F383274

General Info

Members Datasets Scaffolds Average Seq Length
279 84 558 218

Family's Representative Sequence

Representative Sequence 3300046684|Ga0495669_0027389|Ga0495669_0027389_1040_1804
Length 254
Sequence MCFSSQARIAACFHPCNNKNSLHLPDTAHQYGVTMFGTGHPQPPHRKEVAMQIVQQEERNVASTELMVDPPSGEVGPPPDAPPIRFSVSYTLAEYTSILRAHLGFIMRHTPQAQRQRQTWMPLGIGLLAGAAAWAIGPGWARNTFAVLSALSILSLPFTLDMWIALVAPPVFFLKKRRMPVCEFRIDGQGIERSSRLGTLKRTWDEVKMVRRYERGYLLMFARGGIPIPFRCLDQQQQEQLRGYTTARGLAEAA

Samples

Sample ID Description Type Environment
1 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
2 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
3 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
4 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
5 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
6 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
7 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
8 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
9 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
10 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
11 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
12 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
13 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
14 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
15 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
16 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
17 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
18 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
19 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
20 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
21 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
22 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
23 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
24 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
25 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
26 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
27 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
28 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
29 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
30 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
31 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
32 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
33 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
34 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
35 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
36 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
37 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
38 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
39 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
40 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
41 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
42 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
43 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
44 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
45 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
46 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
47 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
48 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
49 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
50 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
51 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
52 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
53 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
54 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
55 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
56 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
57 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
58 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
59 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
60 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
61 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
62 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
63 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
64 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
65 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
66 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
67 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
68 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
69 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
70 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
71 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
72 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
73 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
74 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
75 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
76 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
77 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
78 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
79 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
80 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
81 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
82 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
83 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
84 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.36
Nodule 0
Rhizoplane 3.94
Rhizosphere 93.19
Stem 0
Stem Tuber 0
Unclassified 7.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495669_0027389 3300046684 Bacteria 2493
2 Ga0065165_1002884 3300005262 Bacteria 13219
3 Ga0395900_0086514 3300037418 Bacteria 3221
4 Ga0395900_0212863 3300037418 Bacteria 1951
5 Ga0395905_0145914 3300037471 Bacteria 2226
6 Ga0395905_0281391 3300037471 Bacteria 1549
7 Ga0395901_0406782 3300038443 Bacteria 1398
8 Ga0495617_000014 3300046452 Bacteria 286979
9 Ga0495627_000763 3300046453 Bacteria 23901
10 Ga0495627_007422 3300046453 Bacteria 4198
11 Ga0495627_030204 3300046453 Bacteria 1719
12 Ga0495603_0020879 3300046455 Bacteria 3965
13 Ga0495590_0000106 3300046457 Bacteria 50464
14 Ga0495590_0065582 3300046457 Bacteria 1271
15 Ga0495591_000132 3300046458 Bacteria 81947
16 Ga0495629_0017588 3300046459 Bacteria 5124
17 Ga0495629_0028817 3300046459 Bacteria 3941
18 Ga0495582_0301752 3300046473 Unclassified 920
19 Ga0495605_0000538 3300046474 Bacteria 31464
20 Ga0495605_0010187 3300046474 Bacteria 5264
21 Ga0495605_0011781 3300046474 Bacteria 4867
22 Ga0495605_0017639 3300046474 Bacteria 3839
23 Ga0495605_0041725 3300046474 Bacteria 2285
24 Ga0495605_0176335 3300046474 Bacteria 942
25 Ga0495584_0000883 3300046491 Bacteria 19287
26 Ga0495584_0005207 3300046491 Bacteria 6901
27 Ga0495584_0006181 3300046491 Bacteria 6292
28 Ga0495584_0011228 3300046491 Bacteria 4587
29 Ga0495584_0019936 3300046491 Bacteria 3407
30 Ga0495584_0046083 3300046491 Bacteria 2199
31 Ga0495584_0059445 3300046491 Bacteria 1922
32 Ga0495584_0072702 3300046491 Bacteria 1728
33 Ga0495585_0004556 3300046492 Bacteria 8964
34 Ga0495585_0005288 3300046492 Bacteria 8155
35 Ga0495585_0005593 3300046492 Bacteria 7897
36 Ga0495585_0008255 3300046492 Bacteria 6321
37 Ga0495585_0009574 3300046492 Bacteria 5799
38 Ga0495585_0041228 3300046492 Bacteria 2589
39 Ga0495585_0069034 3300046492 Bacteria 1929
40 Ga0495585_0080559 3300046492 Bacteria 1764
41 Ga0495585_0093914 3300046492 Bacteria 1612
42 Ga0495594_0211960 3300046499 Unclassified 1104
43 Ga0495596_0001100 3300046500 Bacteria 15989
44 Ga0495596_0002011 3300046500 Bacteria 11192
45 Ga0495596_0002530 3300046500 Bacteria 9789
46 Ga0495596_0005655 3300046500 Bacteria 5871
47 Ga0495596_0007238 3300046500 Bacteria 5020
48 Ga0495596_0008822 3300046500 Bacteria 4462
49 Ga0495596_0010584 3300046500 Bacteria 4008
50 Ga0495596_0011912 3300046500 Bacteria 3733
51 Ga0495596_0014283 3300046500 Bacteria 3346
52 Ga0495596_0016555 3300046500 Bacteria 3061
53 Ga0495596_0023482 3300046500 Bacteria 2502
54 Ga0495596_0089508 3300046500 Bacteria 1194
55 Ga0495607_0021315 3300046501 Bacteria 4079
56 Ga0495607_0026114 3300046501 Bacteria 3626
57 Ga0495607_0096157 3300046501 Bacteria 1595
58 Ga0495607_0142339 3300046501 Unclassified 1235
59 Ga0495607_0146620 3300046501 Bacteria 1212
60 Ga0495583_0002025 3300046506 Bacteria 18447
61 Ga0495583_0005154 3300046506 Bacteria 8999
62 Ga0495583_0005420 3300046506 Bacteria 8668
63 Ga0495583_0011392 3300046506 Bacteria 5109
64 Ga0495583_0016617 3300046506 Bacteria 3947
65 Ga0495583_0019991 3300046506 Bacteria 3481
66 Ga0495583_0056135 3300046506 Bacteria 1777
67 Ga0495583_0095336 3300046506 Bacteria 1276
68 Ga0495606_0040299 3300046507 Bacteria 3140
69 Ga0495606_0065048 3300046507 Bacteria 2318
70 Ga0495606_0100219 3300046507 Bacteria 1765
71 Ga0495606_0125889 3300046507 Unclassified 1528
72 Ga0495606_0351483 3300046507 Unclassified 782
73 Ga0495610_0006005 3300046512 Bacteria 8483
74 Ga0495610_0114947 3300046512 Unclassified 1187
75 Ga0495610_0232211 3300046512 Bacteria 740
76 Ga0495616_0000886 3300046513 Bacteria 21668
77 Ga0495616_0003063 3300046513 Bacteria 10829
78 Ga0495616_0004707 3300046513 Bacteria 8549
79 Ga0495616_0022946 3300046513 Bacteria 3363
80 Ga0495616_0077843 3300046513 Bacteria 1591
81 Ga0495616_0084517 3300046513 Unclassified 1513
82 Ga0495616_0161302 3300046513 Unclassified 1008
83 Ga0495631_0002188 3300046518 Bacteria 11269
84 Ga0495631_0002615 3300046518 Bacteria 10055
85 Ga0495631_0003958 3300046518 Bacteria 7999
86 Ga0495631_0003968 3300046518 Bacteria 7987
87 Ga0495631_0007768 3300046518 Bacteria 5440
88 Ga0495631_0019525 3300046518 Bacteria 3176
89 Ga0495631_0022376 3300046518 Bacteria 2939
90 Ga0495631_0024377 3300046518 Bacteria 2793
91 Ga0495631_0050655 3300046518 Bacteria 1816
92 Ga0495631_0054457 3300046518 Unclassified 1744
93 Ga0495631_0067548 3300046518 Bacteria 1546
94 Ga0495632_0001028 3300046519 Bacteria 24124
95 Ga0495632_0001647 3300046519 Bacteria 18288
96 Ga0495632_0003427 3300046519 Bacteria 11265
97 Ga0495632_0004405 3300046519 Bacteria 9568
98 Ga0495637_0000028 3300046520 Bacteria 144203
99 Ga0495643_0018085 3300046522 Bacteria 4104
100 Ga0495643_0052763 3300046522 Bacteria 2182
101 Ga0495643_0238411 3300046522 Unclassified 854
102 Ga0495644_0009264 3300046523 Bacteria 3794
103 Ga0495644_0014495 3300046523 Bacteria 3019
104 Ga0495644_0015095 3300046523 Bacteria 2958
105 Ga0495644_0046468 3300046523 Bacteria 1631
106 Ga0495644_0153250 3300046523 Bacteria 882
107 Ga0495648_0004787 3300046524 Bacteria 11444
108 Ga0495648_0017692 3300046524 Bacteria 5084
109 Ga0495648_0042023 3300046524 Bacteria 2880
110 Ga0495648_0057173 3300046524 Bacteria 2342
111 Ga0495648_0192400 3300046524 Bacteria 1028
112 Ga0495663_0024708 3300046525 Bacteria 1748
113 Ga0495642_0000192 3300046528 Bacteria 36285
114 Ga0495642_0003344 3300046528 Bacteria 6335
115 Ga0495642_0004047 3300046528 Bacteria 5721
116 Ga0495642_0013116 3300046528 Bacteria 3201
117 Ga0495642_0014657 3300046528 Bacteria 3039
118 Ga0495642_0014799 3300046528 Bacteria 3026
119 Ga0495642_0014967 3300046528 Bacteria 3010
120 Ga0495642_0018019 3300046528 Bacteria 2761
121 Ga0495642_0022607 3300046528 Bacteria 2478
122 Ga0495642_0032491 3300046528 Bacteria 2094
123 Ga0495654_0008297 3300046530 Bacteria 5746
124 Ga0495654_0036650 3300046530 Bacteria 2464
125 Ga0495654_0053688 3300046530 Bacteria 1957
126 Ga0495654_0282998 3300046530 Unclassified 681
127 Ga0495665_0213892 3300046531 Unclassified 998
128 Ga0495586_0025772 3300046535 Bacteria 3146
129 Ga0495609_0004957 3300046538 Bacteria 7139
130 Ga0495609_0015905 3300046538 Bacteria 3513
131 Ga0495609_0028260 3300046538 Bacteria 2560
132 Ga0495609_0057858 3300046538 Bacteria 1715
133 Ga0495597_0001773 3300046542 Bacteria 14819
134 Ga0495597_0002013 3300046542 Bacteria 13612
135 Ga0495597_0007545 3300046542 Bacteria 5515
136 Ga0495597_0010634 3300046542 Bacteria 4488
137 Ga0495597_0149848 3300046542 Bacteria 957
138 Ga0495597_0239554 3300046542 Bacteria 715
139 Ga0495622_0040755 3300046557 Bacteria 2160
140 Ga0495633_0005864 3300046558 Bacteria 7391
141 Ga0495633_0022458 3300046558 Bacteria 3139
142 Ga0495633_0059831 3300046558 Bacteria 1785
143 Ga0495633_0189516 3300046558 Bacteria 946
144 Ga0495656_0046997 3300046615 Bacteria 1829
145 Ga0495668_0005938 3300046616 Bacteria 8109
146 Ga0495668_0006670 3300046616 Bacteria 7516
147 Ga0495668_0007992 3300046616 Bacteria 6666
148 Ga0495668_0016253 3300046616 Bacteria 4326
149 Ga0495668_0017899 3300046616 Bacteria 4104
150 Ga0495668_0027493 3300046616 Bacteria 3223
151 Ga0495668_0042432 3300046616 Bacteria 2533
152 Ga0495668_0092217 3300046616 Bacteria 1659
153 Ga0495668_0136153 3300046616 Bacteria 1344
154 Ga0495668_0192068 3300046616 Bacteria 1118
155 Ga0495668_0350425 3300046616 Unclassified 810
156 Ga0495611_0001165 3300046648 Bacteria 13719
157 Ga0495611_0002506 3300046648 Bacteria 8358
158 Ga0495611_0015111 3300046648 Bacteria 3299
159 Ga0495611_0044439 3300046648 Bacteria 1987
160 Ga0495611_0111506 3300046648 Bacteria 1273
161 Ga0495625_0031228 3300046660 Bacteria 3964
162 Ga0495625_0037530 3300046660 Bacteria 3555
163 Ga0495625_0043834 3300046660 Bacteria 3242
164 Ga0495625_0142644 3300046660 Bacteria 1615
165 Ga0495635_0034272 3300046663 Bacteria 3521
166 Ga0495661_0001306 3300046665 Bacteria 21236
167 Ga0495661_0002699 3300046665 Bacteria 13535
168 Ga0495661_0010336 3300046665 Bacteria 6371
169 Ga0495661_0011190 3300046665 Bacteria 6088
170 Ga0495661_0012907 3300046665 Bacteria 5628
171 Ga0495661_0022391 3300046665 Bacteria 4110
172 Ga0495661_0036406 3300046665 Bacteria 3082
173 Ga0495661_0070129 3300046665 Bacteria 2052
174 Ga0495661_0084704 3300046665 Bacteria 1818
175 Ga0495661_0086410 3300046665 Bacteria 1795
176 Ga0495661_0123431 3300046665 Bacteria 1427
177 Ga0495661_0220326 3300046665 Unclassified 983
178 Ga0495588_0004738 3300046674 Bacteria 6015
179 Ga0495588_0022391 3300046674 Bacteria 3123
180 Ga0495588_0029889 3300046674 Bacteria 2735
181 Ga0495588_0067151 3300046674 Unclassified 1861
182 Ga0495588_0109266 3300046674 Bacteria 1456
183 Ga0495669_0000095 3300046684 Bacteria 57161
184 Ga0495669_0004830 3300046684 Bacteria 5592
185 Ga0495669_0021862 3300046684 Bacteria 2779
186 Ga0495669_0042059 3300046684 Bacteria 2030
187 Ga0495613_0053461 3300046689 Bacteria 2972
188 Ga0495613_0105277 3300046689 Bacteria 2036
189 Ga0495624_0086090 3300046690 Bacteria 1941
190 Ga0495670_0001130 3300046691 Bacteria 12953
191 Ga0495670_0007180 3300046691 Bacteria 5484
192 Ga0495670_0044256 3300046691 Bacteria 2222
193 Ga0495670_0068806 3300046691 Bacteria 1789
194 Ga0495670_0118816 3300046691 Bacteria 1372
195 Ga0495671_0000718 3300046692 Bacteria 23936
196 Ga0495671_0003539 3300046692 Bacteria 9547
197 Ga0495671_0004436 3300046692 Bacteria 8392
198 Ga0495671_0127821 3300046692 Unclassified 1239
199 Ga0495649_0000648 3300046694 Bacteria 28291
200 Ga0495649_0021192 3300046694 Bacteria 3642
201 Ga0495589_0000266 3300046794 Bacteria 42658
202 Ga0495589_0021499 3300046794 Bacteria 3297
203 Ga0495589_0028351 3300046794 Bacteria 2826
204 Ga0495589_0050728 3300046794 Bacteria 2051
205 Ga0495589_0055424 3300046794 Bacteria 1953
206 Ga0495589_0063289 3300046794 Bacteria 1815
207 Ga0495660_0003500 3300046810 Bacteria 9685
208 Ga0495660_0019652 3300046810 Bacteria 3877
209 Ga0495660_0027525 3300046810 Bacteria 3216
210 Ga0495660_0208134 3300046810 Bacteria 929
211 Ga0495604_0050924 3300047317 Bacteria 3213
212 Ga0495672_0001291 3300047320 Bacteria 24984
213 Ga0495672_0002747 3300047320 Bacteria 15771
214 Ga0495672_0013539 3300047320 Bacteria 5624
215 Ga0495672_0102478 3300047320 Bacteria 1549
216 Ga0495676_0000135 3300047321 Bacteria 55966
217 Ga0495680_0011297 3300047322 Bacteria 7913
218 Ga0495683_0000330 3300047323 Bacteria 39863
219 Ga0495683_0002039 3300047323 Bacteria 12515
220 Ga0495683_0042974 3300047323 Bacteria 2277
221 Ga0495683_0067050 3300047323 Bacteria 1767
222 Ga0495683_0114951 3300047323 Unclassified 1281
223 Ga0495687_004606 3300047443 Bacteria 9212
224 Ga0495687_122510 3300047443 Bacteria 935
225 Ga0495675_0088963 3300047444 Bacteria 1939
226 Ga0495677_0002469 3300047445 Bacteria 7260
227 Ga0495677_0003116 3300047445 Bacteria 6459
228 Ga0495677_0010670 3300047445 Bacteria 3366
229 Ga0495677_0019366 3300047445 Unclassified 2468
230 Ga0495677_0100080 3300047445 Bacteria 1097
231 Ga0495677_0178583 3300047445 Bacteria 822
232 Ga0495679_009610 3300047446 Bacteria 3856
233 Ga0495679_011595 3300047446 Unclassified 3390
234 Ga0495679_021282 3300047446 Bacteria 2243
235 Ga0495685_021485 3300047447 Bacteria 2220
236 Ga0495681_0000317 3300047470 Bacteria 38608
237 Ga0495681_0001145 3300047470 Bacteria 20136
238 Ga0495681_0002124 3300047470 Bacteria 14408
239 Ga0495681_0016508 3300047470 Bacteria 4133
240 Ga0495681_0018665 3300047470 Bacteria 3814
241 Ga0495681_0026042 3300047470 Bacteria 3054
242 Ga0495681_0104313 3300047470 Unclassified 1235
243 Ga0495681_0107008 3300047470 Bacteria 1215
244 Ga0495686_0002300 3300047472 Bacteria 18278
245 Ga0495686_0059644 3300047472 Unclassified 2374
246 Ga0495686_0078845 3300047472 Bacteria 2015
247 Ga0495593_0010408 3300047673 Bacteria 5377
248 Ga0495614_0003589 3300048089 Bacteria 6950
249 Ga0495626_0002032 3300048091 Bacteria 14850
250 Ga0495626_0007143 3300048091 Bacteria 6249
251 Ga0495626_0007469 3300048091 Bacteria 6082
252 Ga0495626_0015777 3300048091 Bacteria 3856
253 Ga0495626_0019817 3300048091 Bacteria 3358
254 Ga0495626_0035420 3300048091 Bacteria 2382
255 Ga0495626_0061760 3300048091 Bacteria 1703
256 Ga0496100_0072820 3300048903 Bacteria 2297
257 Ga0496101_0592506 3300048904 Bacteria 876
258 Ga0496102_0000849 3300048905 Bacteria 29319
259 Ga0496103_0207104 3300048906 Bacteria 1261
260 Ga0496106_0838394 3300048909 Unclassified 728
261 Ga0496108_0555378 3300048911 Bacteria 1002
262 Ga0496109_0057630 3300048912 Bacteria 3547
263 Ga0496110_0113144 3300048913 Bacteria 2440
264 Ga0496111_0183432 3300048914 Bacteria 1556
265 Ga0496113_0014975 3300048916 Bacteria 5310
266 Ga0496115_0131859 3300048918 Bacteria 2060
267 Ga0496121_0201839 3300048924 Bacteria 1417
268 Ga0496122_0003500 3300048925 Bacteria 20624
269 Ga0496122_0203052 3300048925 Bacteria 1157
270 Ga0496123_0001889 3300048926 Bacteria 27331
271 Ga0496124_0133659 3300048927 Bacteria 1967
272 Ga0496124_0236994 3300048927 Bacteria 1360
273 Ga0496125_0019312 3300048928 Bacteria 6435
274 Ga0495678_000264 3300049459 Bacteria 58107
275 Ga0495678_002431 3300049459 Bacteria 12656
276 Ga0495678_004801 3300049459 Bacteria 7691
277 Ga0495682_0000262 3300049460 Bacteria 41629
278 Ga0495682_0003425 3300049460 Bacteria 7054
279 Ga0495682_0043081 3300049460 Bacteria 1653
280 Ga0495669_0027389
281 Ga0065165_1002884
282 Ga0395900_0086514
283 Ga0395900_0212863
284 Ga0395905_0145914
285 Ga0395905_0281391
286 Ga0395901_0406782
287 Ga0495617_000014
288 Ga0495627_000763
289 Ga0495627_007422
290 Ga0495627_030204
291 Ga0495603_0020879
292 Ga0495590_0000106
293 Ga0495590_0065582
294 Ga0495591_000132
295 Ga0495629_0017588
296 Ga0495629_0028817
297 Ga0495582_0301752
298 Ga0495605_0000538
299 Ga0495605_0010187
300 Ga0495605_0011781
301 Ga0495605_0017639
302 Ga0495605_0041725
303 Ga0495605_0176335
304 Ga0495584_0000883
305 Ga0495584_0005207
306 Ga0495584_0006181
307 Ga0495584_0011228
308 Ga0495584_0019936
309 Ga0495584_0046083
310 Ga0495584_0059445
311 Ga0495584_0072702
312 Ga0495585_0004556
313 Ga0495585_0005288
314 Ga0495585_0005593
315 Ga0495585_0008255
316 Ga0495585_0009574
317 Ga0495585_0041228
318 Ga0495585_0069034
319 Ga0495585_0080559
320 Ga0495585_0093914
321 Ga0495594_0211960
322 Ga0495596_0001100
323 Ga0495596_0002011
324 Ga0495596_0002530
325 Ga0495596_0005655
326 Ga0495596_0007238
327 Ga0495596_0008822
328 Ga0495596_0010584
329 Ga0495596_0011912
330 Ga0495596_0014283
331 Ga0495596_0016555
332 Ga0495596_0023482
333 Ga0495596_0089508
334 Ga0495607_0021315
335 Ga0495607_0026114
336 Ga0495607_0096157
