F383570

General Info

Members Datasets Scaffolds Average Seq Length
280 182 280 92

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10002592|Ga0081539_100025922
Length 93
Sequence MTRDVDPIAKVLHDAAELHHAVWRDTDGDDPDWASWYADWLVGHSELPALLDAAPIRSHLVHALVELDREHGPGAGWEAAYARGLVARFAAEE

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
95 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
96 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
105 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
106 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
107 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
108 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
109 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
110 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
111 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
112 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
113 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
114 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
115 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
116 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
119 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
127 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
128 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
129 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
130 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
131 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
157 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
162 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
163 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
166 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
169 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
173 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
174 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
178 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
179 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
182 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.79
Nodule 0
Rhizoplane 7.5
Rhizosphere 89.64
Stem 0
Stem Tuber 0
Unclassified 1.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10629055 3300005327 Bacteria 931
2 Ga0070658_10872974 3300005327 Bacteria 782
3 Ga0070683_100220987 3300005329 Bacteria 1800
4 Ga0070683_101016694 3300005329 Bacteria 796
5 Ga0070683_102025040 3300005329 Bacteria 553
6 Ga0070690_100566104 3300005330 Bacteria 858
7 Ga0070670_100064618 3300005331 Bacteria 3140
8 Ga0070670_100409297 3300005331 Bacteria 1198
9 Ga0068868_100123837 3300005338 Bacteria 2110
10 Ga0068868_100750214 3300005338 Bacteria 877
11 Ga0070660_100008163 3300005339 Bacteria 7317
12 Ga0070660_100084956 3300005339 Bacteria 2488
13 Ga0070689_100057789 3300005340 Bacteria 3012
14 Ga0070674_100068014 3300005356 Bacteria 2508
15 Ga0070688_100323192 3300005365 Unclassified 1122
16 Ga0070659_101649557 3300005366 Bacteria 573
17 Ga0070667_101383623 3300005367 Bacteria 660
18 Ga0070709_10743148 3300005434 Unclassified 766
19 Ga0070714_100072342 3300005435 Bacteria 2984
20 Ga0070714_100228759 3300005435 Bacteria 1712
21 Ga0070714_100321275 3300005435 Bacteria 1448
22 Ga0070710_10630996 3300005437 Bacteria 749
23 Ga0070711_101167987 3300005439 Unclassified 665
24 Ga0070678_101319106 3300005456 Bacteria 672
25 Ga0070678_102039226 3300005456 Unclassified 543
26 Ga0070678_102070851 3300005456 Unclassified 539
27 Ga0070662_100232962 3300005457 Bacteria 1474
28 Ga0070681_10024721 3300005458 Bacteria 6043
29 Ga0068867_100056440 3300005459 Unclassified 2906
30 Ga0068867_100650196 3300005459 Bacteria 925
31 Ga0070707_100648862 3300005468 Bacteria 1018
32 Ga0070684_100888753 3300005535 Bacteria 834
33 Ga0070672_101267014 3300005543 Unclassified 658
34 Ga0070665_100383955 3300005548 Bacteria 1412
35 Ga0070704_102277747 3300005549 Unclassified 504
36 Ga0068855_100050746 3300005563 Bacteria 4888
37 Ga0068855_100390816 3300005563 Bacteria 1526
38 Ga0068857_100319313 3300005577 Bacteria 1434
39 Ga0068857_100397506 3300005577 Bacteria 1282
40 Ga0068854_100362328 3300005578 Bacteria 1190
41 Ga0068859_101474832 3300005617 Bacteria 751
42 Ga0068866_10288523 3300005718 Bacteria 1020
43 Ga0068861_100315251 3300005719 Bacteria 1360
44 Ga0068870_10028503 3300005840 Bacteria 2804
45 Ga0068862_100283975 3300005844 Bacteria 1518
46 Ga0081455_10042405 3300005937 Bacteria 3992
47 Ga0081455_10108252 3300005937 Bacteria 2214
48 Ga0081455_10744675 3300005937 Unclassified 620
49 Ga0081539_10002592 3300005985 Bacteria 24830
50 Ga0081539_10003654 3300005985 Bacteria 18513
51 Ga0070717_10549530 3300006028 Bacteria 1046
52 Ga0075365_10001901 3300006038 Bacteria 9838
53 Ga0075364_10037689 3300006051 Bacteria 3132
54 Ga0075367_10526519 3300006178 Bacteria 750
55 Ga0097621_100193084 3300006237 Unclassified 1764
56 Ga0097621_100782367 3300006237 Bacteria 883
57 Ga0068871_100058757 3300006358 Bacteria 3132
58 Ga0075436_100738760 3300006914 Bacteria 730
59 Ga0097620_101475032 3300006931 Bacteria 751
60 Ga0075435_100482329 3300007076 Bacteria 1071
61 Ga0105240_11606901 3300009093 Bacteria 680
62 Ga0111539_10058188 3300009094 Bacteria 4586
63 Ga0105245_10483325 3300009098 Bacteria 1252
64 Ga0105245_10484165 3300009098 Bacteria 1251
65 Ga0105245_11769550 3300009098 Bacteria 671
66 Ga0105245_11880682 3300009098 Unclassified 652
67 Ga0114129_10637481 3300009147 Bacteria 1377
68 Ga0114129_10795203 3300009147 Unclassified 1207
69 Ga0105243_10221651 3300009148 Unclassified 1672
70 Ga0105243_12387007 3300009148 Bacteria 567
71 Ga0105241_12659375 3300009174 Unclassified 503
72 Ga0105242_10002530 3300009176 Bacteria 14346
73 Ga0105242_10147648 3300009176 Bacteria 2047
74 Ga0105242_11135314 3300009176 Unclassified 797
75 Ga0105248_10341896 3300009177 Bacteria 1685
76 Ga0105248_13062204 3300009177 Bacteria 532
77 Ga0105239_10077436 3300010375 Bacteria 3659
78 Ga0105246_10556529 3300011119 Bacteria 984
79 Ga0105246_10961869 3300011119 Bacteria 770
80 Ga0105246_11351292 3300011119 Bacteria 663
81 Ga0157373_10264240 3300013100 Bacteria 1218
82 Ga0157371_10784365 3300013102 Bacteria 717
83 Ga0157374_12886221 3300013296 Unclassified 508
84 Ga0157378_10213267 3300013297 Bacteria 1832
85 Ga0163162_10488671 3300013306 Unclassified 1362
86 Ga0157372_10268363 3300013307 Bacteria 1982
87 Ga0157375_10867609 3300013308 Bacteria 1048
88 Ga0157375_12127781 3300013308 Bacteria 668
89 Ga0163163_10855920 3300014325 Unclassified 973
90 Ga0157380_10530293 3300014326 Unclassified 1150
91 Ga0157380_10965546 3300014326 Unclassified 883
92 Ga0157380_13071136 3300014326 Unclassified 532
93 Ga0182008_10121225 3300014497 Bacteria 1300
94 Ga0182008_10688973 3300014497 Unclassified 582
95 Ga0157377_10875754 3300014745 Bacteria 669
96 Ga0157379_10031562 3300014968 Bacteria 4721
97 Ga0157376_10161512 3300014969 Bacteria 2032
98 Ga0157376_10226361 3300014969 Bacteria 1735
99 Ga0157376_11713436 3300014969 Archaea 664
100 Ga0157376_12711319 3300014969 Bacteria 535
101 Ga0182006_1099422 3300015261 Bacteria 1034
102 Ga0207642_10546170 3300025899 Bacteria 715
103 Ga0207699_10328519 3300025906 Bacteria 1075
104 Ga0207643_10031514 3300025908 Bacteria 2956
105 Ga0207684_11163978 3300025910 Bacteria 640
106 Ga0207707_10044523 3300025912 Bacteria 3869
107 Ga0207693_10337410 3300025915 Bacteria 1180
108 Ga0207693_10958976 3300025915 Bacteria 654
109 Ga0207660_10043974 3300025917 Bacteria 3141
110 Ga0207657_10005654 3300025919 Bacteria 13046
111 Ga0207681_10562031 3300025923 Bacteria 940
112 Ga0207650_10041615 3300025925 Bacteria 3368
113 Ga0207650_10828578 3300025925 Bacteria 784
114 Ga0207659_11368030 3300025926 Unclassified 607
115 Ga0207687_11155794 3300025927 Bacteria 665
116 Ga0207664_10074342 3300025929 Bacteria 2745
117 Ga0207644_10489850 3300025931 Bacteria 1013
118 Ga0207686_11175490 3300025934 Bacteria 627
119 Ga0207709_10365690 3300025935 Bacteria 1093
120 Ga0207704_10626164 3300025938 Bacteria 884
121 Ga0207665_10623836 3300025939 Bacteria 843
122 Ga0207691_10116664 3300025940 Bacteria 2369
123 Ga0207691_10419081 3300025940 Bacteria 1141
124 Ga0207661_10216738 3300025944 Bacteria 1690
125 Ga0207661_10252271 3300025944 Bacteria 1569
126 Ga0207679_10748113 3300025945 Bacteria 889
127 Ga0207667_10026543 3300025949 Bacteria 6324
128 Ga0207667_11241769 3300025949 Bacteria 723
129 Ga0207640_10915194 3300025981 Bacteria 767
130 Ga0207640_11417820 3300025981 Bacteria 623
131 Ga0207675_100391370 3300026118 Bacteria 1368
132 Ga0207683_10804147 3300026121 Bacteria 873
133 Ga0207683_11214093 3300026121 Unclassified 699
134 Ga0207428_10083646 3300027907 Bacteria 2488
135 Ga0307415_101511211 3300032126 Unclassified 643
136 Ga0373961_0266835 3300035241 Unclassified 624
137 Ga0373931_1295888 3300035691 Unclassified 501
138 Ga0395899_0173716 3300037312 Bacteria 1516
139 Ga0395900_0012807 3300037418 Bacteria 8573
140 Ga0395900_0251112 3300037418 Bacteria 1770
141 Ga0395900_0575462 3300037418 Bacteria 1069
142 Ga0395900_0617004 3300037418 Bacteria 1024
143 Ga0395898_0005034 3300037466 Bacteria 14328
144 Ga0395898_0022194 3300037466 Bacteria 6432
145 Ga0395898_0393839 3300037466 Bacteria 1321
146 Ga0395898_0791174 3300037466 Bacteria 889
147 Ga0395905_0017178 3300037471 Bacteria 6873
148 Ga0395905_0238673 3300037471 Bacteria 1699
149 Ga0395905_0426960 3300037471 Bacteria 1222
150 Ga0436364_0691561 3300037853 Bacteria 635
151 Ga0395901_0005619 3300038443 Bacteria 12695
152 Ga0395901_0006209 3300038443 Bacteria 12108
153 Ga0395901_0056634 3300038443 Bacteria 4078
154 Ga0395901_0129604 3300038443 Bacteria 2650
155 Ga0395901_0476166 3300038443 Bacteria 1274
156 Ga0395901_0575239 3300038443 Bacteria 1139
157 Ga0436365_1537269 3300039437 Bacteria 1258
158 Ga0436363_1695102 3300039450 Bacteria 1748
159 Ga0436362_0735028 3300039453 Bacteria 653
160 Ga0439436_0185904 3300041404 Bacteria 592
161 Ga0451802_1153344 3300041460 Bacteria 712
162 Ga0439433_0008239 3300041999 Bacteria 2257
163 Ga0439442_020124 3300042002 Bacteria 1383
164 Ga0439456_018089 3300042013 Unclassified 1479
165 Ga0439462_0037414 3300042015 Bacteria 1293
166 Ga0450923_109405 3300042125 Bacteria 644
167 Ga0439446_0002894 3300042156 Bacteria 4187
168 Ga0439434_0013017 3300042435 Bacteria 2467
169 Ga0466969_0050591 3300044656 Bacteria 2048
170 Ga0466961_0064585 3300044693 Bacteria 2326
171 Ga0466963_0161163 3300044694 Bacteria 1561
172 Ga0466963_0322035 3300044694 Bacteria 1088
173 Ga0466963_0454584 3300044694 Bacteria 904
174 Ga0466964_0003040 3300044706 Bacteria 6086
175 Ga0466968_0045871 3300044735 Bacteria 1856
176 Ga0466970_0340296 3300044765 Bacteria 850
177 Ga0466970_0663162 3300044765 Bacteria 607
178 Ga0466960_0675092 3300044901 Bacteria 618
179 Ga0466959_0033695 3300045049 Bacteria 3788
180 Ga0466959_0333427 3300045049 Bacteria 1036
181 Ga0466958_0018234 3300045836 Bacteria 4071
182 Ga0466958_0380585 3300045836 Unclassified 910
183 Ga0466967_0332941 3300045976 Bacteria 1466
184 Ga0466967_0443294 3300045976 Bacteria 1268
185 Ga0466967_0929058 3300045976 Bacteria 865
186 Ga0466967_1104779 3300045976 Bacteria 790
187 Ga0495603_0766077 3300046455 Bacteria 551
188 Ga0495629_0008509 3300046459 Bacteria 7556
189 Ga0495641_0101366 3300046461 Bacteria 1285
190 Ga0495594_0755564 3300046499 Unclassified 549
191 Ga0495618_0528220 3300046514 Unclassified 709
192 Ga0495586_0253323 3300046535 Bacteria 1005
193 Ga0495624_0565328 3300046690 Unclassified 679
194 Ga0495674_0770177 3300047319 Unclassified 750
195 Ga0496101_0670321 3300048904 Bacteria 819
196 Ga0496102_0155582 3300048905 Bacteria 2149
197 Ga0496102_0195415 3300048905 Archaea 1907
198 Ga0496102_0619987 3300048905 Bacteria 1005
199 Ga0496102_0646145 3300048905 Bacteria 981
200 Ga0496102_0913432 3300048905 Bacteria 799
201 Ga0496102_1033212 3300048905 Unclassified 742
202 Ga0496105_0103596 3300048908 Bacteria 2350
203 Ga0496105_0394924 3300048908 Bacteria 1099
204 Ga0496105_0864064 3300048908 Unclassified 684
205 Ga0496107_0196123 3300048910 Bacteria 1501
206 Ga0496108_0289668 3300048911 Unclassified 1426
207 Ga0496109_0372548 3300048912 Bacteria 1349
208 Ga0496109_0500067 3300048912 Unclassified 1148
209 Ga0496110_0053398 3300048913 Bacteria 3553
210 Ga0496110_0762542 3300048913 Bacteria 871
211 Ga0496112_0014299 3300048915 Bacteria 7353
212 Ga0496113_0840813 3300048916 Bacteria 728
213 Ga0496114_0247675 3300048917 Unclassified 1568
214 Ga0496114_1541938 3300048917 Unclassified 552
215 Ga0501031_0016598 3300049568 Bacteria 4781
216 Ga0501031_0558330 3300049568 Bacteria 737
217 Ga0501032_0075727 3300049569 Bacteria 2241
218 Ga0501036_0028093 3300049572 Bacteria 4755
219 Ga0501037_0047895 3300049573 Bacteria 3132
220 Ga0501038_0021837 3300049574 Bacteria 5741
221 Ga0501039_0095511 3300049575 Bacteria 2318
222 Ga0501039_0881881 3300049575 Archaea 697
223 Ga0501039_1085711 3300049575 Bacteria 620
224 Ga0501040_0033202 3300049576 Bacteria 3495
225 Ga0501040_0071303 3300049576 Bacteria 2398
226 Ga0501040_0133716 3300049576 Bacteria 1745
227 Ga0501041_0154093 3300049577 Bacteria 1435
228 Ga0501042_0000831 3300049578 Bacteria 17146
229 Ga0501043_0137356 3300049579 Bacteria 1915
230 Ga0501046_0025739 3300049580 Bacteria 4812
231 Ga0501047_0372171 3300049581 Bacteria 1264
232 Ga0501048_0401427 3300049582 Archaea 980
233 Ga0501048_0994982 3300049582 Bacteria 603
234 Ga0501067_0011889 3300049583 Bacteria 4823
235 Ga0501067_0074603 3300049583 Bacteria 1880
236 Ga0501068_0001680 3300049584 Bacteria 11804
237 Ga0501068_0403660 3300049584 Bacteria 881
238 Ga0501070_0031945 3300049586 Bacteria 4409
239 Ga0501071_0038363 3300049587 Bacteria 3423
240 Ga0501071_0190584 3300049587 Archaea 1538
241 Ga0501071_0193186 3300049587 Bacteria 1527
242 Ga0501072_0006258 3300049588 Bacteria 9072
243 Ga0501072_0008449 3300049588 Bacteria 7812
244 Ga0501072_0172846 3300049588 Bacteria 1724
245 Ga0501073_0030754 3300049589 Bacteria 3833
246 Ga0501074_0011638 3300049590 Bacteria 6395
247 Ga0501074_0605275 3300049590 Bacteria 775
248 Ga0501074_1143872 3300049590 Bacteria 546
249 Ga0501075_0080695 3300049591 Bacteria 2462
250 Ga0501076_0020130 3300049592 Bacteria 5105
251 Ga0501076_0077718 3300049592 Bacteria 2663
252 Ga0501077_0018169 3300049593 Bacteria 4446
253 Ga0501077_0034916 3300049593 Bacteria 3201
254 Ga0501079_0009137 3300049741 Bacteria 7503
255 Ga0501080_0043372 3300049742 Bacteria 4188
256 Ga0501081_0011795 3300049743 Bacteria 5724
257 Ga0501081_0029185 3300049743 Bacteria 3726
258 Ga0501081_0857695 3300049743 Bacteria 684
259 Ga0501083_0013344 3300049744 Bacteria 5745
260 Ga0501035_0019890 3300049822 Bacteria 6167
261 Ga0501035_1226215 3300049822 Bacteria 581
262 Ga0501044_0077194 3300049823 Bacteria 3379
263 Ga0501044_1179760 3300049823 Bacteria 634
264 Ga0501045_0011323 3300049824 Bacteria 6261
265 nmdc:mga00v17_47389_c1 3300050491 Bacteria 2603
266 nmdc:mga0yw44_9351_c1 3300050492 Bacteria 4949
267 nmdc:mga08y16_82371_c1 3300050511 Bacteria 3354
268 nmdc:mga0rr50_1332710_c1 3300050513 Unclassified 608
269 nmdc:mga08x19_674152_c1 3300050514 Bacteria 734
270 nmdc:mga0a205_248888_c1 3300050515 Bacteria 1657
271 Ga0495619_0131987 3300053085 Bacteria 1717
272 Ga0501084_0006835 3300054114 Bacteria 9387
273 Ga0501084_0093183 3300054114 Bacteria 2529
274 Ga0501082_0056150 3300060353 Bacteria 3391
275 Ga0501082_1200923 3300060353 Unclassified 663
276 Ga0501082_1541428 3300060353 Bacteria 580
277 Ga0501082_1866804 3300060353 Bacteria 524
278 Ga0530510_0003512 3300061734 Bacteria 10779
279 Ga0530510_0055165 3300061734 Bacteria 2871
280 Ga0530510_0210590 3300061734 Archaea 1444

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_10795203 Ga0114129_107952033 80
2 3300046455 Ga0495603_0766077 Ga0495603_0766077_115_408 82
3 3300005937 Ga0081455_10042405 Ga0081455_100424053 83
4 3300042013 Ga0439456_018089 Ga0439456_018089_181_516 83
5 3300045836 Ga0466958_0018234 Ga0466958_0018234_993_1259 83
6 3300045976 Ga0466967_0929058 Ga0466967_0929058_551_817 83
7 3300049568 Ga0501031_0016598 Ga0501031_0016598_488_784 83
8 3300049569 Ga0501032_0075727 Ga0501032_0075727_314_610 83
9 3300049572 Ga0501036_0028093 Ga0501036_0028093_114_410 83
10 3300049573 Ga0501037_0047895 Ga0501037_0047895_797_1093 83
11 3300049574 Ga0501038_0021837 Ga0501038_0021837_381_677 83
12 3300049575 Ga0501039_1085711 Ga0501039_1085711_314_610 83
13 3300049576 Ga0501040_0071303 Ga0501040_0071303_2092_2388 83
14 3300049577 Ga0501041_0154093 Ga0501041_0154093_302_598 83
15 3300049578 Ga0501042_0000831 Ga0501042_0000831_4077_4373 83
16 3300049579 Ga0501043_0137356 Ga0501043_0137356_77_373 83
17 3300049580 Ga0501046_0025739 Ga0501046_0025739_609_905 83
18 3300049581 Ga0501047_0372171 Ga0501047_0372171_941_1237 83
19 3300049584 Ga0501068_0001680 Ga0501068_0001680_10120_10416 83
20 3300049586 Ga0501070_0031945 Ga0501070_0031945_1750_2046 83
21 3300049587 Ga0501071_0038363 Ga0501071_0038363_917_1213 83
22 3300049588 Ga0501072_0008449 Ga0501072_0008449_5878_6174 83
23 3300049589 Ga0501073_0030754 Ga0501073_0030754_1790_2086 83
24 3300049590 Ga0501074_0011638 Ga0501074_0011638_1709_2005 83
25 3300049591 Ga0501075_0080695 Ga0501075_0080695_300_596 83
26 3300049592 Ga0501076_0020130 Ga0501076_0020130_646_942 83
27 3300049593 Ga0501077_0018169 Ga0501077_0018169_130_426 83
28 3300049741 Ga0501079_0009137 Ga0501079_0009137_4351_4647 83
29 3300049742 Ga0501080_0043372 Ga0501080_0043372_1682_1978 83
30 3300049743 Ga0501081_0011795 Ga0501081_0011795_1749_2045 83
31 3300049744 Ga0501083_0013344 Ga0501083_0013344_52_348 83
32 3300049822 Ga0501035_0019890 Ga0501035_0019890_1872_2168 83
33 3300049823 Ga0501044_0077194 Ga0501044_0077194_947_1243 83
34 3300049824 Ga0501045_0011323 Ga0501045_0011323_139_435 83
35 3300054114 Ga0501084_0006835 Ga0501084_0006835_18_314 83
36 3300060353 Ga0501082_0056150 Ga0501082_0056150_1801_2097 83
37 3300061734 Ga0530510_0003512 Ga0530510_0003512_10345_10641 83
38 3300038443 Ga0395901_0056634 Ga0395901_0056634_2463_2759 84
39 3300037853 Ga0436364_0691561 Ga0436364_0691561_353_610 85
40 3300039437 Ga0436365_1537269 Ga0436365_1537269_919_1176 85
41 3300039450 Ga0436363_1695102 Ga0436363_1695102_582_839 85
42 3300039453 Ga0436362_0735028 Ga0436362_0735028_100_360 86
43 3300044706 Ga0466964_0003040 Ga0466964_0003040_3988_4248 86
44 3300049583 Ga0501067_0074603 Ga0501067_0074603_1372_1632 86
45 3300037418 Ga0395900_0251112 Ga0395900_0251112_166_429 87
46 3300037418 Ga0395900_0575462 Ga0395900_0575462_210_473 87
47 3300037466 Ga0395898_0022194 Ga0395898_0022194_459_722 87
48 3300037471 Ga0395905_0238673 Ga0395905_0238673_715_978 87
49 3300038443 Ga0395901_0005619 Ga0395901_0005619_2723_2986 87
50 3300005434 Ga0070709_10743148 Ga0070709_107431481 88
51 3300005435 Ga0070714_100072342 Ga0070714_1000723422 88
52 3300005437 Ga0070710_10630996 Ga0070710_106309961 88
53 3300005439 Ga0070711_101167987 Ga0070711_1011679872 88
54 3300006914 Ga0075436_100738760 Ga0075436_1007387602 88
55 3300025906 Ga0207699_10328519 Ga0207699_103285193 88
56 3300025915 Ga0207693_10337410 Ga0207693_103374103 88
57 3300025939 Ga0207665_10623836 Ga0207665_106238361 88
58 3300035241 Ga0373961_0266835 Ga0373961_0266835_278_544 88
59 3300035691 Ga0373931_1295888 Ga0373931_1295888_200_466 88
60 3300046459 Ga0495629_0008509 Ga0495629_0008509_958_1242 88
61 3300046499 Ga0495594_0755564 Ga0495594_0755564_55_339 88
62 3300046514 Ga0495618_0528220 Ga0495618_0528220_330_596 88
63 3300046535 Ga0495586_0253323 Ga0495586_0253323_574_858 88
64 3300048913 Ga0496110_0762542 Ga0496110_0762542_173_439 88
65 3300048917 Ga0496114_1541938 Ga0496114_1541938_223_489 88
66 3300050513 nmdc:mga0rr50_1332710_c1 nmdc:mga0rr50_1332710_c1_239_505 88
67 3300050514 nmdc:mga08x19_674152_c1 nmdc:mga08x19_674152_c1_213_482 88
68 3300050515 nmdc:mga0a205_248888_c1 nmdc:mga0a205_248888_c1_240_506 88
69 3300053085 Ga0495619_0131987 Ga0495619_0131987_655_921 88
70 3300060353 Ga0501082_1200923 Ga0501082_1200923_233_502 88
71 3300037418 Ga0395900_0617004 Ga0395900_0617004_656_925 89
72 3300044694 Ga0466963_0161163 Ga0466963_0161163_627_896 89
73 3300044901 Ga0466960_0675092 Ga0466960_0675092_103_372 89
74 3300045976 Ga0466967_0443294 Ga0466967_0443294_191_460 89
75 3300005329 Ga0070683_102025040 Ga0070683_1020250401 90
76 3300005339 Ga0070660_100008163 Ga0070660_1000081634 90
77 3300005339 Ga0070660_100084956 Ga0070660_1000849563 90
78 3300005366 Ga0070659_101649557 Ga0070659_1016495571 90
79 3300005435 Ga0070714_100321275 Ga0070714_1003212751 90
80 3300005458 Ga0070681_10024721 Ga0070681_100247217 90
81 3300005563 Ga0068855_100050746 Ga0068855_1000507467 90
82 3300005563 Ga0068855_100390816 Ga0068855_1003908161 90
83 3300005937 Ga0081455_10108252 Ga0081455_101082523 90
84 3300005985 Ga0081539_10002592 Ga0081539_100025922 90
85 3300009098 Ga0105245_11880682 Ga0105245_118806822 90
86 3300009174 Ga0105241_12659375 Ga0105241_126593752 90
87 3300013100 Ga0157373_10264240 Ga0157373_102642403 90
88 3300013102 Ga0157371_10784365 Ga0157371_107843652 90
89 3300013307 Ga0157372_10268363 Ga0157372_102683632 90
90 3300014497 Ga0182008_10688973 Ga0182008_106889731 90
91 3300025912 Ga0207707_10044523 Ga0207707_100445233 90
92 3300025915 Ga0207693_10958976 Ga0207693_109589762 90
93 3300025917 Ga0207660_10043974 Ga0207660_100439743 90
94 3300025919 Ga0207657_10005654 Ga0207657_1000565410 90
95 3300025929 Ga0207664_10074342 Ga0207664_100743421 90
96 3300025949 Ga0207667_10026543 Ga0207667_100265433 90
97 3300025949 Ga0207667_11241769 Ga0207667_112417691 90
98 3300025981 Ga0207640_11417820 Ga0207640_114178201 90
99 3300038443 Ga0395901_0575239 Ga0395901_0575239_77_352 90
100 3300045976 Ga0466967_1104779 Ga0466967_1104779_342_614 90
101 3300048905 Ga0496102_0155582 Ga0496102_0155582_1660_1932 90
102 3300049583 Ga0501067_0011889 Ga0501067_0011889_4117_4389 90
103 3300049590 Ga0501074_0605275 Ga0501074_0605275_199_471 90
104 3300061734 Ga0530510_0055165 Ga0530510_0055165_2122_2394 90
105 3300005327 Ga0070658_10872974 Ga0070658_108729741 91
106 3300005329 Ga0070683_101016694 Ga0070683_1010166942 91
107 3300005456 Ga0070678_101319106 Ga0070678_1013191061 91
108 3300005456 Ga0070678_102070851 Ga0070678_1020708511 91
109 3300006237 Ga0097621_100193084 Ga0097621_1001930845 91
110 3300025910 Ga0207684_11163978 Ga0207684_111639783 91
111 3300025940 Ga0207691_10419081 Ga0207691_104190812 91
112 3300025944 Ga0207661_10216738 Ga0207661_102167381 91
113 3300026121 Ga0207683_10804147 Ga0207683_108041472 91
114 3300044656 Ga0466969_0050591 Ga0466969_0050591_652_936 91
115 3300044693 Ga0466961_0064585 Ga0466961_0064585_177_461 91
116 3300044694 Ga0466963_0322035 Ga0466963_0322035_447_731 91
117 3300044735 Ga0466968_0045871 Ga0466968_0045871_121_402 91
118 3300044765 Ga0466970_0340296 Ga0466970_0340296_360_644 91
119 3300044765 Ga0466970_0663162 Ga0466970_0663162_284_562 91
120 3300045049 Ga0466959_0033695 Ga0466959_0033695_2845_3129 91
121 3300045049 Ga0466959_0333427 Ga0466959_0333427_447_725 91
122 3300045836 Ga0466958_0380585 Ga0466958_0380585_565_849 91
123 3300048905 Ga0496102_0619987 Ga0496102_0619987_420_695 91
124 3300048905 Ga0496102_1033212 Ga0496102_1033212_246_527 91
125 3300048917 Ga0496114_0247675 Ga0496114_0247675_907_1188 91
126 3300005329 Ga0070683_100220987 Ga0070683_1002209872 92
127 3300005331 Ga0070670_100064618 Ga0070670_1000646184 92
128 3300005338 Ga0068868_100750214 Ga0068868_1007502142 92
129 3300005456 Ga0070678_102039226 Ga0070678_1020392262 92
130 3300005457 Ga0070662_100232962 Ga0070662_1002329622 92
131 3300005459 Ga0068867_100650196 Ga0068867_1006501961 92
132 3300005535 Ga0070684_100888753 Ga0070684_1008887532 92
133 3300005548 Ga0070665_100383955 Ga0070665_1003839553 92
134 3300005549 Ga0070704_102277747 Ga0070704_1022777471 92
135 3300005577 Ga0068857_100319313 Ga0068857_1003193132 92
136 3300005577 Ga0068857_100397506 Ga0068857_1003975062 92
137 3300005578 Ga0068854_100362328 Ga0068854_1003623282 92
138 3300005719 Ga0068861_100315251 Ga0068861_1003152512 92
139 3300005840 Ga0068870_10028503 Ga0068870_100285034 92
140 3300005844 Ga0068862_100283975 Ga0068862_1002839752 92
141 3300005937 Ga0081455_10744675 Ga0081455_107446752 92
142 3300005985 Ga0081539_10003654 Ga0081539_100036542 92
143 3300006178 Ga0075367_10526519 Ga0075367_105265192 92
144 3300006237 Ga0097621_100782367 Ga0097621_1007823671 92
145 3300009093 Ga0105240_11606901 Ga0105240_116069012 92
146 3300009094 Ga0111539_10058188 Ga0111539_100581884 92
147 3300009098 Ga0105245_10483325 Ga0105245_104833251 92
148 3300009098 Ga0105245_10484165 Ga0105245_104841651 92
149 3300009098 Ga0105245_11769550 Ga0105245_117695501 92
150 3300009148 Ga0105243_12387007 Ga0105243_123870072 92
151 3300009176 Ga0105242_10147648 Ga0105242_101476484 92
152 3300009176 Ga0105242_11135314 Ga0105242_111353142 92
153 3300009177 Ga0105248_10341896 Ga0105248_103418962 92
154 3300009177 Ga0105248_13062204 Ga0105248_130622041 92
155 3300010375 Ga0105239_10077436 Ga0105239_100774364 92
156 3300011119 Ga0105246_10556529 Ga0105246_105565293 92
157 3300011119 Ga0105246_10961869 Ga0105246_109618692 92
158 3300011119 Ga0105246_11351292 Ga0105246_113512922 92
159 3300013296 Ga0157374_12886221 Ga0157374_128862211 92
160 3300013308 Ga0157375_12127781 Ga0157375_121277812 92
161 3300014325 Ga0163163_10855920 Ga0163163_108559202 92
162 3300014326 Ga0157380_10965546 Ga0157380_109655462 92
163 3300014326 Ga0157380_13071136 Ga0157380_130711361 92
164 3300014497 Ga0182008_10121225 Ga0182008_101212253 92
165 3300014745 Ga0157377_10875754 Ga0157377_108757542 92
166 3300014969 Ga0157376_10226361 Ga0157376_102263612 92
167 3300014969 Ga0157376_11713436 Ga0157376_117134362 92
168 3300014969 Ga0157376_12711319 Ga0157376_127113192 92
169 3300015261 Ga0182006_1099422 Ga0182006_10994221 92
170 3300025899 Ga0207642_10546170 Ga0207642_105461701 92
171 3300025908 Ga0207643_10031514 Ga0207643_100315145 92
172 3300025923 Ga0207681_10562031 Ga0207681_105620311 92
173 3300025925 Ga0207650_10041615 Ga0207650_100416155 92
174 3300025926 Ga0207659_11368030 Ga0207659_113680302 92
175 3300025927 Ga0207687_11155794 Ga0207687_111557941 92
176 3300025931 Ga0207644_10489850 Ga0207644_104898501 92
177 3300025934 Ga0207686_11175490 Ga0207686_111754902 92
178 3300025935 Ga0207709_10365690 Ga0207709_103656902 92
179 3300025944 Ga0207661_10252271 Ga0207661_102522713 92
180 3300025945 Ga0207679_10748113 Ga0207679_107481131 92
181 3300025981 Ga0207640_10915194 Ga0207640_109151942 92
182 3300026118 Ga0207675_100391370 Ga0207675_1003913703 92
183 3300026121 Ga0207683_11214093 Ga0207683_112140932 92
184 3300027907 Ga0207428_10083646 Ga0207428_100836462 92
185 3300032126 Ga0307415_101511211 Ga0307415_1015112111 92
186 3300037312 Ga0395899_0173716 Ga0395899_0173716_639_926 92
187 3300037418 Ga0395900_0012807 Ga0395900_0012807_4370_4654 92
188 3300037466 Ga0395898_0005034 Ga0395898_0005034_13706_13990 92
189 3300037466 Ga0395898_0393839 Ga0395898_0393839_57_335 92
190 3300037466 Ga0395898_0791174 Ga0395898_0791174_189_473 92
191 3300037471 Ga0395905_0017178 Ga0395905_0017178_19_303 92
192 3300037471 Ga0395905_0426960 Ga0395905_0426960_738_1025 92
193 3300038443 Ga0395901_0006209 Ga0395901_0006209_2086_2370 92
194 3300038443 Ga0395901_0129604 Ga0395901_0129604_315_599 92
195 3300038443 Ga0395901_0476166 Ga0395901_0476166_239_523 92
196 3300041460 Ga0451802_1153344 Ga0451802_1153344_32_313 92
197 3300044694 Ga0466963_0454584 Ga0466963_0454584_103_390 92
198 3300045976 Ga0466967_0332941 Ga0466967_0332941_1024_1308 92
199 3300046461 Ga0495641_0101366 Ga0495641_0101366_777_1058 92
200 3300046690 Ga0495624_0565328 Ga0495624_0565328_33_314 92
201 3300047319 Ga0495674_0770177 Ga0495674_0770177_223_507 92
202 3300048904 Ga0496101_0670321 Ga0496101_0670321_101_382 92
203 3300048905 Ga0496102_0646145 Ga0496102_0646145_91_375 92
204 3300048905 Ga0496102_0913432 Ga0496102_0913432_332_613 92
205 3300048908 Ga0496105_0103596 Ga0496105_0103596_1839_2120 92
206 3300048908 Ga0496105_0864064 Ga0496105_0864064_372_653 92
207 3300048910 Ga0496107_0196123 Ga0496107_0196123_302_583 92
208 3300048911 Ga0496108_0289668 Ga0496108_0289668_475_765 92
209 3300048912 Ga0496109_0372548 Ga0496109_0372548_994_1275 92
210 3300048912 Ga0496109_0500067 Ga0496109_0500067_724_1005 92
211 3300048913 Ga0496110_0053398 Ga0496110_0053398_3004_3291 92
212 3300048915 Ga0496112_0014299 Ga0496112_0014299_308_592 92
213 3300048916 Ga0496113_0840813 Ga0496113_0840813_33_314 92
214 3300049568 Ga0501031_0558330 Ga0501031_0558330_435_716 92
215 3300049575 Ga0501039_0095511 Ga0501039_0095511_1993_2277 92
216 3300049575 Ga0501039_0881881 Ga0501039_0881881_359_652 92
217 3300049576 Ga0501040_0033202 Ga0501040_0033202_3079_3363 92
218 3300049576 Ga0501040_0133716 Ga0501040_0133716_156_449 92
219 3300049582 Ga0501048_0401427 Ga0501048_0401427_264_557 92
220 3300049584 Ga0501068_0403660 Ga0501068_0403660_540_824 92
221 3300049587 Ga0501071_0190584 Ga0501071_0190584_530_823 92
222 3300049588 Ga0501072_0006258 Ga0501072_0006258_8777_9061 92
223 3300049588 Ga0501072_0172846 Ga0501072_0172846_736_1020 92
224 3300049592 Ga0501076_0077718 Ga0501076_0077718_158_442 92
225 3300049593 Ga0501077_0034916 Ga0501077_0034916_2500_2793 92
226 3300049743 Ga0501081_0029185 Ga0501081_0029185_2781_3074 92
227 3300049743 Ga0501081_0857695 Ga0501081_0857695_144_428 92
228 3300049822 Ga0501035_1226215 Ga0501035_1226215_12_296 92
229 3300049823 Ga0501044_1179760 Ga0501044_1179760_252_536 92
230 3300050511 nmdc:mga08y16_82371_c1 nmdc:mga08y16_82371_c1_620_907 92
231 3300054114 Ga0501084_0093183 Ga0501084_0093183_2141_2422 92
232 3300060353 Ga0501082_1541428 Ga0501082_1541428_54_341 92
233 3300061734 Ga0530510_0210590 Ga0530510_0210590_515_808 92
234 3300005331 Ga0070670_100409297 Ga0070670_1004092971 93
235 3300005435 Ga0070714_100228759 Ga0070714_1002287592 93
236 3300005468 Ga0070707_100648862 Ga0070707_1006488621 93
