F383417
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 280 | 146 | 275 | 116 |
Family's Representative Sequence
| Representative Sequence | 3300001990|JGI24737J22298_10041108|JGI24737J22298_100411082 |
| Length | 115 |
| Sequence | MKVRIKGNSLRYRLSMTDVARFARDGYAEEVIDFGKTQLTYALQRGPTLSLEAEFMNNKIIVFMPYSWADEWVETDRVGFEQKGPLYLLVEKDFQCIDNVAEDQTDNYPNPSLIC |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 2 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 3 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 4 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 5 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 6 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 11 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 12 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 14 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 15 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 16 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 40 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 41 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 44 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 72 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 104 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 105 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 106 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 107 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 108 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 109 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 110 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 111 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 112 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 113 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 114 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 115 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 141 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 142 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 143 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 144 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 145 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 146 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.21 |
| Metatranscriptomes | 0 |
| Isolates | 1.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.64 |
| Nodule | 0 |
| Rhizoplane | 0.36 |
| Rhizosphere | 85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1007496 | 3300001904 | Bacteria | 1833 |
| 2 | JGI24739J22299_10004769 | 3300001989 | Bacteria | 5177 |
| 3 | JGI24739J22299_10014232 | 3300001989 | Bacteria | 2895 |
| 4 | JGI24739J22299_10040978 | 3300001989 | Bacteria | 1543 |
| 5 | JGI24737J22298_10001645 | 3300001990 | Bacteria | 7971 |
| 6 | JGI24737J22298_10041108 | 3300001990 | Bacteria | 1418 |
| 7 | JGI24737J22298_10217767 | 3300001990 | Unclassified | 563 |
| 8 | JGI24735J21928_10000014 | 3300002067 | Bacteria | 186670 |
| 9 | JGI24735J21928_10155306 | 3300002067 | Bacteria | 661 |
| 10 | JGI24735J21928_10179068 | 3300002067 | Bacteria | 614 |
| 11 | JGI24735J21928_10198589 | 3300002067 | Unclassified | 581 |
| 12 | JGI24744J21845_10004630 | 3300002077 | Bacteria | 2845 |
| 13 | JGI25162J39368_1001672 | 3300002737 | Bacteria | 10898 |
| 14 | JGI25164J39214_1001330 | 3300002772 | Bacteria | 6126 |
| 15 | JGI25165J46597_1000436 | 3300003214 | Bacteria | 42359 |
| 16 | rootH2_10001535 | 3300003320 | Bacteria | 91957 |
| 17 | rootH2_10100608 | 3300003320 | Bacteria | 8405 |
| 18 | rootH2_10155889 | 3300003320 | Bacteria | 3032 |
| 19 | rootH2_10197472 | 3300003320 | Bacteria | 1190 |
| 20 | rootH1_10024899 | 3300003323 | Bacteria | 34477 |
| 21 | rootH1_10170445 | 3300003323 | Bacteria | 2981 |
| 22 | rootH1_10183887 | 3300003323 | Bacteria | 2642 |
| 23 | Ga0065714_10007166 | 3300005288 | Bacteria | 2954 |
| 24 | Ga0065714_10091923 | 3300005288 | Bacteria | 1894 |
| 25 | Ga0065714_10125995 | 3300005288 | Bacteria | 1237 |
| 26 | Ga0070658_10134249 | 3300005327 | Bacteria | 2064 |
| 27 | Ga0070658_10371914 | 3300005327 | Bacteria | 1225 |
| 28 | Ga0070658_10829791 | 3300005327 | Bacteria | 803 |
| 29 | Ga0070676_10000879 | 3300005328 | Bacteria | 14827 |
| 30 | Ga0068868_100004532 | 3300005338 | Bacteria | 9750 |
| 31 | Ga0070660_100073201 | 3300005339 | Bacteria | 2679 |
| 32 | Ga0070691_10117583 | 3300005341 | Unclassified | 1335 |
| 33 | Ga0070671_100011480 | 3300005355 | Bacteria | 7121 |
| 34 | Ga0070673_100012628 | 3300005364 | Bacteria | 5806 |
| 35 | Ga0070659_100001078 | 3300005366 | Bacteria | 19930 |
| 36 | Ga0070659_100004671 | 3300005366 | Bacteria | 9777 |
| 37 | Ga0070659_101251704 | 3300005366 | Bacteria | 657 |
| 38 | Ga0070711_100343580 | 3300005439 | Unclassified | 1198 |
| 39 | Ga0070663_100064906 | 3300005455 | Bacteria | 2640 |
| 40 | Ga0070678_100031536 | 3300005456 | Bacteria | 3658 |
| 41 | Ga0070662_100003184 | 3300005457 | Bacteria | 10200 |
| 42 | Ga0068867_100001558 | 3300005459 | Bacteria | 15909 |
| 43 | Ga0070679_100419919 | 3300005530 | Bacteria | 1283 |
| 44 | Ga0068853_100049743 | 3300005539 | Bacteria | 3603 |
| 45 | Ga0068853_100151313 | 3300005539 | Bacteria | 2089 |
| 46 | Ga0070665_100000178 | 3300005548 | Bacteria | 113002 |
| 47 | Ga0068855_100000141 | 3300005563 | Bacteria | 92463 |
| 48 | Ga0068855_100022917 | 3300005563 | Bacteria | 7483 |
| 49 | Ga0068855_100553181 | 3300005563 | Bacteria | 1245 |
| 50 | Ga0068855_100613124 | 3300005563 | Bacteria | 1172 |
| 51 | Ga0068855_100794552 | 3300005563 | Bacteria | 1006 |
| 52 | Ga0068857_100203926 | 3300005577 | Bacteria | 1803 |
| 53 | Ga0068854_100749669 | 3300005578 | Bacteria | 847 |
| 54 | Ga0068856_100002785 | 3300005614 | Bacteria | 17904 |
| 55 | Ga0068856_100110349 | 3300005614 | Bacteria | 2748 |
| 56 | Ga0068856_100310570 | 3300005614 | Bacteria | 1594 |
| 57 | Ga0068856_100481743 | 3300005614 | Bacteria | 1262 |
| 58 | Ga0068856_101036546 | 3300005614 | Bacteria | 838 |
| 59 | Ga0068856_101434988 | 3300005614 | Bacteria | 704 |
| 60 | Ga0068852_100000571 | 3300005616 | Bacteria | 24216 |
| 61 | Ga0068852_100077341 | 3300005616 | Bacteria | 2941 |
| 62 | Ga0068852_102765216 | 3300005616 | Unclassified | 509 |
| 63 | Ga0068864_101410281 | 3300005618 | Bacteria | 698 |
| 64 | Ga0068866_10099817 | 3300005718 | Bacteria | 1599 |
| 65 | Ga0068851_10904037 | 3300005834 | Unclassified | 553 |
| 66 | Ga0068870_10250041 | 3300005840 | Bacteria | 1098 |
| 67 | Ga0068858_100072498 | 3300005842 | Bacteria | 3195 |
| 68 | Ga0075366_10000201 | 3300006195 | Bacteria | 26314 |
| 69 | Ga0075366_10003586 | 3300006195 | Bacteria | 8217 |
| 70 | Ga0097621_100000344 | 3300006237 | Bacteria | 31894 |
| 71 | Ga0068871_100000758 | 3300006358 | Bacteria | 21810 |
| 72 | Ga0068865_100000373 | 3300006881 | Bacteria | 24834 |
| 73 | Ga0105240_10001569 | 3300009093 | Bacteria | 38745 |
| 74 | Ga0105240_10010365 | 3300009093 | Bacteria | 13112 |
| 75 | Ga0105240_10029162 | 3300009093 | Bacteria | 7196 |
| 76 | Ga0105240_10183939 | 3300009093 | Bacteria | 2463 |
| 77 | Ga0105240_10294634 | 3300009093 | Unclassified | 1858 |
| 78 | Ga0105240_10319596 | 3300009093 | Unclassified | 1770 |
| 79 | Ga0105240_10352355 | 3300009093 | Bacteria | 1670 |
| 80 | Ga0105240_10810596 | 3300009093 | Bacteria | 1013 |
| 81 | Ga0105240_11117735 | 3300009093 | Bacteria | 838 |
| 82 | Ga0105241_10012854 | 3300009174 | Bacteria | 6143 |
| 83 | Ga0105241_10030428 | 3300009174 | Bacteria | 4035 |
| 84 | Ga0105241_10101824 | 3300009174 | Bacteria | 2284 |
| 85 | Ga0105241_10102971 | 3300009174 | Bacteria | 2273 |
| 86 | Ga0105241_10686397 | 3300009174 | Unclassified | 933 |
| 87 | Ga0105241_11857441 | 3300009174 | Bacteria | 589 |
| 88 | Ga0105242_10020623 | 3300009176 | Bacteria | 5170 |
| 89 | Ga0105237_10000168 | 3300009545 | Bacteria | 92212 |
| 90 | Ga0105237_10000811 | 3300009545 | Bacteria | 42732 |
| 91 | Ga0105237_10009972 | 3300009545 | Bacteria | 10135 |
| 92 | Ga0105237_10045495 | 3300009545 | Bacteria | 4416 |
| 93 | Ga0105238_10162040 | 3300009551 | Bacteria | 2212 |
| 94 | Ga0105249_10223417 | 3300009553 | Bacteria | 1854 |
| 95 | Ga0105239_10000137 | 3300010375 | Bacteria | 102833 |
| 96 | Ga0105239_10013805 | 3300010375 | Bacteria | 8965 |
| 97 | Ga0105239_10027198 | 3300010375 | Bacteria | 6296 |
| 98 | Ga0105239_10071253 | 3300010375 | Bacteria | 3819 |
| 99 | Ga0105239_10409326 | 3300010375 | Bacteria | 1536 |
| 100 | Ga0105239_10476989 | 3300010375 | Bacteria | 1417 |
| 101 | Ga0105246_10809660 | 3300011119 | Bacteria | 832 |
| 102 | Ga0157373_10000906 | 3300013100 | Bacteria | 22984 |
| 103 | Ga0157373_10002692 | 3300013100 | Bacteria | 13467 |
| 104 | Ga0157373_10006683 | 3300013100 | Bacteria | 8589 |
| 105 | Ga0157371_10002379 | 3300013102 | Bacteria | 17992 |
| 106 | Ga0157371_10025137 | 3300013102 | Bacteria | 4344 |
| 107 | Ga0157370_10122083 | 3300013104 | Bacteria | 2433 |
| 108 | Ga0157370_10823207 | 3300013104 | Bacteria | 844 |
| 109 | Ga0157370_11139412 | 3300013104 | Bacteria | 704 |
| 110 | Ga0157369_10162391 | 3300013105 | Unclassified | 2358 |
| 111 | Ga0157369_10190334 | 3300013105 | Bacteria | 2156 |
| 112 | Ga0157369_10827842 | 3300013105 | Bacteria | 950 |
| 113 | Ga0157374_10000445 | 3300013296 | Bacteria | 37588 |
| 114 | Ga0157374_10010164 | 3300013296 | Bacteria | 8087 |
| 115 | Ga0157374_10320587 | 3300013296 | Bacteria | 1536 |
| 116 | Ga0157378_10046287 | 3300013297 | Bacteria | 3867 |
| 117 | Ga0157378_10183611 | 3300013297 | Bacteria | 1969 |
| 118 | Ga0157378_10603570 | 3300013297 | Bacteria | 1109 |
| 119 | Ga0163162_10000008 | 3300013306 | Bacteria | 316194 |
| 120 | Ga0163162_10038578 | 3300013306 | Bacteria | 4767 |
| 121 | Ga0163162_10044363 | 3300013306 | Bacteria | 4453 |
| 122 | Ga0163162_10130102 | 3300013306 | Bacteria | 2625 |
| 123 | Ga0163162_10495534 | 3300013306 | Bacteria | 1352 |
| 124 | Ga0157372_10000296 | 3300013307 | Bacteria | 55447 |
| 125 | Ga0157372_10001857 | 3300013307 | Bacteria | 22903 |
| 126 | Ga0157372_10005806 | 3300013307 | Bacteria | 13148 |
| 127 | Ga0157372_10050237 | 3300013307 | Bacteria | 4639 |
| 128 | Ga0157372_10346125 | 3300013307 | Bacteria | 1732 |
| 129 | Ga0157375_10000834 | 3300013308 | Bacteria | 26970 |
| 130 | Ga0157375_10003328 | 3300013308 | Bacteria | 13921 |
| 131 | Ga0157375_10390200 | 3300013308 | Bacteria | 1559 |
| 132 | Ga0157375_10612613 | 3300013308 | Bacteria | 1247 |
| 133 | Ga0157377_10012405 | 3300014745 | Bacteria | 4284 |
| 134 | Ga0157376_10006193 | 3300014969 | Bacteria | 8430 |
| 135 | Ga0209563_109553 | 3300025230 | Bacteria | 1460 |
| 136 | Ga0207427_100163 | 3300025231 | Bacteria | 74501 |
| 137 | Ga0209437_100041 | 3300025233 | Bacteria | 444465 |
| 138 | Ga0209437_100101 | 3300025233 | Bacteria | 226668 |
| 139 | Ga0209258_115622 | 3300025242 | Bacteria | 862 |
| 140 | Ga0209148_1019414 | 3300025254 | Bacteria | 1128 |
| 141 | Ga0209129_1025236 | 3300025258 | Bacteria | 1038 |
| 142 | Ga0209233_1000124 | 3300025261 | Bacteria | 226743 |
| 143 | Ga0209233_1000783 | 3300025261 | Bacteria | 14334 |
| 144 | Ga0207656_10722416 | 3300025321 | Unclassified | 510 |
| 145 | Ga0207642_10077083 | 3300025899 | Bacteria | 1607 |
| 146 | Ga0207642_10348324 | 3300025899 | Unclassified | 873 |
| 147 | Ga0207647_10000043 | 3300025904 | Bacteria | 91109 |
| 148 | Ga0207647_10502723 | 3300025904 | Bacteria | 676 |
| 149 | Ga0207647_10515433 | 3300025904 | Bacteria | 666 |
| 150 | Ga0207645_10000185 | 3300025907 | Bacteria | 49988 |
| 151 | Ga0207705_10638228 | 3300025909 | Bacteria | 828 |
| 152 | Ga0207654_10079604 | 3300025911 | Bacteria | 1968 |
| 153 | Ga0207654_10178422 | 3300025911 | Bacteria | 1384 |
| 154 | Ga0207654_10884354 | 3300025911 | Unclassified | 647 |
| 155 | Ga0207695_10006499 | 3300025913 | Bacteria | 15141 |
| 156 | Ga0207695_10011817 | 3300025913 | Bacteria | 10535 |
| 157 | Ga0207695_10052382 | 3300025913 | Bacteria | 4277 |
| 158 | Ga0207695_10810353 | 3300025913 | Unclassified | 816 |
| 159 | Ga0207671_10000724 | 3300025914 | Bacteria | 42108 |
| 160 | Ga0207671_10017322 | 3300025914 | Bacteria | 5559 |
| 161 | Ga0207671_10324239 | 3300025914 | Bacteria | 1219 |
| 162 | Ga0207671_10519182 | 3300025914 | Unclassified | 950 |
| 163 | Ga0207663_10270244 | 3300025916 | Unclassified | 1259 |
| 164 | Ga0207657_10104256 | 3300025919 | Bacteria | 2349 |
| 165 | Ga0207694_10496212 | 3300025924 | Bacteria | 1022 |
| 166 | Ga0207644_10014405 | 3300025931 | Bacteria | 5290 |
| 167 | Ga0207690_10003549 | 3300025932 | Bacteria | 9291 |
| 168 | Ga0207690_10053951 | 3300025932 | Unclassified | 2700 |
| 169 | Ga0207706_10000246 | 3300025933 | Bacteria | 59254 |
| 170 | Ga0207686_10021420 | 3300025934 | Bacteria | 3710 |
| 171 | Ga0207709_11161817 | 3300025935 | Unclassified | 635 |
| 172 | Ga0207669_10501106 | 3300025937 | Bacteria | 971 |
| 173 | Ga0207704_10000055 | 3300025938 | Bacteria | 78858 |
| 174 | Ga0207661_10055966 | 3300025944 | Bacteria | 3165 |
| 175 | Ga0207667_10000030 | 3300025949 | Bacteria | 327226 |
| 176 | Ga0207667_10003094 | 3300025949 | Bacteria | 20590 |
| 177 | Ga0207667_10478675 | 3300025949 | Bacteria | 1264 |
| 178 | Ga0207667_10539303 | 3300025949 | Bacteria | 1181 |
| 179 | Ga0207667_10671060 | 3300025949 | Bacteria | 1041 |
| 180 | Ga0207651_10006512 | 3300025960 | Bacteria | 6126 |
| 181 | Ga0207677_10015980 | 3300026023 | Bacteria | 4432 |
| 182 | Ga0207677_12021656 | 3300026023 | Unclassified | 536 |
| 183 | Ga0207703_10159219 | 3300026035 | Bacteria | 1976 |
| 184 | Ga0207639_10009944 | 3300026041 | Bacteria | 6573 |
| 185 | Ga0207639_10044062 | 3300026041 | Bacteria | 3354 |
| 186 | Ga0207639_10219245 | 3300026041 | Bacteria | 1642 |
| 187 | Ga0207639_10919778 | 3300026041 | Unclassified | 818 |
| 188 | Ga0207639_10930750 | 3300026041 | Bacteria | 813 |
| 189 | Ga0207702_10002387 | 3300026078 | Bacteria | 17897 |
| 190 | Ga0207702_10269031 | 3300026078 | Bacteria | 1607 |
| 191 | Ga0207702_10324670 | 3300026078 | Bacteria | 1467 |
| 192 | Ga0207702_10379513 | 3300026078 | Bacteria | 1359 |
| 193 | Ga0207648_10000775 | 3300026089 | Bacteria | 36025 |
| 194 | Ga0207674_10305997 | 3300026116 | Bacteria | 1539 |
| 195 | Ga0207683_10063492 | 3300026121 | Bacteria | 3253 |
| 196 | Ga0207698_10038696 | 3300026142 | Bacteria | 3526 |
| 197 | Ga0207698_10226395 | 3300026142 | Bacteria | 1694 |
| 198 | Ga0207698_10729012 | 3300026142 | Bacteria | 988 |
| 199 | Ga0207698_11600063 | 3300026142 | Bacteria | 667 |
| 200 | Ga0268266_10000098 | 3300028379 | Bacteria | 182784 |
| 201 | Ga0307517_10070832 | 3300028786 | Bacteria | 3134 |
| 202 | Ga0307515_10000224 | 3300028794 | Bacteria | 140276 |
| 203 | Ga0307515_10000430 | 3300028794 | Bacteria | 101168 |
| 204 | Ga0307507_10000225 | 3300033179 | Bacteria | 107651 |
| 205 | Ga0307510_10000744 | 3300033180 | Bacteria | 33468 |
| 206 | Ga0395899_0000017 | 3300037312 | Bacteria | 440179 |
| 207 | Ga0395899_0000199 | 3300037312 | Bacteria | 87960 |
| 208 | Ga0395899_0020548 | 3300037312 | Bacteria | 5005 |
| 209 | Ga0395900_0000157 | 3300037418 | Bacteria | 112131 |
| 210 | Ga0395900_0084940 | 3300037418 | Bacteria | 3253 |
| 211 | Ga0395900_0500723 | 3300037418 | Unclassified | 1165 |
| 212 | Ga0395898_0004296 | 3300037466 | Bacteria | 15617 |
| 213 | Ga0395898_1585315 | 3300037466 | Bacteria | 579 |
| 214 | Ga0395905_0000195 | 3300037471 | Bacteria | 95130 |
| 215 | Ga0395905_0004747 | 3300037471 | Bacteria | 14042 |
| 216 | Ga0395901_0000283 | 3300038443 | Bacteria | 62908 |
| 217 | Ga0395901_0008324 | 3300038443 | Bacteria | 10481 |
| 218 | Ga0395901_0077386 | 3300038443 | Bacteria | 3472 |
| 219 | Ga0439448_0079606 | 3300042005 | Unclassified | 1099 |
| 220 | Ga0466966_0198148 | 3300044684 | Bacteria | 1215 |
| 221 | Ga0466966_0872109 | 3300044684 | Unclassified | 543 |
| 222 | Ga0466959_0606621 | 3300045049 | Unclassified | 736 |
| 223 | Ga0495629_0051988 | 3300046459 | Bacteria | 2867 |
| 224 | Ga0495650_0000003 | 3300046471 | Bacteria | 900730 |
| 225 | Ga0495650_0032817 | 3300046471 | Bacteria | 2318 |
| 226 | Ga0495650_0330727 | 3300046471 | Bacteria | 506 |
| 227 | Ga0495639_0231115 | 3300046475 | Bacteria | 911 |
| 228 | Ga0495585_0000362 | 3300046492 | Bacteria | 44090 |
| 229 | Ga0495585_0000677 | 3300046492 | Bacteria | 31155 |
| 230 | Ga0495585_0001602 | 3300046492 | Bacteria | 17485 |
| 231 | Ga0495606_0000002 | 3300046507 | Bacteria | 554637 |
| 232 | Ga0495606_0001945 | 3300046507 | Bacteria | 25548 |
| 233 | Ga0495606_0386996 | 3300046507 | Unclassified | 732 |
| 234 | Ga0495610_0005598 | 3300046512 | Bacteria | 8868 |
| 235 | Ga0495610_0150356 | 3300046512 | Bacteria | 994 |
| 236 | Ga0495616_0012790 | 3300046513 | Bacteria | 4750 |
| 237 | Ga0495632_0105096 | 3300046519 | Bacteria | 1329 |
| 238 | Ga0495644_0036614 | 3300046523 | Bacteria | 1851 |
| 239 | Ga0495648_0013371 | 3300046524 | Bacteria | 6074 |
| 240 | Ga0495648_0022465 | 3300046524 | Bacteria | 4342 |
| 241 | Ga0495648_0222587 | 3300046524 | Bacteria | 929 |
| 242 | Ga0495652_0201739 | 3300046529 | Bacteria | 1509 |
| 243 | Ga0495654_0012718 | 3300046530 | Bacteria | 4518 |
| 244 | Ga0495609_0002670 | 3300046538 | Bacteria | 10800 |
| 245 | Ga0495622_0127131 | 3300046557 | Bacteria | 1162 |
| 246 | Ga0495633_0008502 | 3300046558 | Bacteria | 5771 |
| 247 | Ga0495668_0000050 | 3300046616 | Bacteria | 214716 |
| 248 | Ga0495668_0196017 | 3300046616 | Bacteria | 1106 |
| 249 | Ga0495668_0366387 | 3300046616 | Unclassified | 791 |
| 250 | Ga0495625_0000005 | 3300046660 | Bacteria | 596135 |
| 251 | Ga0495625_0000305 | 3300046660 | Bacteria | 75021 |
| 252 | Ga0495625_0009184 | 3300046660 | Bacteria | 8306 |
| 253 | Ga0495625_0173812 | 3300046660 | Bacteria | 1436 |
| 254 | Ga0495661_0002222 | 3300046665 | Bacteria | 15090 |
| 255 | Ga0495661_0004181 | 3300046665 | Bacteria | 10495 |
| 256 | Ga0495658_0543193 | 3300046683 | Bacteria | 744 |
| 257 | Ga0495669_0080775 | 3300046684 | Bacteria | 1492 |
| 258 | Ga0495649_0000003 | 3300046694 | Bacteria | 880817 |
| 259 | Ga0495660_0107339 | 3300046810 | Bacteria | 1429 |
| 260 | Ga0495687_000345 | 3300047443 | Bacteria | 59578 |
| 261 | Ga0495677_0296779 | 3300047445 | Unclassified | 635 |
| 262 | Ga0495686_0074849 | 3300047472 | Bacteria | 2077 |
| 263 | nmdc:mga0k408_1211_c1 | 3300050493 | Bacteria | 14116 |
| 264 | nmdc:mga0k408_123_c1 | 3300050493 | Bacteria | 38185 |
| 265 | nmdc:mga0k408_161607_c1 | 3300050493 | Bacteria | 1335 |
| 266 | nmdc:mga0k408_2071_c1 | 3300050493 | Bacteria | 10733 |
| 267 | nmdc:mga0k408_409349_c1 | 3300050493 | Bacteria | 807 |
| 268 | Ga0500635_0046699 | 3300053080 | Bacteria | 1469 |
| 269 | Ga0500647_0135115 | 3300053091 | Bacteria | 1161 |
| 270 | Ga0500608_009995 | 3300053122 | Bacteria | 4057 |
| 271 | Ga0500608_017878 | 3300053122 | Bacteria | 3227 |
| 272 | Ga0500618_000015 | 3300053125 | Bacteria | 175864 |
| 273 | Ga0500618_005603 | 3300053125 | Bacteria | 3792 |
| 274 | Ga0500622_0000909 | 3300053156 | Bacteria | 25177 |
| 275 | Ga0500624_002428 | 3300053157 | Bacteria | 2525 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009093 | Ga0105240_10001569 | Ga0105240_1000156914 | 100 |
| 2 | 3300009093 | Ga0105240_10010365 | Ga0105240_100103653 | 100 |
| 3 | 3300013296 | Ga0157374_10010164 | Ga0157374_100101648 | 100 |
| 4 | 3300013306 | Ga0163162_10000008 | Ga0163162_10000008238 | 100 |
| 5 | 3300013307 | Ga0157372_10005806 | Ga0157372_100058065 | 100 |
| 6 | 3300014745 | Ga0157377_10012405 | Ga0157377_100124053 | 100 |
| 7 | 3300037312 | Ga0395899_0000199 | Ga0395899_0000199_54709_55011 | 100 |
| 8 | 3300037312 | Ga0395899_0020548 | Ga0395899_0020548_1687_1989 | 100 |
| 9 | 3300037418 | Ga0395900_0000157 | Ga0395900_0000157_55360_55662 | 100 |
| 10 | 3300037418 | Ga0395900_0084940 | Ga0395900_0084940_2807_3109 | 100 |
| 11 | 3300037466 | Ga0395898_0004296 | Ga0395898_0004296_5050_5352 | 100 |
| 12 | 3300037466 | Ga0395898_1585315 | Ga0395898_1585315_198_500 | 100 |
| 13 | 3300037471 | Ga0395905_0000195 | Ga0395905_0000195_56452_56754 | 100 |
| 14 | 3300037471 | Ga0395905_0004747 | Ga0395905_0004747_6889_7191 | 100 |
| 15 | 3300038443 | Ga0395901_0000283 | Ga0395901_0000283_6140_6442 | 100 |
| 16 | 3300038443 | Ga0395901_0008324 | Ga0395901_0008324_4091_4393 | 100 |
| 17 | 3300044684 | Ga0466966_0872109 | Ga0466966_0872109_108_410 | 100 |
| 18 | 3300045049 | Ga0466959_0606621 | Ga0466959_0606621_400_702 | 100 |
| 19 | 3300047472 | Ga0495686_0074849 | Ga0495686_0074849_1594_1896 | 100 |
| 20 | iso_pu_bacteria | 2599185184 | 2599477803 | 112 |
