | 95 |
|
| AF-A0A535ZGM3-F1-model_v4 | Uncharacterized protein | 0.9512 | 6 | 95 |
|
| AF-A0A537ZRM2-F1-model_v4 | Uncharacterized protein | 0.9492 | 3 | 95 |
|
| AF-A0A7W7QU73-F1-model_v4 | Uncharacterized protein | 0.9489 | 6 | 91 |
|
| AF-A0A535HQ90-F1-model_v4 | Uncharacterized protein | 0.9455 | 3 | 95 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar