F383552

General Info

Members Datasets Scaffolds Average Seq Length
280 193 560 263

Family's Representative Sequence

Representative Sequence 3300005834|Ga0068851_10006274|Ga0068851_100062745
Length 296
Sequence VAQREHAVNEIVLHVGMRSTQRPPGNFKNTNVSKGEHMPLVKHKIKRYGWVADTPDFRDHLYGAPVAALVKLPPKVDLRPQCPKTIYDQGQLGSCTGNAIACAMQFNRMKLKRKPNFIPSRLFIYYNERDMEDTIASDSGAQIRDGIKSVAKLGDCPETDWPYDISKFATKPPAQCYTKAAKYKTVLYQRVSQSLNQMKGCLASGFPFVFGFSVYDSFESAAVARSGVVPMPGATEKQIGGHAVLAVGYDDKEQRFLVRNSWGPKWGIGGYFTMPYAYMTDSNLADDLWTIRVVAS

Samples

Sample ID Description Type Environment
1 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
126 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
127 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
128 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
129 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
132 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
134 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
135 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
136 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
137 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
138 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
139 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
140 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
141 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
142 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
147 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
148 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
149 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
150 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
158 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
163 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
164 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
170 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
171 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
172 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
173 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
192 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
193 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.71
Nodule 0
Rhizoplane 4.29
Rhizosphere 93.93
Stem 0
Stem Tuber 0
Unclassified 23.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068851_10006274 3300005834 Bacteria 5425
2 Ga0065715_10283819 3300005293 Bacteria 1079
3 Ga0070658_10015941 3300005327 Bacteria 6011
4 Ga0070676_10023200 3300005328 Bacteria 3486
5 Ga0070683_100057580 3300005329 Unclassified 3610
6 Ga0070683_100716917 3300005329 Bacteria 958
7 Ga0070690_100046020 3300005330 Bacteria 2773
8 Ga0070670_100010466 3300005331 Bacteria 7915
9 Ga0070677_10014444 3300005333 Unclassified 2779
10 Ga0068869_100362136 3300005334 Bacteria 1184
11 Ga0068868_100000464 3300005338 Bacteria 27008
12 Ga0068868_100049099 3300005338 Bacteria 3312
13 Ga0070661_100001620 3300005344 Bacteria 15563
14 Ga0070692_10062291 3300005345 Unclassified 1968
15 Ga0070668_100164875 3300005347 Bacteria 1800
16 Ga0070668_100226959 3300005347 Bacteria 1542
17 Ga0070669_100184358 3300005353 Bacteria 1634
18 Ga0070675_100000914 3300005354 Bacteria 20982
19 Ga0070675_100149079 3300005354 Bacteria 2004
20 Ga0070671_100001694 3300005355 Bacteria 16720
21 Ga0070671_100169268 3300005355 Bacteria 1847
22 Ga0070674_100034990 3300005356 Bacteria 3360
23 Ga0070674_100072530 3300005356 Unclassified 2438
24 Ga0070673_100019865 3300005364 Bacteria 4832
25 Ga0070673_100111292 3300005364 Bacteria 2271
26 Ga0070659_100588429 3300005366 Unclassified 955
27 Ga0070667_100133050 3300005367 Unclassified 2172
28 Ga0070709_10064810 3300005434 Bacteria 2337
29 Ga0070714_100193741 3300005435 Bacteria 1856
30 Ga0070714_100346287 3300005435 Bacteria 1395
31 Ga0070713_100052573 3300005436 Bacteria 3373
32 Ga0070713_100195580 3300005436 Bacteria 1824
33 Ga0070705_100411495 3300005440 Unclassified 1004
34 Ga0070705_100625133 3300005440 Unclassified 836
35 Ga0070708_100059549 3300005445 Bacteria 3405
36 Ga0070663_100170441 3300005455 Unclassified 1682
37 Ga0070663_100265054 3300005455 Bacteria 1364
38 Ga0070678_100002846 3300005456 Bacteria 9574
39 Ga0070662_100250035 3300005457 Bacteria 1425
40 Ga0070681_10003873 3300005458 Bacteria 14079
41 Ga0070681_10074800 3300005458 Bacteria 3348
42 Ga0070681_10207950 3300005458 Unclassified 1874
43 Ga0068867_100024594 3300005459 Unclassified 4316
44 Ga0068867_100050663 3300005459 Bacteria 3061
45 Ga0070706_100159758 3300005467 Bacteria 2104
46 Ga0070698_100133561 3300005471 Bacteria 2436
47 Ga0070684_100008560 3300005535 Bacteria 8008
48 Ga0070684_100036391 3300005535 Unclassified 4218
49 Ga0070697_100054180 3300005536 Viruses 3260
50 Ga0070672_100004031 3300005543 Bacteria 9583
51 Ga0070672_100520505 3300005543 Bacteria 1030
52 Ga0070686_100023874 3300005544 Bacteria 3660
53 Ga0070665_100080072 3300005548 Unclassified 3272
54 Ga0070665_100490228 3300005548 Bacteria 1240
55 Ga0070704_100133754 3300005549 Unclassified 1926
56 Ga0068855_100067972 3300005563 Bacteria 4149
57 Ga0068855_100866605 3300005563 Unclassified 956
58 Ga0070664_100002897 3300005564 Bacteria 13890
59 Ga0070664_100124740 3300005564 Unclassified 2258
60 Ga0068857_100077619 3300005577 Bacteria 2964
61 Ga0068854_100033590 3300005578 Unclassified 3577
62 Ga0068856_100000003 3300005614 Bacteria 320456
63 Ga0068856_100000380 3300005614 Bacteria 48567
64 Ga0068856_100048312 3300005614 Bacteria 4192
65 Ga0068856_100625997 3300005614 Bacteria 1097
66 Ga0070702_100025222 3300005615 Bacteria 3183
67 Ga0068852_100020825 3300005616 Bacteria 5219
68 Ga0068859_100106341 3300005617 Bacteria 2865
69 Ga0068859_100349992 3300005617 Bacteria 1572
70 Ga0068864_100005459 3300005618 Bacteria 10426
71 Ga0068866_10030175 3300005718 Bacteria 2600
72 Ga0068863_100165016 3300005841 Bacteria 2123
73 Ga0068860_100034099 3300005843 Bacteria 4882
74 Ga0068860_100408364 3300005843 Unclassified 1344
75 Ga0070717_10028579 3300006028 Bacteria 4465
76 Ga0097621_100045646 3300006237 Bacteria 3540
77 Ga0097621_100108538 3300006237 Bacteria 2343
78 Ga0068871_100008118 3300006358 Bacteria 7536
79 Ga0068871_100143412 3300006358 Bacteria 2032
80 Ga0075434_100708161 3300006871 Unclassified 1024
81 Ga0075429_100340464 3300006880 Bacteria 1313
82 Ga0097620_100106337 3300006931 Bacteria 2865
83 Ga0097620_100349996 3300006931 Bacteria 1572
84 Ga0099794_10031961 3300007265 Bacteria 2467
85 Ga0105251_10174572 3300009011 Bacteria 968
86 Ga0105240_10000081 3300009093 Bacteria 195355
87 Ga0105240_10066845 3300009093 Bacteria 4458
88 Ga0105240_10507664 3300009093 Bacteria 1340
89 Ga0111539_10310367 3300009094 Bacteria 1835
90 Ga0105245_10176095 3300009098 Bacteria 2040
91 Ga0105242_10141536 3300009176 Bacteria 2088
92 Ga0105242_10279401 3300009176 Bacteria 1516
93 Ga0105238_10569005 3300009551 Bacteria 1139
94 Ga0105249_10165620 3300009553 Bacteria 2139
95 Ga0105249_10823038 3300009553 Bacteria 993
96 Ga0105239_10129383 3300010375 Bacteria 2807
97 Ga0105239_10514249 3300010375 Bacteria 1362
98 Ga0157369_10002515 3300013105 Bacteria 21929
99 Ga0157369_10378707 3300013105 Unclassified 1469
100 Ga0157369_10798291 3300013105 Bacteria 970
101 Ga0157374_10010686 3300013296 Bacteria 7908
102 Ga0157378_10000079 3300013297 Bacteria 88966
103 Ga0157378_10001981 3300013297 Bacteria 18324
104 Ga0163162_10015471 3300013306 Bacteria 7456
105 Ga0163162_10046552 3300013306 Unclassified 4348
106 Ga0163163_10184257 3300014325 Bacteria 2135
107 Ga0163163_10613382 3300014325 Bacteria 1151
108 Ga0157380_10070300 3300014326 Bacteria 2828
109 Ga0157377_10165437 3300014745 Unclassified 1379
110 Ga0157379_10010166 3300014968 Bacteria 8198
111 Ga0157379_10127215 3300014968 Unclassified 2293
112 Ga0157379_10520098 3300014968 Unclassified 1105
113 Ga0157376_10004716 3300014969 Bacteria 9503
114 Ga0182007_10047365 3300015262 Bacteria 1422
115 Ga0163161_10108309 3300017792 Bacteria 2075
116 Ga0213876_10000997 3300021384 Bacteria 18470
117 Ga0209148_1002083 3300025254 Bacteria 7616
118 Ga0209455_1000225 3300025272 Bacteria 76514
119 Ga0207697_10024218 3300025315 Bacteria 2486
120 Ga0207656_10002960 3300025321 Bacteria 5799
121 Ga0207688_10016218 3300025901 Bacteria 4039
122 Ga0207680_10169576 3300025903 Bacteria 1469
123 Ga0207699_10068109 3300025906 Bacteria 2167
124 Ga0207645_10004331 3300025907 Bacteria 10511
125 Ga0207643_10023228 3300025908 Bacteria 3419
126 Ga0207705_10066571 3300025909 Unclassified 2606
127 Ga0207705_10156747 3300025909 Unclassified 1709
128 Ga0207707_10020003 3300025912 Bacteria 5841
129 Ga0207707_10263553 3300025912 Bacteria 1495
130 Ga0207695_10000569 3300025913 Bacteria 75500
131 Ga0207695_10177894 3300025913 Bacteria 2049
132 Ga0207663_10106500 3300025916 Unclassified 1895
133 Ga0207662_10039812 3300025918 Bacteria 2759
134 Ga0207649_10002056 3300025920 Bacteria 11442
135 Ga0207681_10342550 3300025923 Bacteria 1194
136 Ga0207650_10001095 3300025925 Bacteria 20014
137 Ga0207650_10070344 3300025925 Bacteria 2630
138 Ga0207659_10000875 3300025926 Bacteria 17884
139 Ga0207700_10044569 3300025928 Bacteria 3267
140 Ga0207700_10078831 3300025928 Bacteria 2564
141 Ga0207644_10000147 3300025931 Bacteria 50433
142 Ga0207644_10082118 3300025931 Bacteria 2383
143 Ga0207644_10097760 3300025931 Bacteria 2199
144 Ga0207706_10041722 3300025933 Bacteria 4067
145 Ga0207669_10014009 3300025937 Bacteria 4006
146 Ga0207669_10098494 3300025937 Bacteria 1925
147 Ga0207704_10317983 3300025938 Unclassified 1199
148 Ga0207665_10024931 3300025939 Bacteria 3944
149 Ga0207691_10000123 3300025940 Bacteria 70472
150 Ga0207691_10092434 3300025940 Bacteria 2709