| 21 | iso_pu_bacteria | 2919437846 | 2919442857 | 112 |
| 22 | iso_pu_bacteria | 2928078545 | 2928079720 | 112 |
| 23 | iso_pu_bacteria | 2928147474 | 2928147804 | 112 |
| 24 | iso_pu_bacteria | 2932082852 | 2932086654 | 112 |
| 25 | 3300001990 | JGI24737J22298_10041108 | JGI24737J22298_100411082 | 115 |
| 26 | 3300003320 | rootH2_10001535 | rootH2_100015359 | 115 |
| 27 | 3300003320 | rootH2_10197472 | rootH2_101974722 | 115 |
| 28 | 3300003323 | rootH1_10170445 | rootH1_101704453 | 115 |
| 29 | 3300005366 | Ga0070659_101251704 | Ga0070659_1012517042 | 115 |
| 30 | 3300005439 | Ga0070711_100343580 | Ga0070711_1003435801 | 115 |
| 31 | 3300005457 | Ga0070662_100003184 | Ga0070662_10000318410 | 115 |
| 32 | 3300005548 | Ga0070665_100000178 | Ga0070665_10000017872 | 115 |
| 33 | 3300005563 | Ga0068855_100022917 | Ga0068855_1000229173 | 115 |
| 34 | 3300005614 | Ga0068856_100481743 | Ga0068856_1004817432 | 115 |
| 35 | 3300005840 | Ga0068870_10250041 | Ga0068870_102500412 | 115 |
| 36 | 3300009174 | Ga0105241_10012854 | Ga0105241_100128544 | 115 |
| 37 | 3300009174 | Ga0105241_10686397 | Ga0105241_106863972 | 115 |
| 38 | 3300009545 | Ga0105237_10009972 | Ga0105237_100099724 | 115 |
| 39 | 3300009551 | Ga0105238_10162040 | Ga0105238_101620402 | 115 |
| 40 | 3300010375 | Ga0105239_10000137 | Ga0105239_1000013721 | 115 |
| 41 | 3300010375 | Ga0105239_10476989 | Ga0105239_104769893 | 115 |
| 42 | 3300011119 | Ga0105246_10809660 | Ga0105246_108096602 | 115 |
| 43 | 3300013100 | Ga0157373_10006683 | Ga0157373_100066833 | 115 |
| 44 | 3300025904 | Ga0207647_10502723 | Ga0207647_105027232 | 115 |
| 45 | 3300025911 | Ga0207654_10178422 | Ga0207654_101784222 | 115 |
| 46 | 3300025911 | Ga0207654_10884354 | Ga0207654_108843542 | 115 |
| 47 | 3300025913 | Ga0207695_10006499 | Ga0207695_1000649911 | 115 |
| 48 | 3300025913 | Ga0207695_10011817 | Ga0207695_100118177 | 115 |
| 49 | 3300025914 | Ga0207671_10017322 | Ga0207671_100173224 | 115 |
| 50 | 3300025916 | Ga0207663_10270244 | Ga0207663_102702442 | 115 |
| 51 | 3300025924 | Ga0207694_10496212 | Ga0207694_104962122 | 115 |
| 52 | 3300025933 | Ga0207706_10000246 | Ga0207706_1000024637 | 115 |
| 53 | 3300025949 | Ga0207667_10003094 | Ga0207667_100030947 | 115 |
| 54 | 3300026041 | Ga0207639_10009944 | Ga0207639_100099445 | 115 |
| 55 | 3300026078 | Ga0207702_10379513 | Ga0207702_103795132 | 115 |
| 56 | 3300028379 | Ga0268266_10000098 | Ga0268266_10000098116 | 115 |
| 57 | 3300046492 | Ga0495585_0000362 | Ga0495585_0000362_9921_10268 | 115 |
| 58 | 3300053125 | Ga0500618_000015 | Ga0500618_000015_125455_125802 | 115 |
| 59 | 3300001904 | JGI24736J21556_1007496 | JGI24736J21556_10074962 | 116 |
| 60 | 3300001989 | JGI24739J22299_10004769 | JGI24739J22299_100047692 | 116 |
| 61 | 3300001989 | JGI24739J22299_10014232 | JGI24739J22299_100142323 | 116 |
| 62 | 3300001989 | JGI24739J22299_10040978 | JGI24739J22299_100409782 | 116 |
| 63 | 3300001990 | JGI24737J22298_10001645 | JGI24737J22298_100016457 | 116 |
| 64 | 3300001990 | JGI24737J22298_10217767 | JGI24737J22298_102177672 | 116 |
| 65 | 3300002067 | JGI24735J21928_10000014 | JGI24735J21928_10000014158 | 116 |
| 66 | 3300002067 | JGI24735J21928_10155306 | JGI24735J21928_101553062 | 116 |
| 67 | 3300002067 | JGI24735J21928_10179068 | JGI24735J21928_101790682 | 116 |
| 68 | 3300002067 | JGI24735J21928_10198589 | JGI24735J21928_101985892 | 116 |
| 69 | 3300002077 | JGI24744J21845_10004630 | JGI24744J21845_100046302 | 116 |
| 70 | 3300002737 | JGI25162J39368_1001672 | JGI25162J39368_10016727 | 116 |
| 71 | 3300002772 | JGI25164J39214_1001330 | JGI25164J39214_10013307 | 116 |
| 72 | 3300003214 | JGI25165J46597_1000436 | JGI25165J46597_10004363 | 116 |
| 73 | 3300003320 | rootH2_10100608 | rootH2_101006089 | 116 |
| 74 | 3300003320 | rootH2_10155889 | rootH2_101558892 | 116 |
| 75 | 3300003323 | rootH1_10024899 | rootH1_1002489920 | 116 |
| 76 | 3300003323 | rootH1_10183887 | rootH1_101838872 | 116 |
| 77 | 3300005288 | Ga0065714_10007166 | Ga0065714_100071664 | 116 |
| 78 | 3300005288 | Ga0065714_10091923 | Ga0065714_100919232 | 116 |
| 79 | 3300005288 | Ga0065714_10125995 | Ga0065714_101259952 | 116 |
| 80 | 3300005327 | Ga0070658_10134249 | Ga0070658_101342492 | 116 |
| 81 | 3300005327 | Ga0070658_10371914 | Ga0070658_103719141 | 116 |
| 82 | 3300005327 | Ga0070658_10829791 | Ga0070658_108297912 | 116 |
| 83 | 3300005328 | Ga0070676_10000879 | Ga0070676_100008793 | 116 |
| 84 | 3300005338 | Ga0068868_100004532 | Ga0068868_1000045323 | 116 |
| 85 | 3300005339 | Ga0070660_100073201 | Ga0070660_1000732012 | 116 |
| 86 | 3300005341 | Ga0070691_10117583 | Ga0070691_101175832 | 116 |
| 87 | 3300005355 | Ga0070671_100011480 | Ga0070671_1000114802 | 116 |
| 88 | 3300005364 | Ga0070673_100012628 | Ga0070673_1000126284 | 116 |
| 89 | 3300005366 | Ga0070659_100001078 | Ga0070659_1000010783 | 116 |
| 90 | 3300005366 | Ga0070659_100004671 | Ga0070659_1000046714 | 116 |
| 91 | 3300005455 | Ga0070663_100064906 | Ga0070663_1000649062 | 116 |
| 92 | 3300005456 | Ga0070678_100031536 | Ga0070678_1000315364 | 116 |