237 3300006028 Ga0070717_10549530 Ga0070717_105495302 93
238 3300006038 Ga0075365_10001901 Ga0075365_100019018 93
239 3300006051 Ga0075364_10037689 Ga0075364_100376893 93
240 3300007076 Ga0075435_100482329 Ga0075435_1004823292 93
241 3300009147 Ga0114129_10637481 Ga0114129_106374813 93
242 3300025925 Ga0207650_10828578 Ga0207650_108285781 93
243 3300041404 Ga0439436_0185904 Ga0439436_0185904_252_545 93
244 3300041999 Ga0439433_0008239 Ga0439433_0008239_984_1277 93
245 3300042002 Ga0439442_020124 Ga0439442_020124_923_1216 93
246 3300042015 Ga0439462_0037414 Ga0439462_0037414_159_452 93
247 3300042125 Ga0450923_109405 Ga0450923_109405_260_553 93
248 3300042156 Ga0439446_0002894 Ga0439446_0002894_345_638 93
249 3300042435 Ga0439434_0013017 Ga0439434_0013017_1691_1984 93
250 3300048905 Ga0496102_0195415 Ga0496102_0195415_507_791 93
251 3300048908 Ga0496105_0394924 Ga0496105_0394924_771_1052 93
252 3300049582 Ga0501048_0994982 Ga0501048_0994982_281_565 93
253 3300049587 Ga0501071_0193186 Ga0501071_0193186_646_930 93
254 3300049590 Ga0501074_1143872 Ga0501074_1143872_219_503 93
255 3300050491 nmdc:mga00v17_47389_c1 nmdc:mga00v17_47389_c1_149_430 93
256 3300050492 nmdc:mga0yw44_9351_c1 nmdc:mga0yw44_9351_c1_3185_3466 93
257 3300060353 Ga0501082_1866804 Ga0501082_1866804_112_396 93
258 3300005330 Ga0070690_100566104 Ga0070690_1005661042 94
259 3300005338 Ga0068868_100123837 Ga0068868_1001238374 94
260 3300005340 Ga0070689_100057789 Ga0070689_1000577893 94
261 3300005356 Ga0070674_100068014 Ga0070674_1000680142 94
262 3300005365 Ga0070688_100323192 Ga0070688_1003231922 94
263 3300005367 Ga0070667_101383623 Ga0070667_1013836231 94
264 3300005459 Ga0068867_100056440 Ga0068867_1000564401 94
265 3300005543 Ga0070672_101267014 Ga0070672_1012670141 94
266 3300005617 Ga0068859_101474832 Ga0068859_1014748322 94
267 3300005718 Ga0068866_10288523 Ga0068866_102885232 94
268 3300006358 Ga0068871_100058757 Ga0068871_1000587573 94
269 3300006931 Ga0097620_101475032 Ga0097620_1014750322 94
270 3300009148 Ga0105243_10221651 Ga0105243_102216511 94
271 3300009176 Ga0105242_10002530 Ga0105242_1000253014 94
272 3300013297 Ga0157378_10213267 Ga0157378_102132672 94
273 3300013306 Ga0163162_10488671 Ga0163162_104886712 94
274 3300013308 Ga0157375_10867609 Ga0157375_108676092 94
275 3300014326 Ga0157380_10530293 Ga0157380_105302933 94
276 3300014968 Ga0157379_10031562 Ga0157379_100315624 94
277 3300014969 Ga0157376_10161512 Ga0157376_101615123 94
278 3300025938 Ga0207704_10626164 Ga0207704_106261642 94
279 3300025940 Ga0207691_10116664 Ga0207691_101166643 94
280 3300005327 Ga0070658_10629055 Ga0070658_106290552 95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lg7-assembly1.cif.gz_B crystal structure of hiv epitope-scaffold 4e10_s0_1ez3a_002_c 0.3683 6 94
4fbs-assembly1.cif.gz_A structure of monomeric nt from euprosthenops australis major ampullate spidroin 1 (masp1) 0.3591 3 92
4fbs-assembly1.cif.gz_A structure of monomeric nt from euprosthenops australis major ampullate spidroin 1 (masp1) 0.3471 3 92
6ypi-assembly1.cif.gz_A structure of the engineered metallo-diels-alderase da7 w16g,k58q,l77r,t78r 0.3257 4 94
6ypi-assembly1.cif.gz_A structure of the engineered metallo-diels-alderase da7 w16g,k58q,l77r,t78r 0.3164 4 94
ID Description Score Start End Superfamily
af_Q9VQ27_10_86_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.5349 1 76 1.10.10.60
af_I1NAJ9_422_483_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.5152 3 73 1.10.10.60
af_Q9VQ27_10_86_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.5106 1 76 1.10.10.60
af_I1NAJ9_422_483_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.5048 3 73 1.10.10.60
af_Q9UT77_462_524_1.10.10.410 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.4906 4 64 1.10.10.410
ID Description Score Start End GO Terms
AF-A0A538LD28-F1-model_v4 Uncharacterized protein 0.9549 10 95
AF-A0A535ZGM3-F1-model_v4 Uncharacterized protein 0.9512 6 95
AF-A0A537ZRM2-F1-model_v4 Uncharacterized protein 0.9492 3 95
AF-A0A7W7QU73-F1-model_v4 Uncharacterized protein 0.9489 6 91
AF-A0A535HQ90-F1-model_v4 Uncharacterized protein 0.9455 3 95

Feature Viewer

pLDDT pTM Quality
92.57 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map