F383417

General Info

Members Datasets Scaffolds Average Seq Length
280 146 275 116

Family's Representative Sequence

Representative Sequence 3300001990|JGI24737J22298_10041108|JGI24737J22298_100411082
Length 115
Sequence MKVRIKGNSLRYRLSMTDVARFARDGYAEEVIDFGKTQLTYALQRGPTLSLEAEFMNNKIIVFMPYSWADEWVETDRVGFEQKGPLYLLVEKDFQCIDNVAEDQTDNYPNPSLIC

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
3 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
4 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
5 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
6 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
12 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
69 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
72 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
106 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
117 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
118 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
119 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
120 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
121 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
122 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
123 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
124 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
125 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
126 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
127 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
128 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
129 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
130 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
133 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
134 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
135 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
136 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
137 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
138 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
139 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
140 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
141 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
142 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
143 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
144 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
145 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
146 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.21
Metatranscriptomes 0
Isolates 1.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.64
Nodule 0
Rhizoplane 0.36
Rhizosphere 85
Stem 0
Stem Tuber 0
Unclassified 5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1007496 3300001904 Bacteria 1833
2 JGI24739J22299_10004769 3300001989 Bacteria 5177
3 JGI24739J22299_10014232 3300001989 Bacteria 2895
4 JGI24739J22299_10040978 3300001989 Bacteria 1543
5 JGI24737J22298_10001645 3300001990 Bacteria 7971
6 JGI24737J22298_10041108 3300001990 Bacteria 1418
7 JGI24737J22298_10217767 3300001990 Unclassified 563
8 JGI24735J21928_10000014 3300002067 Bacteria 186670
9 JGI24735J21928_10155306 3300002067 Bacteria 661
10 JGI24735J21928_10179068 3300002067 Bacteria 614
11 JGI24735J21928_10198589 3300002067 Unclassified 581
12 JGI24744J21845_10004630 3300002077 Bacteria 2845
13 JGI25162J39368_1001672 3300002737 Bacteria 10898
14 JGI25164J39214_1001330 3300002772 Bacteria 6126
15 JGI25165J46597_1000436 3300003214 Bacteria 42359
16 rootH2_10001535 3300003320 Bacteria 91957
17 rootH2_10100608 3300003320 Bacteria 8405
18 rootH2_10155889 3300003320 Bacteria 3032
19 rootH2_10197472 3300003320 Bacteria 1190
20 rootH1_10024899 3300003323 Bacteria 34477
21 rootH1_10170445 3300003323 Bacteria 2981
22 rootH1_10183887 3300003323 Bacteria 2642
23 Ga0065714_10007166 3300005288 Bacteria 2954
24 Ga0065714_10091923 3300005288 Bacteria 1894
25 Ga0065714_10125995 3300005288 Bacteria 1237
26 Ga0070658_10134249 3300005327 Bacteria 2064
27 Ga0070658_10371914 3300005327 Bacteria 1225
28 Ga0070658_10829791 3300005327 Bacteria 803
29 Ga0070676_10000879 3300005328 Bacteria 14827
30 Ga0068868_100004532 3300005338 Bacteria 9750
31 Ga0070660_100073201 3300005339 Bacteria 2679
32 Ga0070691_10117583 3300005341 Unclassified 1335
33 Ga0070671_100011480 3300005355 Bacteria 7121
34 Ga0070673_100012628 3300005364 Bacteria 5806
35 Ga0070659_100001078 3300005366 Bacteria 19930
36 Ga0070659_100004671 3300005366 Bacteria 9777
37 Ga0070659_101251704 3300005366 Bacteria 657
38 Ga0070711_100343580 3300005439 Unclassified 1198
39 Ga0070663_100064906 3300005455 Bacteria 2640
40 Ga0070678_100031536 3300005456 Bacteria 3658
41 Ga0070662_100003184 3300005457 Bacteria 10200
42 Ga0068867_100001558 3300005459 Bacteria 15909
43 Ga0070679_100419919 3300005530 Bacteria 1283
44 Ga0068853_100049743 3300005539 Bacteria 3603
45 Ga0068853_100151313 3300005539 Bacteria 2089
46 Ga0070665_100000178 3300005548 Bacteria 113002
47 Ga0068855_100000141 3300005563 Bacteria 92463
48 Ga0068855_100022917 3300005563 Bacteria 7483
49 Ga0068855_100553181 3300005563 Bacteria 1245
50 Ga0068855_100613124 3300005563 Bacteria 1172
51 Ga0068855_100794552 3300005563 Bacteria 1006
52 Ga0068857_100203926 3300005577 Bacteria 1803
53 Ga0068854_100749669 3300005578 Bacteria 847
54 Ga0068856_100002785 3300005614 Bacteria 17904
55 Ga0068856_100110349 3300005614 Bacteria 2748
56 Ga0068856_100310570 3300005614 Bacteria 1594
57 Ga0068856_100481743 3300005614 Bacteria 1262
58 Ga0068856_101036546 3300005614 Bacteria 838
59 Ga0068856_101434988 3300005614 Bacteria 704
60 Ga0068852_100000571 3300005616 Bacteria 24216
61 Ga0068852_100077341 3300005616 Bacteria 2941
62 Ga0068852_102765216 3300005616 Unclassified 509
63 Ga0068864_101410281 3300005618 Bacteria 698
64 Ga0068866_10099817 3300005718 Bacteria 1599
65 Ga0068851_10904037 3300005834 Unclassified 553
66 Ga0068870_10250041 3300005840 Bacteria 1098
67 Ga0068858_100072498 3300005842 Bacteria 3195
68 Ga0075366_10000201 3300006195 Bacteria 26314
69 Ga0075366_10003586 3300006195 Bacteria 8217
70 Ga0097621_100000344 3300006237 Bacteria 31894
71 Ga0068871_100000758 3300006358 Bacteria 21810
72 Ga0068865_100000373 3300006881 Bacteria 24834
73 Ga0105240_10001569 3300009093 Bacteria 38745
74 Ga0105240_10010365 3300009093 Bacteria 13112
75 Ga0105240_10029162 3300009093 Bacteria 7196
76 Ga0105240_10183939 3300009093 Bacteria 2463
77 Ga0105240_10294634 3300009093 Unclassified 1858
78 Ga0105240_10319596 3300009093 Unclassified 1770
79 Ga0105240_10352355 3300009093 Bacteria 1670
80 Ga0105240_10810596 3300009093 Bacteria 1013
81 Ga0105240_11117735 3300009093 Bacteria 838
82 Ga0105241_10012854 3300009174 Bacteria 6143
83 Ga0105241_10030428 3300009174 Bacteria 4035
84 Ga0105241_10101824 3300009174 Bacteria 2284
85 Ga0105241_10102971 3300009174 Bacteria 2273
86 Ga0105241_10686397 3300009174 Unclassified 933
87 Ga0105241_11857441 3300009174 Bacteria 589
88 Ga0105242_10020623 3300009176 Bacteria 5170
89 Ga0105237_10000168 3300009545 Bacteria 92212
90 Ga0105237_10000811 3300009545 Bacteria 42732
91 Ga0105237_10009972 3300009545 Bacteria 10135
92 Ga0105237_10045495 3300009545 Bacteria 4416
93 Ga0105238_10162040 3300009551 Bacteria 2212
94 Ga0105249_10223417 3300009553 Bacteria 1854
95 Ga0105239_10000137 3300010375 Bacteria 102833
96 Ga0105239_10013805 3300010375 Bacteria 8965
97 Ga0105239_10027198 3300010375 Bacteria 6296
98 Ga0105239_10071253 3300010375 Bacteria 3819
99 Ga0105239_10409326 3300010375 Bacteria 1536
100 Ga0105239_10476989 3300010375 Bacteria 1417
101 Ga0105246_10809660 3300011119 Bacteria 832
102 Ga0157373_10000906 3300013100 Bacteria 22984
103 Ga0157373_10002692 3300013100 Bacteria 13467
104 Ga0157373_10006683 3300013100 Bacteria 8589
105 Ga0157371_10002379 3300013102 Bacteria 17992
106 Ga0157371_10025137 3300013102 Bacteria 4344
107 Ga0157370_10122083 3300013104 Bacteria 2433
108 Ga0157370_10823207 3300013104 Bacteria 844
109 Ga0157370_11139412 3300013104 Bacteria 704
110 Ga0157369_10162391 3300013105 Unclassified 2358
111 Ga0157369_10190334 3300013105 Bacteria 2156
112 Ga0157369_10827842 3300013105 Bacteria 950
113 Ga0157374_10000445 3300013296 Bacteria 37588
114 Ga0157374_10010164 3300013296 Bacteria 8087
115 Ga0157374_10320587 3300013296 Bacteria 1536
116 Ga0157378_10046287 3300013297 Bacteria 3867
117 Ga0157378_10183611 3300013297 Bacteria 1969
118 Ga0157378_10603570 3300013297 Bacteria 1109
119 Ga0163162_10000008 3300013306 Bacteria 316194
120 Ga0163162_10038578 3300013306 Bacteria 4767
121 Ga0163162_10044363 3300013306 Bacteria 4453
122 Ga0163162_10130102 3300013306 Bacteria 2625
123 Ga0163162_10495534 3300013306 Bacteria 1352