| 93 | 3300005459 | Ga0068867_100001558 | Ga0068867_1000015583 | 116 |
| 94 | 3300005530 | Ga0070679_100419919 | Ga0070679_1004199192 | 116 |
| 95 | 3300005539 | Ga0068853_100049743 | Ga0068853_1000497433 | 116 |
| 96 | 3300005539 | Ga0068853_100151313 | Ga0068853_1001513131 | 116 |
| 97 | 3300005563 | Ga0068855_100000141 | Ga0068855_1000001416 | 116 |
| 98 | 3300005563 | Ga0068855_100553181 | Ga0068855_1005531812 | 116 |
| 99 | 3300005563 | Ga0068855_100613124 | Ga0068855_1006131242 | 116 |
| 100 | 3300005563 | Ga0068855_100794552 | Ga0068855_1007945522 | 116 |
| 101 | 3300005577 | Ga0068857_100203926 | Ga0068857_1002039263 | 116 |
| 102 | 3300005578 | Ga0068854_100749669 | Ga0068854_1007496691 | 116 |
| 103 | 3300005614 | Ga0068856_100002785 | Ga0068856_1000027857 | 116 |
| 104 | 3300005614 | Ga0068856_100110349 | Ga0068856_1001103492 | 116 |
| 105 | 3300005614 | Ga0068856_100310570 | Ga0068856_1003105702 | 116 |
| 106 | 3300005614 | Ga0068856_101036546 | Ga0068856_1010365461 | 116 |
| 107 | 3300005614 | Ga0068856_101434988 | Ga0068856_1014349881 | 116 |
| 108 | 3300005616 | Ga0068852_100000571 | Ga0068852_10000057112 | 116 |
| 109 | 3300005616 | Ga0068852_100077341 | Ga0068852_1000773413 | 116 |
| 110 | 3300005616 | Ga0068852_102765216 | Ga0068852_1027652162 | 116 |
| 111 | 3300005618 | Ga0068864_101410281 | Ga0068864_1014102811 | 116 |
| 112 | 3300005718 | Ga0068866_10099817 | Ga0068866_100998172 | 116 |
| 113 | 3300005834 | Ga0068851_10904037 | Ga0068851_109040371 | 116 |
| 114 | 3300005842 | Ga0068858_100072498 | Ga0068858_1000724983 | 116 |
| 115 | 3300006195 | Ga0075366_10000201 | Ga0075366_100002016 | 116 |
| 116 | 3300006195 | Ga0075366_10003586 | Ga0075366_100035862 | 116 |
| 117 | 3300006237 | Ga0097621_100000344 | Ga0097621_1000003442 | 116 |
| 118 | 3300006358 | Ga0068871_100000758 | Ga0068871_1000007588 | 116 |
| 119 | 3300006881 | Ga0068865_100000373 | Ga0068865_10000037321 | 116 |
| 120 | 3300009093 | Ga0105240_10029162 | Ga0105240_100291623 | 116 |
| 121 | 3300009093 | Ga0105240_10183939 | Ga0105240_101839392 | 116 |
| 122 | 3300009093 | Ga0105240_10294634 | Ga0105240_102946342 | 116 |
| 123 | 3300009093 | Ga0105240_10319596 | Ga0105240_103195963 | 116 |
| 124 | 3300009093 | Ga0105240_10352355 | Ga0105240_103523552 | 116 |
| 125 | 3300009093 | Ga0105240_10810596 | Ga0105240_108105962 | 116 |
| 126 | 3300009093 | Ga0105240_11117735 | Ga0105240_111177352 | 116 |
| 127 | 3300009174 | Ga0105241_10030428 | Ga0105241_100304282 | 116 |
| 128 | 3300009174 | Ga0105241_10101824 | Ga0105241_101018242 | 116 |
| 129 | 3300009174 | Ga0105241_10102971 | Ga0105241_101029712 | 116 |
| 130 | 3300009174 | Ga0105241_11857441 | Ga0105241_118574411 | 116 |
| 131 | 3300009176 | Ga0105242_10020623 | Ga0105242_100206235 | 116 |
| 132 | 3300009545 | Ga0105237_10000168 | Ga0105237_1000016836 | 116 |
| 133 | 3300009545 | Ga0105237_10000811 | Ga0105237_100008115 | 116 |
| 134 | 3300009545 | Ga0105237_10045495 | Ga0105237_100454953 | 116 |
| 135 | 3300009553 | Ga0105249_10223417 | Ga0105249_102234172 | 116 |
| 136 | 3300010375 | Ga0105239_10013805 | Ga0105239_100138054 | 116 |
| 137 | 3300010375 | Ga0105239_10027198 | Ga0105239_100271986 | 116 |
| 138 | 3300010375 | Ga0105239_10071253 | Ga0105239_100712533 | 116 |
| 139 | 3300010375 | Ga0105239_10409326 | Ga0105239_104093263 | 116 |
| 140 | 3300013100 | Ga0157373_10000906 | Ga0157373_1000090620 | 116 |
| 141 | 3300013100 | Ga0157373_10002692 | Ga0157373_100026923 | 116 |
| 142 | 3300013102 | Ga0157371_10002379 | Ga0157371_100023791 | 116 |
| 143 | 3300013102 | Ga0157371_10025137 | Ga0157371_100251373 | 116 |
| 144 | 3300013104 | Ga0157370_10122083 | Ga0157370_101220832 | 116 |
| 145 | 3300013104 | Ga0157370_10823207 | Ga0157370_108232072 | 116 |
| 146 | 3300013104 | Ga0157370_11139412 | Ga0157370_111394122 | 116 |
| 147 | 3300013105 | Ga0157369_10162391 | Ga0157369_101623912 | 116 |
| 148 | 3300013105 | Ga0157369_10190334 | Ga0157369_101903343 | 116 |
| 149 | 3300013105 | Ga0157369_10827842 | Ga0157369_108278423 | 116 |
| 150 | 3300013296 | Ga0157374_10000445 | Ga0157374_1000044518 | 116 |
| 151 | 3300013296 | Ga0157374_10320587 | Ga0157374_103205872 | 116 |
| 152 | 3300013297 | Ga0157378_10046287 | Ga0157378_100462872 | 116 |
| 153 | 3300013297 | Ga0157378_10183611 | Ga0157378_101836112 | 116 |
| 154 | 3300013297 | Ga0157378_10603570 | Ga0157378_106035702 | 116 |
| 155 | 3300013306 | Ga0163162_10038578 | Ga0163162_100385783 | 116 |
| 156 | 3300013306 | Ga0163162_10044363 | Ga0163162_100443633 | 116 |
| 157 | 3300013306 | Ga0163162_10130102 | Ga0163162_101301024 | 116 |
| 158 | 3300013306 | Ga0163162_10495534 | Ga0163162_104955341 | 116 |
| 159 | 3300013307 | Ga0157372_10000296 | Ga0157372_100002968 | 116 |
| 160 | 3300013307 | Ga0157372_10001857 | Ga0157372_100018576 | 116 |
| 161 | 3300013307 | Ga0157372_10050237 | Ga0157372_100502372 | 116 |
| 162 | 3300013307 | Ga0157372_10346125 | Ga0157372_103461251 | 116 |
| 163 | 3300013308 | Ga0157375_10000834 | Ga0157375_1000083417 | 116 |
| 164 | 3300013308 | Ga0157375_10003328 | Ga0157375_1000332811 | 116 |
| 165 | 3300013308 | Ga0157375_10390200 | Ga0157375_103902003 | 116 |