151 Ga0207691_10152214 3300025940 Bacteria 2033
152 Ga0207711_10445643 3300025941 Bacteria 1205
153 Ga0207689_10027097 3300025942 Bacteria 4797
154 Ga0207661_10001400 3300025944 Bacteria 16234
155 Ga0207661_10026442 3300025944 Bacteria 4422
156 Ga0207661_10045283 3300025944 Bacteria 3482
157 Ga0207661_10417930 3300025944 Bacteria 1218
158 Ga0207679_10029941 3300025945 Bacteria 3795
159 Ga0207667_10081647 3300025949 Bacteria 3349
160 Ga0207651_10023882 3300025960 Unclassified 3770
161 Ga0207651_10113328 3300025960 Bacteria 2040
162 Ga0207651_10136153 3300025960 Bacteria 1889
163 Ga0207712_10119586 3300025961 Bacteria 1991
164 Ga0207668_10162197 3300025972 Bacteria 1743
165 Ga0207640_10025301 3300025981 Unclassified 3591
166 Ga0207640_10314384 3300025981 Bacteria 1244
167 Ga0207658_10124404 3300025986 Unclassified 2061
168 Ga0207677_10001604 3300026023 Bacteria 11997
169 Ga0207677_10179445 3300026023 Bacteria 1664
170 Ga0207678_10070988 3300026067 Bacteria 2986
171 Ga0207678_10352302 3300026067 Unclassified 1269
172 Ga0207708_10034793 3300026075 Bacteria 3833
173 Ga0207702_10000008 3300026078 Bacteria 320479
174 Ga0207702_10002674 3300026078 Bacteria 16728
175 Ga0207702_10092645 3300026078 Unclassified 2649
176 Ga0207648_10036274 3300026089 Unclassified 4343
177 Ga0207648_10089642 3300026089 Bacteria 2687
178 Ga0207676_10022578 3300026095 Bacteria 4628
179 Ga0207674_10075897 3300026116 Bacteria 3370
180 Ga0207683_10004455 3300026121 Bacteria 12093
181 Ga0207683_10139408 3300026121 Bacteria 2184
182 Ga0207698_10854613 3300026142 Bacteria 915
183 Ga0209588_1019959 3300027671 Unclassified 2096
184 Ga0268266_10105409 3300028379 Bacteria 2491
185 Ga0268264_10010280 3300028381 Bacteria 7747
186 Ga0268264_10094692 3300028381 Bacteria 2582
187 Ga0265337_1005095 3300028556 Bacteria 5292
188 Ga0265326_10067471 3300028558 Bacteria 1011
189 Ga0265334_10023311 3300028573 Unclassified 2517
190 Ga0265318_10000139 3300028577 Bacteria 66471
191 Ga0265318_10029654 3300028577 Bacteria 2133
192 Ga0265318_10057098 3300028577 Unclassified 1459
193 Ga0265323_10012045 3300028653 Unclassified 3474
194 Ga0265338_10029623 3300028800 Bacteria 5420
195 Ga0265324_10014862 3300029957 Bacteria 2869
196 Ga0265760_10010028 3300031090 Unclassified 2703
197 Ga0265330_10005827 3300031235 Bacteria 6113
198 Ga0265330_10131446 3300031235 Unclassified 1065
199 Ga0265332_10002597 3300031238 Bacteria 9134
200 Ga0265332_10085737 3300031238 Unclassified 1334
201 Ga0265328_10000542 3300031239 Bacteria 17559
202 Ga0265328_10098005 3300031239 Bacteria 1085
203 Ga0265320_10006194 3300031240 Bacteria 7568
204 Ga0265320_10021634 3300031240 Bacteria 3455
205 Ga0265325_10042107 3300031241 Unclassified 2390
206 Ga0265329_10013359 3300031242 Unclassified 2929
207 Ga0265340_10000720 3300031247 Bacteria 18773
208 Ga0265340_10027439 3300031247 Bacteria 2871
209 Ga0265339_10037303 3300031249 Unclassified 2717
210 Ga0265331_10005878 3300031250 Bacteria 7345
211 Ga0265331_10048496 3300031250 Unclassified 2041
212 Ga0265327_10000193 3300031251 Bacteria 129367
213 Ga0265316_10006614 3300031344 Bacteria 11039
214 Ga0265316_10076484 3300031344 Bacteria 2572
215 Ga0265316_10281284 3300031344 Bacteria 1215
216 Ga0265313_10035618 3300031595 Unclassified 2505
217 Ga0265314_10001875 3300031711 Bacteria 22540
218 Ga0265314_10061853 3300031711 Bacteria 2547
219 Ga0265314_10233540 3300031711 Unclassified 1065
220 Ga0265342_10005206 3300031712 Bacteria 9988
221 Ga0373934_0063142 3300035086 Unclassified 1477
222 Ga0373954_0181594 3300035118 Unclassified 1032
223 Ga0373960_0004976 3300035121 Bacteria 3063
224 Ga0373946_0110399 3300035171 Unclassified 1244
225 Ga0373935_0072396 3300035692 Bacteria 2225
226 Ga0373933_0020087 3300035724 Bacteria 3783
227 Ga0373933_0271926 3300035724 Unclassified 1094
228 Ga0373937_0011204 3300036401 Bacteria 7861
229 Ga0373937_0054199 3300036401 Bacteria 3679
230 Ga0373925_0031231 3300037068 Bacteria 3914
231 Ga0395905_0098640 3300037471 Bacteria 2744
232 Ga0436365_1168772 3300039437 Bacteria 186262
233 Ga0451804_0229048 3300041463 Unclassified 860
234 Ga0451851_0829408 3300041507 Unclassified 1130
235 Ga0453684_0104751 3300044712 Bacteria 3452
236 Ga0495641_0190209 3300046461 Bacteria 920
237 Ga0495651_0011544 3300046462 Bacteria 6785
238 Ga0495651_0302239 3300046462 Unclassified 1073
239 Ga0495664_0005688 3300046477 Bacteria 6858
240 Ga0495594_0170317 3300046499 Unclassified 1239
241 Ga0495618_0308171 3300046514 Unclassified 983
242 Ga0495618_0328618 3300046514 Unclassified 946
243 Ga0495628_0013510 3300046516 Bacteria 6869
244 Ga0495628_0030352 3300046516 Bacteria 4377
245 Ga0495640_0032715 3300046533 Unclassified 3701
246 Ga0495587_0037028 3300046536 Bacteria 2932
247 Ga0495645_0000240 3300046543 Bacteria 40002
248 Ga0495667_0045255 3300046559 Bacteria 2914
249 Ga0495635_0012185 3300046663 Bacteria 6029
250 Ga0495635_0020117 3300046663 Unclassified 4652
251 Ga0495657_0020153 3300046675 Bacteria 4798
252 Ga0495599_0326861 3300046678 Unclassified 922
253 Ga0495623_0045200 3300046679 Unclassified 2798
254 Ga0495604_0066226 3300047317 Bacteria 2748
255 Ga0495674_0004314 3300047319 Bacteria 13679
256 Ga0495674_0163824 3300047319 Unclassified 1859
257 Ga0495680_0008707 3300047322 Bacteria 9200
258 Ga0495675_0005833 3300047444 Bacteria 7524
259 Ga0495675_0078644 3300047444 Unclassified 2077
260 Ga0495684_0005589 3300047471 Bacteria 9792
261 Ga0495686_0002119 3300047472 Bacteria 19437
262 Ga0495602_0004223 3300048088 Bacteria 14946
263 Ga0496102_0006886 3300048905 Bacteria 9702
264 Ga0496105_0318897 3300048908 Bacteria 1246
265 Ga0496105_0570344 3300048908 Unclassified 881
266 Ga0496108_0182213 3300048911 Unclassified 1819
267 Ga0496109_0086807 3300048912 Bacteria 2890
268 Ga0496110_0019123 3300048913 Bacteria 5757
269 Ga0496110_0320148 3300048913 Bacteria 1413
270 Ga0496112_0200125 3300048915 Bacteria 1957
271 Ga0496114_0000673 3300048917 Bacteria 25319
272 Ga0496114_0156212 3300048917 Bacteria 1981
273 Ga0496115_0053668 3300048918 Bacteria 3235
274 nmdc:mga08y16_642704_c1 3300050511 Bacteria 1066
275 nmdc:mga0n895_283960_c1 3300050512 Bacteria 1678
276 Ga0495601_0010166 3300053077 Bacteria 5592
277 Ga0495601_0417709 3300053077 Bacteria 869
278 Ga0495601_0535446 3300053077 Bacteria 754
279 Ga0495612_0002277 3300053078 Bacteria 7899
280 Ga0495619_0080351 3300053085 Bacteria 2194
281 Ga0068851_10006274
282 Ga0065715_10283819
283 Ga0070658_10015941
284 Ga0070676_10023200
285 Ga0070683_100057580
286 Ga0070683_100716917
287 Ga0070690_100046020
288 Ga0070670_100010466
289 Ga0070677_10014444
290 Ga0068869_100362136
291 Ga0068868_100000464
292 Ga0068868_100049099
293 Ga0070661_100001620
294 Ga0070692_10062291
295 Ga0070668_100164875
296 Ga0070668_100226959
297 Ga0070669_100184358
298 Ga0070675_100000914
299 Ga0070675_100149079
300 Ga0070671_100001694
301 Ga0070671_100169268
302 Ga0070674_100034990
303 Ga0070674_100072530
304 Ga0070673_100019865
305 Ga0070673_100111292
306 Ga0070659_100588429
307 Ga0070667_100133050
308 Ga0070709_10064810
309 Ga0070714_100193741
310 Ga0070714_100346287
311 Ga0070713_100052573
312 Ga0070713_100195580
313 Ga0070705_100411495
314 Ga0070705_100625133
315 Ga0070708_100059549
316 Ga0070663_100170441
317 Ga0070663_100265054
318 Ga0070678_100002846
319 Ga0070662_100250035
320 Ga0070681_10003873
321 Ga0070681_10074800
322 Ga0070681_10207950
323 Ga0068867_100024594
324 Ga0068867_100050663
325 Ga0070706_100159758
326 Ga0070698_100133561
327 Ga0070684_100008560
328 Ga0070684_100036391
329 Ga0070697_100054180
330 Ga0070672_100004031
331 Ga0070672_100520505
332 Ga0070686_100023874
333 Ga0070665_100080072
334 Ga0070665_100490228
335 Ga0070704_100133754
336 Ga0068855_100067972
337 Ga0068855_100866605
338 Ga0070664_100002897
339 Ga0070664_100124740
340 Ga0068857_100077619
341 Ga0068854_100033590
342 Ga0068856_100000003
343 Ga0068856_100000380
344 Ga0068856_100048312
345 Ga0068856_100625997
346 Ga0070702_100025222
347 Ga0068852_100020825
348 Ga0068859_100106341
349 Ga0068859_100349992
350 Ga0068864_100005459
351 Ga0068866_10030175
352 Ga0068863_100165016
353 Ga0068860_100034099
354 Ga0068860_100408364
355 Ga0070717_10028579
356 Ga0097621_100045646
357 Ga0097621_100108538
358 Ga0068871_100008118
359 Ga0068871_100143412
360 Ga0075434_100708161
361 Ga0075429_100340464
362 Ga0097620_100106337
363 Ga0097620_100349996
364 Ga0099794_10031961
365 Ga0105251_10174572
366 Ga0105240_10000081
367 Ga0105240_10066845
368 Ga0105240_10507664
369 Ga0111539_10310367
370 Ga0105245_10176095
371 Ga0105242_10141536
372 Ga0105242_10279401
373 Ga0105238_10569005
374 Ga0105249_10165620
375 Ga0105249_10823038
376 Ga0105239_10129383
377 Ga0105239_10514249
378 Ga0157369_10002515
379 Ga0157369_10378707
380 Ga0157369_10798291
381 Ga0157374_10010686
382 Ga0157378_10000079
383 Ga0157378_10001981
384 Ga0163162_10015471
385 Ga0163162_10046552
386 Ga0163163_10184257
387 Ga0163163_10613382
388 Ga0157380_10070300
389 Ga0157377_10165437
390 Ga0157379_10010166
391 Ga0157379_10127215
392 Ga0157379_10520098
393 Ga0157376_10004716
394 Ga0182007_10047365
395 Ga0163161_10108309
396 Ga0213876_10000997
397 Ga0209148_1002083
398 Ga0209455_1000225
399 Ga0207697_10024218
400 Ga0207656_10002960
401 Ga0207688_10016218
402 Ga0207680_10169576
403 Ga0207699_10068109
404 Ga0207645_10004331
405 Ga0207643_10023228
406 Ga0207705_10066571
407 Ga0207705_10156747
408 Ga0207707_10020003
409 Ga0207707_10263553
410 Ga0207695_10000569
411 Ga0207695_10177894
412 Ga0207663_10106500
413 Ga0207662_10039812
414 Ga0207649_10002056
415 Ga0207681_10342550
416 Ga0207650_10001095
417 Ga0207650_10070344
418 Ga0207659_10000875
419 Ga0207700_10044569
420 Ga0207700_10078831
421 Ga0207644_10000147
422 Ga0207644_10082118
423 Ga0207644_10097760
424 Ga0207706_10041722
425 Ga0207669_10014009
426 Ga0207669_10098494
427 Ga0207704_10317983
428 Ga0207665_10024931
429 Ga0207691_10000123
430 Ga0207691_10092434
431 Ga0207691_10152214
432 Ga0207711_10445643
433 Ga0207689_10027097
434 Ga0207661_10001400
435 Ga0207661_10026442
436 Ga0207661_10045283
437 Ga0207661_10417930
438 Ga0207679_10029941
439 Ga0207667_10081647
440 Ga0207651_10023882
441 Ga0207651_10113328
442 Ga0207651_10136153
443 Ga0207712_10119586
444 Ga0207668_10162197
445 Ga0207640_10025301
446 Ga0207640_10314384
447 Ga0207658_10124404
448 Ga0207677_10001604
449 Ga0207677_10179445
450 Ga0207678_10070988
451 Ga0207678_10352302
452 Ga0207708_10034793
453 Ga0207702_10000008
454 Ga0207702_10002674
455 Ga0207702_10092645
456 Ga0207648_10036274
457 Ga0207648_10089642
458 Ga0207676_10022578
459 Ga0207674_10075897
460 Ga0207683_10004455
461 Ga0207683_10139408
462 Ga0207698_10854613
463 Ga0209588_1019959
464 Ga0268266_10105409
465 Ga0268264_10010280
466 Ga0268264_10094692
467 Ga0265337_1005095
468 Ga0265326_10067471
469 Ga0265334_10023311
470 Ga0265318_10000139
471 Ga0265318_10029654
472 Ga0265318_10057098
473 Ga0265323_10012045
474 Ga0265338_10029623
475 Ga0265324_10014862
476 Ga0265760_10010028
477 Ga0265330_10005827
478 Ga0265330_10131446
479 Ga0265332_10002597
480 Ga0265332_10085737
481 Ga0265328_10000542
482 Ga0265328_10098005
483 Ga0265320_10006194
484 Ga0265320_10021634
485 Ga0265325_10042107
486 Ga0265329_10013359
487 Ga0265340_10000720
488 Ga0265340_10027439
489 Ga0265339_10037303
490 Ga0265331_10005878
491 Ga0265331_10048496
492 Ga0265327_10000193
493 Ga0265316_10006614
494 Ga0265316_10076484
495 Ga0265316_10281284
496 Ga0265313_10035618
497 Ga0265314_10001875
498 Ga0265314_10061853
499 Ga0265314_10233540
500 Ga0265342_10005206
501 Ga0373934_0063142
502 Ga0373954_0181594
503 Ga0373960_0004976
504 Ga0373946_0110399
505 Ga0373935_0072396
506 Ga0373933_0020087
507 Ga0373933_0271926
508 Ga0373937_0011204
509 Ga0373937_0054199
510 Ga0373925_0031231
511 Ga0395905_0098640
512 Ga0436365_1168772
513 Ga0451804_0229048
514 Ga0451851_0829408
515 Ga0453684_0104751
516 Ga0495641_0190209
517 Ga0495651_0011544
518 Ga0495651_0302239
519 Ga0495664_0005688
520 Ga0495594_0170317
521 Ga0495618_0308171
522 Ga0495618_0328618
523 Ga0495628_0013510
524 Ga0495628_0030352
525 Ga0495640_0032715
526 Ga0495587_0037028
527 Ga0495645_0000240
528 Ga0495667_0045255
529 Ga0495635_0012185
530 Ga0495635_0020117
531 Ga0495657_0020153
532 Ga0495599_0326861
533 Ga0495623_0045200
534 Ga0495604_0066226
535 Ga0495674_0004314
536 Ga0495674_0163824
537 Ga0495680_0008707
538 Ga0495675_0005833
539 Ga0495675_0078644
540 Ga0495684_0005589
541 Ga0495686_0002119
542 Ga0495602_0004223
543 Ga0496102_0006886
544 Ga0496105_0318897
545 Ga0496105_0570344
546 Ga0496108_0182213
547 Ga0496109_0086807
548 Ga0496110_0019123
549 Ga0496110_0320148
550 Ga0496112_0200125
551 Ga0496114_0000673
552 Ga0496114_0156212
553 Ga0496115_0053668
554 nmdc:mga08y16_642704_c1
555 nmdc:mga0n895_283960_c1
556 Ga0495601_0010166
557 Ga0495601_0417709
558 Ga0495601_0535446
559 Ga0495612_0002277
560 Ga0495619_0080351

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13529

Peptidase_C39_2

Peptidase_C39 like family

124

262

0.8

PF00112

Peptidase_C1

Papain family cysteine protease

72

290

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
1k3b-assembly1.cif.gz_C crystal structure of human dipeptidyl peptidase i (cathepsin c): exclusion domain added to an endopeptidase framework creates the machine for activation of granular serine proteases 0.9389 233 253
3ois-assembly1.cif.gz_A crystal structure xylellain, a cysteine protease from xylella fastidiosa 0.9209 13 273
6rn6-assembly1.cif.gz_F dpp1 in complex with inhibitor 0.9168 233 253
3ois-assembly1.cif.gz_A crystal structure xylellain, a cysteine protease from xylella fastidiosa 0.8944 13 273
3f5v-assembly2.cif.gz_B c2 crystal form of mite allergen der p 1 0.8055 30 271
ID Description Score Start End Superfamily
4oelB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Cysteine proteinases. Chain C 0.9321 233 253 2.40.50.170
3oisC00 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.9205 14 273 3.90.70.10
3oisC00 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.8937 14 273 3.90.70.10
af_A0A0R0KWV5_150_228_2.40.50.170 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Cysteine proteinases. Chain C 0.869 233 252 2.40.50.170
af_A0A1D6ER43_33_300_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.8023 33 263 3.90.70.10
ID Description Score Start End GO Terms
AF-A0A3B8XGG8-F1-model_v4 Peptidase 0.9926 161 273 GO:0006508
GO:0008234
AF-A0A812U2C5-F1-model_v4 Peptidase C1A papain C-terminal domain-containing protein 0.9923 165 271 GO:0006508
GO:0008234
AF-A0A538AF61-F1-model_v4 Peptidase 0.9887 31 273 GO:0006508
GO:0008234
AF-A0A3B9MAM4-F1-model_v4 Peptidase 0.9867 91 272 GO:0006508
GO:0008234
AF-A0A812SZ12-F1-model_v4 deleted 0.9803 84 270

Map