124 Ga0157372_10000296 3300013307 Bacteria 55447
125 Ga0157372_10001857 3300013307 Bacteria 22903
126 Ga0157372_10005806 3300013307 Bacteria 13148
127 Ga0157372_10050237 3300013307 Bacteria 4639
128 Ga0157372_10346125 3300013307 Bacteria 1732
129 Ga0157375_10000834 3300013308 Bacteria 26970
130 Ga0157375_10003328 3300013308 Bacteria 13921
131 Ga0157375_10390200 3300013308 Bacteria 1559
132 Ga0157375_10612613 3300013308 Bacteria 1247
133 Ga0157377_10012405 3300014745 Bacteria 4284
134 Ga0157376_10006193 3300014969 Bacteria 8430
135 Ga0209563_109553 3300025230 Bacteria 1460
136 Ga0207427_100163 3300025231 Bacteria 74501
137 Ga0209437_100041 3300025233 Bacteria 444465
138 Ga0209437_100101 3300025233 Bacteria 226668
139 Ga0209258_115622 3300025242 Bacteria 862
140 Ga0209148_1019414 3300025254 Bacteria 1128
141 Ga0209129_1025236 3300025258 Bacteria 1038
142 Ga0209233_1000124 3300025261 Bacteria 226743
143 Ga0209233_1000783 3300025261 Bacteria 14334
144 Ga0207656_10722416 3300025321 Unclassified 510
145 Ga0207642_10077083 3300025899 Bacteria 1607
146 Ga0207642_10348324 3300025899 Unclassified 873
147 Ga0207647_10000043 3300025904 Bacteria 91109
148 Ga0207647_10502723 3300025904 Bacteria 676
149 Ga0207647_10515433 3300025904 Bacteria 666
150 Ga0207645_10000185 3300025907 Bacteria 49988
151 Ga0207705_10638228 3300025909 Bacteria 828
152 Ga0207654_10079604 3300025911 Bacteria 1968
153 Ga0207654_10178422 3300025911 Bacteria 1384
154 Ga0207654_10884354 3300025911 Unclassified 647
155 Ga0207695_10006499 3300025913 Bacteria 15141
156 Ga0207695_10011817 3300025913 Bacteria 10535
157 Ga0207695_10052382 3300025913 Bacteria 4277
158 Ga0207695_10810353 3300025913 Unclassified 816
159 Ga0207671_10000724 3300025914 Bacteria 42108
160 Ga0207671_10017322 3300025914 Bacteria 5559
161 Ga0207671_10324239 3300025914 Bacteria 1219
162 Ga0207671_10519182 3300025914 Unclassified 950
163 Ga0207663_10270244 3300025916 Unclassified 1259
164 Ga0207657_10104256 3300025919 Bacteria 2349
165 Ga0207694_10496212 3300025924 Bacteria 1022
166 Ga0207644_10014405 3300025931 Bacteria 5290
167 Ga0207690_10003549 3300025932 Bacteria 9291
168 Ga0207690_10053951 3300025932 Unclassified 2700
169 Ga0207706_10000246 3300025933 Bacteria 59254
170 Ga0207686_10021420 3300025934 Bacteria 3710
171 Ga0207709_11161817 3300025935 Unclassified 635
172 Ga0207669_10501106 3300025937 Bacteria 971
173 Ga0207704_10000055 3300025938 Bacteria 78858
174 Ga0207661_10055966 3300025944 Bacteria 3165
175 Ga0207667_10000030 3300025949 Bacteria 327226
176 Ga0207667_10003094 3300025949 Bacteria 20590
177 Ga0207667_10478675 3300025949 Bacteria 1264
178 Ga0207667_10539303 3300025949 Bacteria 1181
179 Ga0207667_10671060 3300025949 Bacteria 1041
180 Ga0207651_10006512 3300025960 Bacteria 6126
181 Ga0207677_10015980 3300026023 Bacteria 4432
182 Ga0207677_12021656 3300026023 Unclassified 536
183 Ga0207703_10159219 3300026035 Bacteria 1976
184 Ga0207639_10009944 3300026041 Bacteria 6573
185 Ga0207639_10044062 3300026041 Bacteria 3354
186 Ga0207639_10219245 3300026041 Bacteria 1642
187 Ga0207639_10919778 3300026041 Unclassified 818
188 Ga0207639_10930750 3300026041 Bacteria 813
189 Ga0207702_10002387 3300026078 Bacteria 17897
190 Ga0207702_10269031 3300026078 Bacteria 1607
191 Ga0207702_10324670 3300026078 Bacteria 1467
192 Ga0207702_10379513 3300026078 Bacteria 1359
193 Ga0207648_10000775 3300026089 Bacteria 36025
194 Ga0207674_10305997 3300026116 Bacteria 1539
195 Ga0207683_10063492 3300026121 Bacteria 3253
196 Ga0207698_10038696 3300026142 Bacteria 3526
197 Ga0207698_10226395 3300026142 Bacteria 1694
198 Ga0207698_10729012 3300026142 Bacteria 988
199 Ga0207698_11600063 3300026142 Bacteria 667
200 Ga0268266_10000098 3300028379 Bacteria 182784
201 Ga0307517_10070832 3300028786 Bacteria 3134
202 Ga0307515_10000224 3300028794 Bacteria 140276
203 Ga0307515_10000430 3300028794 Bacteria 101168
204 Ga0307507_10000225 3300033179 Bacteria 107651
205 Ga0307510_10000744 3300033180 Bacteria 33468
206 Ga0395899_0000017 3300037312 Bacteria 440179
207 Ga0395899_0000199 3300037312 Bacteria 87960
208 Ga0395899_0020548 3300037312 Bacteria 5005
209 Ga0395900_0000157 3300037418 Bacteria 112131
210 Ga0395900_0084940 3300037418 Bacteria 3253
211 Ga0395900_0500723 3300037418 Unclassified 1165
212 Ga0395898_0004296 3300037466 Bacteria 15617
213 Ga0395898_1585315 3300037466 Bacteria 579
214 Ga0395905_0000195 3300037471 Bacteria 95130
215 Ga0395905_0004747 3300037471 Bacteria 14042
216 Ga0395901_0000283 3300038443 Bacteria 62908
217 Ga0395901_0008324 3300038443 Bacteria 10481
218 Ga0395901_0077386 3300038443 Bacteria 3472
219 Ga0439448_0079606 3300042005 Unclassified 1099
220 Ga0466966_0198148 3300044684 Bacteria 1215
221 Ga0466966_0872109 3300044684 Unclassified 543
222 Ga0466959_0606621 3300045049 Unclassified 736
223 Ga0495629_0051988 3300046459 Bacteria 2867
224 Ga0495650_0000003 3300046471 Bacteria 900730
225 Ga0495650_0032817 3300046471 Bacteria 2318
226 Ga0495650_0330727 3300046471 Bacteria 506
227 Ga0495639_0231115 3300046475 Bacteria 911
228 Ga0495585_0000362 3300046492 Bacteria 44090
229 Ga0495585_0000677 3300046492 Bacteria 31155
230 Ga0495585_0001602 3300046492 Bacteria 17485
231 Ga0495606_0000002 3300046507 Bacteria 554637
232 Ga0495606_0001945 3300046507 Bacteria 25548
233 Ga0495606_0386996 3300046507 Unclassified 732
234 Ga0495610_0005598 3300046512 Bacteria 8868
235 Ga0495610_0150356 3300046512 Bacteria 994
236 Ga0495616_0012790 3300046513 Bacteria 4750
237 Ga0495632_0105096 3300046519 Bacteria 1329
238 Ga0495644_0036614 3300046523 Bacteria 1851
239 Ga0495648_0013371 3300046524 Bacteria 6074
240 Ga0495648_0022465 3300046524 Bacteria 4342
241 Ga0495648_0222587 3300046524 Bacteria 929
242 Ga0495652_0201739 3300046529 Bacteria 1509
243 Ga0495654_0012718 3300046530 Bacteria 4518
244 Ga0495609_0002670 3300046538 Bacteria 10800
245 Ga0495622_0127131 3300046557 Bacteria 1162
246 Ga0495633_0008502 3300046558 Bacteria 5771
247 Ga0495668_0000050 3300046616 Bacteria 214716
248 Ga0495668_0196017 3300046616 Bacteria 1106
249 Ga0495668_0366387 3300046616 Unclassified 791
250 Ga0495625_0000005 3300046660 Bacteria 596135
251 Ga0495625_0000305 3300046660 Bacteria 75021
252 Ga0495625_0009184 3300046660 Bacteria 8306
253 Ga0495625_0173812 3300046660 Bacteria 1436
254 Ga0495661_0002222 3300046665 Bacteria 15090
255 Ga0495661_0004181 3300046665 Bacteria 10495
256 Ga0495658_0543193 3300046683 Bacteria 744
257 Ga0495669_0080775 3300046684 Bacteria 1492
258 Ga0495649_0000003 3300046694 Bacteria 880817
259 Ga0495660_0107339 3300046810 Bacteria 1429
260 Ga0495687_000345 3300047443 Bacteria 59578
261 Ga0495677_0296779 3300047445 Unclassified 635
262 Ga0495686_0074849 3300047472 Bacteria 2077
263 nmdc:mga0k408_1211_c1 3300050493 Bacteria 14116
264 nmdc:mga0k408_123_c1 3300050493 Bacteria 38185
265 nmdc:mga0k408_161607_c1 3300050493 Bacteria 1335
266 nmdc:mga0k408_2071_c1 3300050493 Bacteria 10733
267 nmdc:mga0k408_409349_c1 3300050493 Bacteria 807
268 Ga0500635_0046699 3300053080 Bacteria 1469
269 Ga0500647_0135115 3300053091 Bacteria 1161
270 Ga0500608_009995 3300053122 Bacteria 4057
271 Ga0500608_017878 3300053122 Bacteria 3227
272 Ga0500618_000015 3300053125 Bacteria 175864
273 Ga0500618_005603 3300053125 Bacteria 3792
274 Ga0500622_0000909 3300053156 Bacteria 25177
275 Ga0500624_002428 3300053157 Bacteria 2525

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10001569 Ga0105240_1000156914 100
2 3300009093 Ga0105240_10010365 Ga0105240_100103653 100
3 3300013296 Ga0157374_10010164 Ga0157374_100101648 100
4 3300013306 Ga0163162_10000008 Ga0163162_10000008238 100
5 3300013307 Ga0157372_10005806 Ga0157372_100058065 100
6 3300014745 Ga0157377_10012405 Ga0157377_100124053 100
7 3300037312 Ga0395899_0000199 Ga0395899_0000199_54709_55011 100
8 3300037312 Ga0395899_0020548 Ga0395899_0020548_1687_1989 100
9 3300037418 Ga0395900_0000157 Ga0395900_0000157_55360_55662 100
10 3300037418 Ga0395900_0084940 Ga0395900_0084940_2807_3109 100
11 3300037466 Ga0395898_0004296 Ga0395898_0004296_5050_5352 100
12 3300037466 Ga0395898_1585315 Ga0395898_1585315_198_500 100
13 3300037471 Ga0395905_0000195 Ga0395905_0000195_56452_56754 100
14 3300037471 Ga0395905_0004747 Ga0395905_0004747_6889_7191 100
15 3300038443 Ga0395901_0000283 Ga0395901_0000283_6140_6442 100
16 3300038443 Ga0395901_0008324 Ga0395901_0008324_4091_4393 100
17 3300044684 Ga0466966_0872109 Ga0466966_0872109_108_410 100
18 3300045049 Ga0466959_0606621 Ga0466959_0606621_400_702 100
19 3300047472 Ga0495686_0074849 Ga0495686_0074849_1594_1896 100
20 iso_pu_bacteria 2599185184 2599477803 112
21 iso_pu_bacteria 2919437846 2919442857 112