| 166 | 3300013308 | Ga0157375_10612613 | Ga0157375_106126132 | 116 |
| 167 | 3300014969 | Ga0157376_10006193 | Ga0157376_100061936 | 116 |
| 168 | 3300025230 | Ga0209563_109553 | Ga0209563_1095532 | 116 |
| 169 | 3300025231 | Ga0207427_100163 | Ga0207427_10016360 | 116 |
| 170 | 3300025233 | Ga0209437_100041 | Ga0209437_100041317 | 116 |
| 171 | 3300025233 | Ga0209437_100101 | Ga0209437_100101166 | 116 |
| 172 | 3300025242 | Ga0209258_115622 | Ga0209258_1156221 | 116 |
| 173 | 3300025254 | Ga0209148_1019414 | Ga0209148_10194142 | 116 |
| 174 | 3300025258 | Ga0209129_1025236 | Ga0209129_10252361 | 116 |
| 175 | 3300025261 | Ga0209233_1000124 | Ga0209233_100012471 | 116 |
| 176 | 3300025261 | Ga0209233_1000783 | Ga0209233_10007838 | 116 |
| 177 | 3300025321 | Ga0207656_10722416 | Ga0207656_107224162 | 116 |
| 178 | 3300025899 | Ga0207642_10077083 | Ga0207642_100770832 | 116 |
| 179 | 3300025899 | Ga0207642_10348324 | Ga0207642_103483242 | 116 |
| 180 | 3300025904 | Ga0207647_10000043 | Ga0207647_1000004364 | 116 |
| 181 | 3300025904 | Ga0207647_10515433 | Ga0207647_105154332 | 116 |
| 182 | 3300025907 | Ga0207645_10000185 | Ga0207645_100001855 | 116 |
| 183 | 3300025909 | Ga0207705_10638228 | Ga0207705_106382282 | 116 |
| 184 | 3300025911 | Ga0207654_10079604 | Ga0207654_100796042 | 116 |
| 185 | 3300025913 | Ga0207695_10052382 | Ga0207695_100523823 | 116 |
| 186 | 3300025913 | Ga0207695_10810353 | Ga0207695_108103532 | 116 |
| 187 | 3300025914 | Ga0207671_10000724 | Ga0207671_100007245 | 116 |
| 188 | 3300025914 | Ga0207671_10324239 | Ga0207671_103242392 | 116 |
| 189 | 3300025914 | Ga0207671_10519182 | Ga0207671_105191822 | 116 |
| 190 | 3300025919 | Ga0207657_10104256 | Ga0207657_101042562 | 116 |
| 191 | 3300025931 | Ga0207644_10014405 | Ga0207644_100144055 | 116 |
| 192 | 3300025932 | Ga0207690_10003549 | Ga0207690_100035498 | 116 |
| 193 | 3300025932 | Ga0207690_10053951 | Ga0207690_100539514 | 116 |
| 194 | 3300025934 | Ga0207686_10021420 | Ga0207686_100214204 | 116 |
| 195 | 3300025935 | Ga0207709_11161817 | Ga0207709_111618172 | 116 |
| 196 | 3300025937 | Ga0207669_10501106 | Ga0207669_105011062 | 116 |
| 197 | 3300025938 | Ga0207704_10000055 | Ga0207704_1000005539 | 116 |
| 198 | 3300025944 | Ga0207661_10055966 | Ga0207661_100559662 | 116 |
| 199 | 3300025949 | Ga0207667_10000030 | Ga0207667_1000003029 | 116 |
| 200 | 3300025949 | Ga0207667_10478675 | Ga0207667_104786751 | 116 |
| 201 | 3300025949 | Ga0207667_10539303 | Ga0207667_105393031 | 116 |
| 202 | 3300025949 | Ga0207667_10671060 | Ga0207667_106710602 | 116 |
| 203 | 3300025960 | Ga0207651_10006512 | Ga0207651_100065125 | 116 |
| 204 | 3300026023 | Ga0207677_10015980 | Ga0207677_100159803 | 116 |
| 205 | 3300026023 | Ga0207677_12021656 | Ga0207677_120216561 | 116 |
| 206 | 3300026035 | Ga0207703_10159219 | Ga0207703_101592193 | 116 |
| 207 | 3300026041 | Ga0207639_10044062 | Ga0207639_100440623 | 116 |
| 208 | 3300026041 | Ga0207639_10219245 | Ga0207639_102192452 | 116 |
| 209 | 3300026041 | Ga0207639_10919778 | Ga0207639_109197781 | 116 |
| 210 | 3300026041 | Ga0207639_10930750 | Ga0207639_109307501 | 116 |
| 211 | 3300026078 | Ga0207702_10002387 | Ga0207702_1000238712 | 116 |
| 212 | 3300026078 | Ga0207702_10269031 | Ga0207702_102690312 | 116 |
| 213 | 3300026078 | Ga0207702_10324670 | Ga0207702_103246702 | 116 |
| 214 | 3300026089 | Ga0207648_10000775 | Ga0207648_1000077530 | 116 |
| 215 | 3300026116 | Ga0207674_10305997 | Ga0207674_103059971 | 116 |
| 216 | 3300026121 | Ga0207683_10063492 | Ga0207683_100634922 | 116 |
| 217 | 3300026142 | Ga0207698_10038696 | Ga0207698_100386962 | 116 |
| 218 | 3300026142 | Ga0207698_10226395 | Ga0207698_102263952 | 116 |
| 219 | 3300026142 | Ga0207698_10729012 | Ga0207698_107290122 | 116 |
| 220 | 3300026142 | Ga0207698_11600063 | Ga0207698_116000632 | 116 |
| 221 | 3300028786 | Ga0307517_10070832 | Ga0307517_100708322 | 116 |
| 222 | 3300028794 | Ga0307515_10000224 | Ga0307515_1000022488 | 116 |
| 223 | 3300028794 | Ga0307515_10000430 | Ga0307515_1000043017 | 116 |
| 224 | 3300033179 | Ga0307507_10000225 | Ga0307507_1000022548 | 116 |
| 225 | 3300033180 | Ga0307510_10000744 | Ga0307510_100007444 | 116 |
| 226 | 3300037312 | Ga0395899_0000017 | Ga0395899_0000017_211838_212191 | 116 |
| 227 | 3300037418 | Ga0395900_0500723 | Ga0395900_0500723_427_777 | 116 |
| 228 | 3300038443 | Ga0395901_0077386 | Ga0395901_0077386_877_1227 | 116 |
| 229 | 3300042005 | Ga0439448_0079606 | Ga0439448_0079606_426_776 | 116 |
| 230 | 3300044684 | Ga0466966_0198148 | Ga0466966_0198148_528_881 | 116 |
| 231 | 3300046459 | Ga0495629_0051988 | Ga0495629_0051988_256_624 | 116 |
| 232 | 3300046471 | Ga0495650_0000003 | Ga0495650_0000003_435222_435581 | 116 |
| 233 | 3300046471 | Ga0495650_0032817 | Ga0495650_0032817_899_1267 | 116 |
| 234 | 3300046471 | Ga0495650_0330727 | Ga0495650_0330727_121_480 | 116 |
| 235 | 3300046475 | Ga0495639_0231115 | Ga0495639_0231115_521_889 | 116 |
| 236 | 3300046492 | Ga0495585_0000677 | Ga0495585_0000677_4356_4715 | 116 |
| 237 | 3300046492 | Ga0495585_0001602 | Ga0495585_0001602_11894_12262 | 116 |