337 Ga0495607_0142339
338 Ga0495607_0146620
339 Ga0495583_0002025
340 Ga0495583_0005154
341 Ga0495583_0005420
342 Ga0495583_0011392
343 Ga0495583_0016617
344 Ga0495583_0019991
345 Ga0495583_0056135
346 Ga0495583_0095336
347 Ga0495606_0040299
348 Ga0495606_0065048
349 Ga0495606_0100219
350 Ga0495606_0125889
351 Ga0495606_0351483
352 Ga0495610_0006005
353 Ga0495610_0114947
354 Ga0495610_0232211
355 Ga0495616_0000886
356 Ga0495616_0003063
357 Ga0495616_0004707
358 Ga0495616_0022946
359 Ga0495616_0077843
360 Ga0495616_0084517
361 Ga0495616_0161302
362 Ga0495631_0002188
363 Ga0495631_0002615
364 Ga0495631_0003958
365 Ga0495631_0003968
366 Ga0495631_0007768
367 Ga0495631_0019525
368 Ga0495631_0022376
369 Ga0495631_0024377
370 Ga0495631_0050655
371 Ga0495631_0054457
372 Ga0495631_0067548
373 Ga0495632_0001028
374 Ga0495632_0001647
375 Ga0495632_0003427
376 Ga0495632_0004405
377 Ga0495637_0000028
378 Ga0495643_0018085
379 Ga0495643_0052763
380 Ga0495643_0238411
381 Ga0495644_0009264
382 Ga0495644_0014495
383 Ga0495644_0015095
384 Ga0495644_0046468
385 Ga0495644_0153250
386 Ga0495648_0004787
387 Ga0495648_0017692
388 Ga0495648_0042023
389 Ga0495648_0057173
390 Ga0495648_0192400
391 Ga0495663_0024708
392 Ga0495642_0000192
393 Ga0495642_0003344
394 Ga0495642_0004047
395 Ga0495642_0013116
396 Ga0495642_0014657
397 Ga0495642_0014799
398 Ga0495642_0014967
399 Ga0495642_0018019
400 Ga0495642_0022607
401 Ga0495642_0032491
402 Ga0495654_0008297
403 Ga0495654_0036650
404 Ga0495654_0053688
405 Ga0495654_0282998
406 Ga0495665_0213892
407 Ga0495586_0025772
408 Ga0495609_0004957
409 Ga0495609_0015905
410 Ga0495609_0028260
411 Ga0495609_0057858
412 Ga0495597_0001773
413 Ga0495597_0002013
414 Ga0495597_0007545
415 Ga0495597_0010634
416 Ga0495597_0149848
417 Ga0495597_0239554
418 Ga0495622_0040755
419 Ga0495633_0005864
420 Ga0495633_0022458
421 Ga0495633_0059831
422 Ga0495633_0189516
423 Ga0495656_0046997
424 Ga0495668_0005938
425 Ga0495668_0006670
426 Ga0495668_0007992
427 Ga0495668_0016253
428 Ga0495668_0017899
429 Ga0495668_0027493
430 Ga0495668_0042432
431 Ga0495668_0092217
432 Ga0495668_0136153
433 Ga0495668_0192068
434 Ga0495668_0350425
435 Ga0495611_0001165
436 Ga0495611_0002506
437 Ga0495611_0015111
438 Ga0495611_0044439
439 Ga0495611_0111506
440 Ga0495625_0031228
441 Ga0495625_0037530
442 Ga0495625_0043834
443 Ga0495625_0142644
444 Ga0495635_0034272
445 Ga0495661_0001306
446 Ga0495661_0002699
447 Ga0495661_0010336
448 Ga0495661_0011190
449 Ga0495661_0012907
450 Ga0495661_0022391
451 Ga0495661_0036406
452 Ga0495661_0070129
453 Ga0495661_0084704
454 Ga0495661_0086410
455 Ga0495661_0123431
456 Ga0495661_0220326
457 Ga0495588_0004738
458 Ga0495588_0022391
459 Ga0495588_0029889
460 Ga0495588_0067151
461 Ga0495588_0109266
462 Ga0495669_0000095
463 Ga0495669_0004830
464 Ga0495669_0021862
465 Ga0495669_0042059
466 Ga0495613_0053461
467 Ga0495613_0105277
468 Ga0495624_0086090
469 Ga0495670_0001130
470 Ga0495670_0007180
471 Ga0495670_0044256
472 Ga0495670_0068806
473 Ga0495670_0118816
474 Ga0495671_0000718
475 Ga0495671_0003539
476 Ga0495671_0004436
477 Ga0495671_0127821
478 Ga0495649_0000648
479 Ga0495649_0021192
480 Ga0495589_0000266
481 Ga0495589_0021499
482 Ga0495589_0028351
483 Ga0495589_0050728
484 Ga0495589_0055424
485 Ga0495589_0063289
486 Ga0495660_0003500
487 Ga0495660_0019652
488 Ga0495660_0027525
489 Ga0495660_0208134
490 Ga0495604_0050924
491 Ga0495672_0001291
492 Ga0495672_0002747
493 Ga0495672_0013539
494 Ga0495672_0102478
495 Ga0495676_0000135
496 Ga0495680_0011297
497 Ga0495683_0000330
498 Ga0495683_0002039
499 Ga0495683_0042974
500 Ga0495683_0067050
501 Ga0495683_0114951
502 Ga0495687_004606
503 Ga0495687_122510
504 Ga0495675_0088963
505 Ga0495677_0002469
506 Ga0495677_0003116
507 Ga0495677_0010670
508 Ga0495677_0019366
509 Ga0495677_0100080
510 Ga0495677_0178583
511 Ga0495679_009610
512 Ga0495679_011595
513 Ga0495679_021282
514 Ga0495685_021485
515 Ga0495681_0000317
516 Ga0495681_0001145
517 Ga0495681_0002124
518 Ga0495681_0016508
519 Ga0495681_0018665
520 Ga0495681_0026042
521 Ga0495681_0104313
522 Ga0495681_0107008
523 Ga0495686_0002300
524 Ga0495686_0059644
525 Ga0495686_0078845
526 Ga0495593_0010408
527 Ga0495614_0003589
528 Ga0495626_0002032
529 Ga0495626_0007143
530 Ga0495626_0007469
531 Ga0495626_0015777
532 Ga0495626_0019817
533 Ga0495626_0035420
534 Ga0495626_0061760
535 Ga0496100_0072820
536 Ga0496101_0592506
537 Ga0496102_0000849
538 Ga0496103_0207104
539 Ga0496106_0838394
540 Ga0496108_0555378
541 Ga0496109_0057630
542 Ga0496110_0113144
543 Ga0496111_0183432
544 Ga0496113_0014975
545 Ga0496115_0131859
546 Ga0496121_0201839
547 Ga0496122_0003500
548 Ga0496122_0203052
549 Ga0496123_0001889
550 Ga0496124_0133659
551 Ga0496124_0236994
552 Ga0496125_0019312
553 Ga0495678_000264
554 Ga0495678_002431
555 Ga0495678_004801
556 Ga0495682_0000262
557 Ga0495682_0003425
558 Ga0495682_0043081

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14317

YcxB

YcxB-like protein

186

244

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bgf-assembly3.cif.gz_C the 3d-structure of arylamine-n-acetyltransferase from m. tuberculosis 0.8525 132 153
4bgf-assembly6.cif.gz_F the 3d-structure of arylamine-n-acetyltransferase from m. tuberculosis 0.8384 132 153
7x1x-assembly1.cif.gz_B crystal structure of cis-4,5-dihydrodiol phthalate dehydrogenase in complex with nad+ 0.8006 132 153
7w74-assembly2.cif.gz_B crystal structure of dtg rhodopsin from pseudomonas putida 0.7752 62 120
5ah2-assembly1.cif.gz_D the sliding clamp of mycobacterium smegmatis in complex with a natural product. 0.7688 130 153
ID Description Score Start End Superfamily
af_P9WJI5_3_255_3.90.1170.20 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Quinolinate phosphoribosyl transferase, N-terminal domain 0.8757 132 153 3.90.1170.20
4tr8A02 Alpha Beta;Roll;DNA Polymerase III; Chain A, domain 2;DNA Polymerase III, subunit A, domain 2 0.835 130 153 3.10.150.10
4c5pA01 Alpha Beta;2-Layer Sandwich;Arylamine N-acetyltransferase fold;Arylamine N-acetyltransferase 0.8337 132 153 3.30.2140.10
af_O17231_1_185_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.7513 129 153 3.80.10.10
af_Q4D9X7_16_163_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.7474 130 195 2.60.40.150
ID Description Score Start End GO Terms
AF-A0A2S8GXN2-F1-model_v4 deleted 0.8033 16 199
AF-A0A542LNP1-F1-model_v4 YcxB-like protein 0.7975 1 205 GO:0016020
AF-A0A1H7ITT7-F1-model_v4 YcxB-like protein 0.7943 30 201
AF-A0A542LNP1-F1-model_v4 YcxB-like protein 0.794 1 205 GO:0016020
AF-A0A7Z2VU39-F1-model_v4 YcxB family protein 0.7875 1 198 GO:0016020

Map