22 iso_pu_bacteria 2928078545 2928079720 112
23 iso_pu_bacteria 2928147474 2928147804 112
24 iso_pu_bacteria 2932082852 2932086654 112
25 3300001990 JGI24737J22298_10041108 JGI24737J22298_100411082 115
26 3300003320 rootH2_10001535 rootH2_100015359 115
27 3300003320 rootH2_10197472 rootH2_101974722 115
28 3300003323 rootH1_10170445 rootH1_101704453 115
29 3300005366 Ga0070659_101251704 Ga0070659_1012517042 115
30 3300005439 Ga0070711_100343580 Ga0070711_1003435801 115
31 3300005457 Ga0070662_100003184 Ga0070662_10000318410 115
32 3300005548 Ga0070665_100000178 Ga0070665_10000017872 115
33 3300005563 Ga0068855_100022917 Ga0068855_1000229173 115
34 3300005614 Ga0068856_100481743 Ga0068856_1004817432 115
35 3300005840 Ga0068870_10250041 Ga0068870_102500412 115
36 3300009174 Ga0105241_10012854 Ga0105241_100128544 115
37 3300009174 Ga0105241_10686397 Ga0105241_106863972 115
38 3300009545 Ga0105237_10009972 Ga0105237_100099724 115
39 3300009551 Ga0105238_10162040 Ga0105238_101620402 115
40 3300010375 Ga0105239_10000137 Ga0105239_1000013721 115
41 3300010375 Ga0105239_10476989 Ga0105239_104769893 115
42 3300011119 Ga0105246_10809660 Ga0105246_108096602 115
43 3300013100 Ga0157373_10006683 Ga0157373_100066833 115
44 3300025904 Ga0207647_10502723 Ga0207647_105027232 115
45 3300025911 Ga0207654_10178422 Ga0207654_101784222 115
46 3300025911 Ga0207654_10884354 Ga0207654_108843542 115
47 3300025913 Ga0207695_10006499 Ga0207695_1000649911 115
48 3300025913 Ga0207695_10011817 Ga0207695_100118177 115
49 3300025914 Ga0207671_10017322 Ga0207671_100173224 115
50 3300025916 Ga0207663_10270244 Ga0207663_102702442 115
51 3300025924 Ga0207694_10496212 Ga0207694_104962122 115
52 3300025933 Ga0207706_10000246 Ga0207706_1000024637 115
53 3300025949 Ga0207667_10003094 Ga0207667_100030947 115
54 3300026041 Ga0207639_10009944 Ga0207639_100099445 115
55 3300026078 Ga0207702_10379513 Ga0207702_103795132 115
56 3300028379 Ga0268266_10000098 Ga0268266_10000098116 115
57 3300046492 Ga0495585_0000362 Ga0495585_0000362_9921_10268 115
58 3300053125 Ga0500618_000015 Ga0500618_000015_125455_125802 115
59 3300001904 JGI24736J21556_1007496 JGI24736J21556_10074962 116
60 3300001989 JGI24739J22299_10004769 JGI24739J22299_100047692 116
61 3300001989 JGI24739J22299_10014232 JGI24739J22299_100142323 116
62 3300001989 JGI24739J22299_10040978 JGI24739J22299_100409782 116
63 3300001990 JGI24737J22298_10001645 JGI24737J22298_100016457 116
64 3300001990 JGI24737J22298_10217767 JGI24737J22298_102177672 116
65 3300002067 JGI24735J21928_10000014 JGI24735J21928_10000014158 116
66 3300002067 JGI24735J21928_10155306 JGI24735J21928_101553062 116
67 3300002067 JGI24735J21928_10179068 JGI24735J21928_101790682 116
68 3300002067 JGI24735J21928_10198589 JGI24735J21928_101985892 116
69 3300002077 JGI24744J21845_10004630 JGI24744J21845_100046302 116
70 3300002737 JGI25162J39368_1001672 JGI25162J39368_10016727 116
71 3300002772 JGI25164J39214_1001330 JGI25164J39214_10013307 116
72 3300003214 JGI25165J46597_1000436 JGI25165J46597_10004363 116
73 3300003320 rootH2_10100608 rootH2_101006089 116
74 3300003320 rootH2_10155889 rootH2_101558892 116
75 3300003323 rootH1_10024899 rootH1_1002489920 116
76 3300003323 rootH1_10183887 rootH1_101838872 116
77 3300005288 Ga0065714_10007166 Ga0065714_100071664 116
78 3300005288 Ga0065714_10091923 Ga0065714_100919232 116
79 3300005288 Ga0065714_10125995 Ga0065714_101259952 116
80 3300005327 Ga0070658_10134249 Ga0070658_101342492 116
81 3300005327 Ga0070658_10371914 Ga0070658_103719141 116
82 3300005327 Ga0070658_10829791 Ga0070658_108297912 116
83 3300005328 Ga0070676_10000879 Ga0070676_100008793 116
84 3300005338 Ga0068868_100004532 Ga0068868_1000045323 116
85 3300005339 Ga0070660_100073201 Ga0070660_1000732012 116
86 3300005341 Ga0070691_10117583 Ga0070691_101175832 116
87 3300005355 Ga0070671_100011480 Ga0070671_1000114802 116
88 3300005364 Ga0070673_100012628 Ga0070673_1000126284 116
89 3300005366 Ga0070659_100001078 Ga0070659_1000010783 116
90 3300005366 Ga0070659_100004671 Ga0070659_1000046714 116
91 3300005455 Ga0070663_100064906 Ga0070663_1000649062 116
92 3300005456 Ga0070678_100031536 Ga0070678_1000315364 116
93 3300005459 Ga0068867_100001558 Ga0068867_1000015583 116
94 3300005530 Ga0070679_100419919 Ga0070679_1004199192 116
95 3300005539 Ga0068853_100049743 Ga0068853_1000497433 116
96 3300005539 Ga0068853_100151313 Ga0068853_1001513131 116
97 3300005563 Ga0068855_100000141 Ga0068855_1000001416 116
98 3300005563 Ga0068855_100553181 Ga0068855_1005531812 116
99 3300005563 Ga0068855_100613124 Ga0068855_1006131242 116
100 3300005563 Ga0068855_100794552 Ga0068855_1007945522 116
101 3300005577 Ga0068857_100203926 Ga0068857_1002039263 116
102 3300005578 Ga0068854_100749669 Ga0068854_1007496691 116
103 3300005614 Ga0068856_100002785 Ga0068856_1000027857 116
104 3300005614 Ga0068856_100110349 Ga0068856_1001103492 116
105 3300005614 Ga0068856_100310570 Ga0068856_1003105702 116
106 3300005614 Ga0068856_101036546 Ga0068856_1010365461 116
107 3300005614 Ga0068856_101434988 Ga0068856_1014349881 116
108 3300005616 Ga0068852_100000571 Ga0068852_10000057112 116
109 3300005616 Ga0068852_100077341 Ga0068852_1000773413 116
110 3300005616 Ga0068852_102765216 Ga0068852_1027652162 116
111 3300005618 Ga0068864_101410281 Ga0068864_1014102811 116
112 3300005718 Ga0068866_10099817 Ga0068866_100998172 116
113 3300005834 Ga0068851_10904037 Ga0068851_109040371 116
114 3300005842 Ga0068858_100072498 Ga0068858_1000724983 116
115 3300006195 Ga0075366_10000201 Ga0075366_100002016 116
116 3300006195 Ga0075366_10003586 Ga0075366_100035862 116
117 3300006237 Ga0097621_100000344 Ga0097621_1000003442 116
118 3300006358 Ga0068871_100000758 Ga0068871_1000007588 116
119 3300006881 Ga0068865_100000373 Ga0068865_10000037321 116
120 3300009093 Ga0105240_10029162 Ga0105240_100291623 116
121 3300009093 Ga0105240_10183939 Ga0105240_101839392 116
122 3300009093 Ga0105240_10294634 Ga0105240_102946342 116
123 3300009093 Ga0105240_10319596 Ga0105240_103195963 116
124 3300009093 Ga0105240_10352355 Ga0105240_103523552 116
125 3300009093 Ga0105240_10810596 Ga0105240_108105962 116
126 3300009093 Ga0105240_11117735 Ga0105240_111177352 116
127 3300009174 Ga0105241_10030428 Ga0105241_100304282 116
128 3300009174 Ga0105241_10101824 Ga0105241_101018242 116
129 3300009174 Ga0105241_10102971 Ga0105241_101029712 116
130 3300009174 Ga0105241_11857441 Ga0105241_118574411 116
131 3300009176 Ga0105242_10020623 Ga0105242_100206235 116
132 3300009545 Ga0105237_10000168 Ga0105237_1000016836 116
133 3300009545 Ga0105237_10000811 Ga0105237_100008115 116
134 3300009545 Ga0105237_10045495 Ga0105237_100454953 116
135 3300009553 Ga0105249_10223417 Ga0105249_102234172 116
136 3300010375 Ga0105239_10013805 Ga0105239_100138054 116
137 3300010375 Ga0105239_10027198 Ga0105239_100271986 116
138 3300010375 Ga0105239_10071253 Ga0105239_100712533 116
139 3300010375 Ga0105239_10409326 Ga0105239_104093263 116
140 3300013100 Ga0157373_10000906 Ga0157373_1000090620 116
141 3300013100 Ga0157373_10002692 Ga0157373_100026923 116
142 3300013102 Ga0157371_10002379 Ga0157371_100023791 116
143 3300013102 Ga0157371_10025137 Ga0157371_100251373 116
144 3300013104 Ga0157370_10122083 Ga0157370_101220832 116
145 3300013104 Ga0157370_10823207 Ga0157370_108232072 116
146 3300013104 Ga0157370_11139412 Ga0157370_111394122 116
147 3300013105 Ga0157369_10162391 Ga0157369_101623912 116
148 3300013105 Ga0157369_10190334 Ga0157369_101903343 116
149 3300013105 Ga0157369_10827842 Ga0157369_108278423 116
150 3300013296 Ga0157374_10000445 Ga0157374_1000044518 116
151 3300013296 Ga0157374_10320587 Ga0157374_103205872 116
152 3300013297 Ga0157378_10046287 Ga0157378_100462872 116
153 3300013297 Ga0157378_10183611 Ga0157378_101836112 116
154 3300013297 Ga0157378_10603570 Ga0157378_106035702 116
155 3300013306 Ga0163162_10038578 Ga0163162_100385783 116
156 3300013306 Ga0163162_10044363 Ga0163162_100443633 116
157 3300013306 Ga0163162_10130102 Ga0163162_101301024 116
158 3300013306 Ga0163162_10495534 Ga0163162_104955341 116
159 3300013307 Ga0157372_10000296 Ga0157372_100002968 116
160 3300013307 Ga0157372_10001857 Ga0157372_100018576 116
161 3300013307 Ga0157372_10050237 Ga0157372_100502372 116
162 3300013307 Ga0157372_10346125 Ga0157372_103461251 116
163 3300013308 Ga0157375_10000834 Ga0157375_1000083417 116
164 3300013308 Ga0157375_10003328 Ga0157375_1000332811 116
165 3300013308 Ga0157375_10390200 Ga0157375_103902003 116
166 3300013308 Ga0157375_10612613 Ga0157375_106126132 116
167 3300014969 Ga0157376_10006193 Ga0157376_100061936 116
168 3300025230 Ga0209563_109553 Ga0209563_1095532 116
169 3300025231 Ga0207427_100163 Ga0207427_10016360 116
170 3300025233 Ga0209437_100041 Ga0209437_100041317 116
171 3300025233 Ga0209437_100101 Ga0209437_100101166 116
172 3300025242 Ga0209258_115622 Ga0209258_1156221 116
173 3300025254 Ga0209148_1019414 Ga0209148_10194142 116
174 3300025258 Ga0209129_1025236 Ga0209129_10252361 116
175 3300025261 Ga0209233_1000124 Ga0209233_100012471 116
176 3300025261 Ga0209233_1000783 Ga0209233_10007838 116
177 3300025321 Ga0207656_10722416 Ga0207656_107224162 116
178 3300025899 Ga0207642_10077083 Ga0207642_100770832 116
179 3300025899 Ga0207642_10348324 Ga0207642_103483242 116
180 3300025904 Ga0207647_10000043 Ga0207647_1000004364 116
181 3300025904 Ga0207647_10515433 Ga0207647_105154332 116
182 3300025907 Ga0207645_10000185 Ga0207645_100001855 116
183 3300025909 Ga0207705_10638228 Ga0207705_106382282 116
184 3300025911 Ga0207654_10079604 Ga0207654_100796042 116
185 3300025913 Ga0207695_10052382 Ga0207695_100523823 116
186 3300025913 Ga0207695_10810353 Ga0207695_108103532 116
187 3300025914 Ga0207671_10000724 Ga0207671_100007245 116
188 3300025914 Ga0207671_10324239 Ga0207671_103242392 116
189 3300025914 Ga0207671_10519182 Ga0207671_105191822 116
190 3300025919 Ga0207657_10104256 Ga0207657_101042562 116
191 3300025931 Ga0207644_10014405 Ga0207644_100144055 116
192 3300025932 Ga0207690_10003549 Ga0207690_100035498 116
193 3300025932 Ga0207690_10053951 Ga0207690_100539514 116
194 3300025934 Ga0207686_10021420 Ga0207686_100214204 116
195 3300025935 Ga0207709_11161817 Ga0207709_111618172 116
196 3300025937 Ga0207669_10501106 Ga0207669_105011062 116
197 3300025938 Ga0207704_10000055 Ga0207704_1000005539 116
198 3300025944 Ga0207661_10055966 Ga0207661_100559662 116
199 3300025949 Ga0207667_10000030 Ga0207667_1000003029 116
200 3300025949 Ga0207667_10478675 Ga0207667_104786751 116
201 3300025949 Ga0207667_10539303 Ga0207667_105393031 116
202 3300025949 Ga0207667_10671060 Ga0207667_106710602 116
203 3300025960 Ga0207651_10006512 Ga0207651_100065125 116
204 3300026023 Ga0207677_10015980 Ga0207677_100159803 116
205 3300026023 Ga0207677_12021656 Ga0207677_120216561 116
206 3300026035 Ga0207703_10159219 Ga0207703_101592193 116
207 3300026041 Ga0207639_10044062 Ga0207639_100440623 116
208 3300026041 Ga0207639_10219245 Ga0207639_102192452 116
209 3300026041 Ga0207639_10919778 Ga0207639_109197781 116
210 3300026041 Ga0207639_10930750 Ga0207639_109307501 116
211 3300026078 Ga0207702_10002387 Ga0207702_1000238712 116
212 3300026078 Ga0207702_10269031 Ga0207702_102690312 116
213 3300026078 Ga0207702_10324670 Ga0207702_103246702 116
214 3300026089 Ga0207648_10000775 Ga0207648_1000077530 116
215 3300026116 Ga0207674_10305997 Ga0207674_103059971 116
216 3300026121 Ga0207683_10063492 Ga0207683_100634922 116
217 3300026142 Ga0207698_10038696 Ga0207698_100386962 116
218 3300026142 Ga0207698_10226395 Ga0207698_102263952 116
219 3300026142 Ga0207698_10729012 Ga0207698_107290122 116
220 3300026142 Ga0207698_11600063 Ga0207698_116000632 116
221 3300028786 Ga0307517_10070832 Ga0307517_100708322 116
222 3300028794 Ga0307515_10000224 Ga0307515_1000022488 116
223 3300028794 Ga0307515_10000430 Ga0307515_1000043017 116
224 3300033179 Ga0307507_10000225 Ga0307507_1000022548 116
225 3300033180 Ga0307510_10000744 Ga0307510_100007444 116
226 3300037312 Ga0395899_0000017 Ga0395899_0000017_211838_212191 116
227 3300037418 Ga0395900_0500723 Ga0395900_0500723_427_777 116
228 3300038443 Ga0395901_0077386 Ga0395901_0077386_877_1227 116
229 3300042005 Ga0439448_0079606 Ga0439448_0079606_426_776 116
230 3300044684 Ga0466966_0198148 Ga0466966_0198148_528_881 116
231 3300046459 Ga0495629_0051988 Ga0495629_0051988_256_624 116
232 3300046471 Ga0495650_0000003 Ga0495650_0000003_435222_435581 116
233 3300046471 Ga0495650_0032817 Ga0495650_0032817_899_1267 116
234 3300046471 Ga0495650_0330727 Ga0495650_0330727_121_480 116
235 3300046475 Ga0495639_0231115 Ga0495639_0231115_521_889 116
236 3300046492 Ga0495585_0000677 Ga0495585_0000677_4356_4715 116
237 3300046492 Ga0495585_0001602 Ga0495585_0001602_11894_12262 116
238 3300046507 Ga0495606_0000002 Ga0495606_0000002_390912_391271 116
239 3300046507 Ga0495606_0001945 Ga0495606_0001945_18656_19009 116
240 3300046507 Ga0495606_0386996 Ga0495606_0386996_25_375 116
241 3300046512 Ga0495610_0005598 Ga0495610_0005598_6021_6386 116
242 3300046512 Ga0495610_0150356 Ga0495610_0150356_235_594 116
243 3300046513 Ga0495616_0012790 Ga0495616_0012790_370_729 116
244 3300046519 Ga0495632_0105096 Ga0495632_0105096_847_1197 116
245 3300046523 Ga0495644_0036614 Ga0495644_0036614_634_984 116
246 3300046524 Ga0495648_0013371 Ga0495648_0013371_24_392 116
247 3300046524 Ga0495648_0022465 Ga0495648_0022465_151_510 116
248 3300046524 Ga0495648_0222587 Ga0495648_0222587_24_392 116
249 3300046529 Ga0495652_0201739 Ga0495652_0201739_451_810 116
250 3300046530 Ga0495654_0012718 Ga0495654_0012718_3533_3901 116
251 3300046538 Ga0495609_0002670 Ga0495609_0002670_7160_7528 116
252 3300046557 Ga0495622_0127131 Ga0495622_0127131_374_742 116
253 3300046558 Ga0495633_0008502 Ga0495633_0008502_2215_2580 116
254 3300046616 Ga0495668_0000050 Ga0495668_0000050_45677_46045 116
255 3300046616 Ga0495668_0196017 Ga0495668_0196017_252_611 116
256 3300046616 Ga0495668_0366387 Ga0495668_0366387_153_503 116
257 3300046660 Ga0495625_0000005 Ga0495625_0000005_370766_371125 116
258 3300046660 Ga0495625_0000305 Ga0495625_0000305_65764_66132 116
259 3300046660 Ga0495625_0009184 Ga0495625_0009184_1966_2325 116
260 3300046660 Ga0495625_0173812 Ga0495625_0173812_177_536 116
261 3300046665 Ga0495661_0002222 Ga0495661_0002222_2549_2914 116
262 3300046665 Ga0495661_0004181 Ga0495661_0004181_7656_8015 116
263 3300046683 Ga0495658_0543193 Ga0495658_0543193_182_550 116
264 3300046684 Ga0495669_0080775 Ga0495669_0080775_523_873 116
265 3300046694 Ga0495649_0000003 Ga0495649_0000003_551524_551883 116
266 3300046810 Ga0495660_0107339 Ga0495660_0107339_494_862 116
267 3300047443 Ga0495687_000345 Ga0495687_000345_27342_27692 116
268 3300047445 Ga0495677_0296779 Ga0495677_0296779_116_466 116
269 3300050493 nmdc:mga0k408_1211_c1 nmdc:mga0k408_1211_c1_8889_9242 116
270 3300050493 nmdc:mga0k408_123_c1 nmdc:mga0k408_123_c1_4171_4530 116
271 3300050493 nmdc:mga0k408_161607_c1 nmdc:mga0k408_161607_c1_295_654 116
272 3300050493 nmdc:mga0k408_2071_c1 nmdc:mga0k408_2071_c1_223_579 116
273 3300050493 nmdc:mga0k408_409349_c1 nmdc:mga0k408_409349_c1_418_771 116
274 3300053080 Ga0500635_0046699 Ga0500635_0046699_830_1180 116
275 3300053091 Ga0500647_0135115 Ga0500647_0135115_633_1001 116
276 3300053122 Ga0500608_009995 Ga0500608_009995_800_1150 116
277 3300053122 Ga0500608_017878 Ga0500608_017878_63_416 116
278 3300053125 Ga0500618_005603 Ga0500618_005603_1997_2356 116
279 3300053156 Ga0500622_0000909 Ga0500622_0000909_9171_9524 116
280 3300053157 Ga0500624_002428 Ga0500624_002428_1263_1613 116

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22668

DUF7009

Family of unknown function (DUF7009)

1

112

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6h8d-assembly1.cif.gz_A-2 mamm ctd d249n - nickel form 0.7007 28 49
3w63-assembly1.cif.gz_A-2 mamm-ctd 215-293 0.6854 28 49
5u5n-assembly1.cif.gz_B the dimeric crystal structure of htpa reductase from sellaginella moellendorffii 0.6747 43 74
6h88-assembly1.cif.gz_A mamm ctd d249n 0.6496 28 49
7z5h-assembly3.cif.gz_C human zn matcap 0.6354 43 72
ID Description Score Start End Superfamily
af_Q553Z2_307_449_2.70.130.10 Mainly Beta;Distorted Sandwich;Cation-dependent Mannose-6-phosphate Receptor; Chain A;Mannose-6-phosphate receptor binding domain 0.7543 27 65 2.70.130.10
af_O07429_1_169_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.7504 43 69 3.40.390.10
af_I1MYZ4_16_275_2.70.130.10 Mainly Beta;Distorted Sandwich;Cation-dependent Mannose-6-phosphate Receptor; Chain A;Mannose-6-phosphate receptor binding domain 0.7108 27 65 2.70.130.10
af_Q54QZ0_34_162_2.70.130.10 Mainly Beta;Distorted Sandwich;Cation-dependent Mannose-6-phosphate Receptor; Chain A;Mannose-6-phosphate receptor binding domain 0.7008 27 65 2.70.130.10
af_O53463_124_228_1.10.10.2910 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.6828 43 66 1.10.10.2910
ID Description Score Start End GO Terms
AF-A0A243WLK8-F1-model_v4 Uncharacterized protein 0.9451 1 98
AF-A0A3E0P9V8-F1-model_v4 Uncharacterized protein 0.9448 1 92
AF-A0A369Q9X4-F1-model_v4 Uncharacterized protein 0.937 1 98
AF-A0A4Q6C9N1-F1-model_v4 Uncharacterized protein 0.926 1 94
AF-A0A1I7KTM2-F1-model_v4 Uncharacterized protein 0.9257 1 94

Feature Viewer

pLDDT pTM Quality
86.37 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map