| 238 | 3300046507 | Ga0495606_0000002 | Ga0495606_0000002_390912_391271 | 116 |
| 239 | 3300046507 | Ga0495606_0001945 | Ga0495606_0001945_18656_19009 | 116 |
| 240 | 3300046507 | Ga0495606_0386996 | Ga0495606_0386996_25_375 | 116 |
| 241 | 3300046512 | Ga0495610_0005598 | Ga0495610_0005598_6021_6386 | 116 |
| 242 | 3300046512 | Ga0495610_0150356 | Ga0495610_0150356_235_594 | 116 |
| 243 | 3300046513 | Ga0495616_0012790 | Ga0495616_0012790_370_729 | 116 |
| 244 | 3300046519 | Ga0495632_0105096 | Ga0495632_0105096_847_1197 | 116 |
| 245 | 3300046523 | Ga0495644_0036614 | Ga0495644_0036614_634_984 | 116 |
| 246 | 3300046524 | Ga0495648_0013371 | Ga0495648_0013371_24_392 | 116 |
| 247 | 3300046524 | Ga0495648_0022465 | Ga0495648_0022465_151_510 | 116 |
| 248 | 3300046524 | Ga0495648_0222587 | Ga0495648_0222587_24_392 | 116 |
| 249 | 3300046529 | Ga0495652_0201739 | Ga0495652_0201739_451_810 | 116 |
| 250 | 3300046530 | Ga0495654_0012718 | Ga0495654_0012718_3533_3901 | 116 |
| 251 | 3300046538 | Ga0495609_0002670 | Ga0495609_0002670_7160_7528 | 116 |
| 252 | 3300046557 | Ga0495622_0127131 | Ga0495622_0127131_374_742 | 116 |
| 253 | 3300046558 | Ga0495633_0008502 | Ga0495633_0008502_2215_2580 | 116 |
| 254 | 3300046616 | Ga0495668_0000050 | Ga0495668_0000050_45677_46045 | 116 |
| 255 | 3300046616 | Ga0495668_0196017 | Ga0495668_0196017_252_611 | 116 |
| 256 | 3300046616 | Ga0495668_0366387 | Ga0495668_0366387_153_503 | 116 |
| 257 | 3300046660 | Ga0495625_0000005 | Ga0495625_0000005_370766_371125 | 116 |
| 258 | 3300046660 | Ga0495625_0000305 | Ga0495625_0000305_65764_66132 | 116 |
| 259 | 3300046660 | Ga0495625_0009184 | Ga0495625_0009184_1966_2325 | 116 |
| 260 | 3300046660 | Ga0495625_0173812 | Ga0495625_0173812_177_536 | 116 |
| 261 | 3300046665 | Ga0495661_0002222 | Ga0495661_0002222_2549_2914 | 116 |
| 262 | 3300046665 | Ga0495661_0004181 | Ga0495661_0004181_7656_8015 | 116 |
| 263 | 3300046683 | Ga0495658_0543193 | Ga0495658_0543193_182_550 | 116 |
| 264 | 3300046684 | Ga0495669_0080775 | Ga0495669_0080775_523_873 | 116 |
| 265 | 3300046694 | Ga0495649_0000003 | Ga0495649_0000003_551524_551883 | 116 |
| 266 | 3300046810 | Ga0495660_0107339 | Ga0495660_0107339_494_862 | 116 |
| 267 | 3300047443 | Ga0495687_000345 | Ga0495687_000345_27342_27692 | 116 |
| 268 | 3300047445 | Ga0495677_0296779 | Ga0495677_0296779_116_466 | 116 |
| 269 | 3300050493 | nmdc:mga0k408_1211_c1 | nmdc:mga0k408_1211_c1_8889_9242 | 116 |
| 270 | 3300050493 | nmdc:mga0k408_123_c1 | nmdc:mga0k408_123_c1_4171_4530 | 116 |
| 271 | 3300050493 | nmdc:mga0k408_161607_c1 | nmdc:mga0k408_161607_c1_295_654 | 116 |
| 272 | 3300050493 | nmdc:mga0k408_2071_c1 | nmdc:mga0k408_2071_c1_223_579 | 116 |
| 273 | 3300050493 | nmdc:mga0k408_409349_c1 | nmdc:mga0k408_409349_c1_418_771 | 116 |
| 274 | 3300053080 | Ga0500635_0046699 | Ga0500635_0046699_830_1180 | 116 |
| 275 | 3300053091 | Ga0500647_0135115 | Ga0500647_0135115_633_1001 | 116 |
| 276 | 3300053122 | Ga0500608_009995 | Ga0500608_009995_800_1150 | 116 |
| 277 | 3300053122 | Ga0500608_017878 | Ga0500608_017878_63_416 | 116 |
| 278 | 3300053125 | Ga0500618_005603 | Ga0500618_005603_1997_2356 | 116 |
| 279 | 3300053156 | Ga0500622_0000909 | Ga0500622_0000909_9171_9524 | 116 |
| 280 | 3300053157 | Ga0500624_002428 | Ga0500624_002428_1263_1613 | 116 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6h8d-assembly1.cif.gz_A-2 | mamm ctd d249n - nickel form | 0.7007 | 28 | 49 |
| 3w63-assembly1.cif.gz_A-2 | mamm-ctd 215-293 | 0.6854 | 28 | 49 |
| 5u5n-assembly1.cif.gz_B | the dimeric crystal structure of htpa reductase from sellaginella moellendorffii | 0.6747 | 43 | 74 |
| 6h88-assembly1.cif.gz_A | mamm ctd d249n | 0.6496 | 28 | 49 |
| 7z5h-assembly3.cif.gz_C | human zn matcap | 0.6354 | 43 | 72 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q553Z2_307_449_2.70.130.10 | Mainly Beta;Distorted Sandwich;Cation-dependent Mannose-6-phosphate Receptor; Chain A;Mannose-6-phosphate receptor binding domain | 0.7543 | 27 | 65 | 2.70.130.10 |
| af_O07429_1_169_3.40.390.10 | Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) | 0.7504 | 43 | 69 | 3.40.390.10 |
| af_I1MYZ4_16_275_2.70.130.10 | Mainly Beta;Distorted Sandwich;Cation-dependent Mannose-6-phosphate Receptor; Chain A;Mannose-6-phosphate receptor binding domain | 0.7108 | 27 | 65 | 2.70.130.10 |
| af_Q54QZ0_34_162_2.70.130.10 | Mainly Beta;Distorted Sandwich;Cation-dependent Mannose-6-phosphate Receptor; Chain A;Mannose-6-phosphate receptor binding domain | 0.7008 | 27 | 65 | 2.70.130.10 |
| af_O53463_124_228_1.10.10.2910 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; | 0.6828 | 43 | 66 | 1.10.10.2910 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A243WLK8-F1-model_v4 | Uncharacterized protein | 0.9451 | 1 | 98 |
|
| AF-A0A3E0P9V8-F1-model_v4 | Uncharacterized protein | 0.9448 | 1 | 92 |
|
| AF-A0A369Q9X4-F1-model_v4 | Uncharacterized protein | 0.937 | 1 | 98 |
|
| AF-A0A4Q6C9N1-F1-model_v4 | Uncharacterized protein | 0.926 | 1 | 94 |
|
| AF-A0A1I7KTM2-F1-model_v4 | Uncharacterized protein | 0.9257 | 1 | 94 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar