F382936

General Info

Members Datasets Scaffolds Average Seq Length
279 169 558 172

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100491731|Ga0068859_1004917313
Length 179
Sequence MSPLTTVTTDQLKQKIRHVPDFPKPGILFYDVTTLLRDAAGFHAAIEHLAQPFHGQHIDLVVGIESRGFIFGAAVADRIGAGFIPVRKPGKLPYTTIKASYALEYGTDALEMHDDGIVKGERVLIVDDLLATGGTARATVDLVKQLGGEVHALALLIELVALNGRERLAGENIHTVLKY

Samples

Sample ID Description Type Environment
1 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
114 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
115 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
119 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
120 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
149 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
150 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
153 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
156 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
157 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
158 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
159 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
160 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
161 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
167 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.96
Nodule 0
Rhizoplane 7.53
Rhizosphere 83.51
Stem 0
Stem Tuber 0
Unclassified 4.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068859_100491731 3300005617 Bacteria 1322
2 Ga0065712_10008199 3300005290 Bacteria 2765
3 Ga0065712_10029842 3300005290 Bacteria 1495
4 Ga0065712_10156189 3300005290 Bacteria 1333
5 Ga0065715_10038915 3300005293 Unclassified 1079
6 Ga0065715_10291448 3300005293 Bacteria 1062
7 Ga0070676_10312394 3300005328 Bacteria 1069
8 Ga0070683_100014940 3300005329 Bacteria 6808
9 Ga0070690_100305957 3300005330 Bacteria 1141
10 Ga0070670_100030959 3300005331 Bacteria 4608
11 Ga0068869_100341813 3300005334 Bacteria 1218
12 Ga0070680_100088253 3300005336 Unclassified 2565
13 Ga0070680_101019658 3300005336 Unclassified 715
14 Ga0068868_100052932 3300005338 Bacteria 3197
15 Ga0070660_100014656 3300005339 Bacteria 5655
16 Ga0070660_100379871 3300005339 Bacteria 1166
17 Ga0070691_10140652 3300005341 Bacteria 1230
18 Ga0070692_10171037 3300005345 Bacteria 1252
19 Ga0070668_100315856 3300005347 Bacteria 1314
20 Ga0070669_100051469 3300005353 Bacteria 3010
21 Ga0070669_100448752 3300005353 Bacteria 1063
22 Ga0070675_100363367 3300005354 Bacteria 1286
23 Ga0070671_100344706 3300005355 Bacteria 1271
24 Ga0070674_100054813 3300005356 Bacteria 2758
25 Ga0070673_100141990 3300005364 Bacteria 2026
26 Ga0070659_100017543 3300005366 Bacteria 5392
27 Ga0070659_100054103 3300005366 Bacteria 3161
28 Ga0070659_100140839 3300005366 Bacteria 1963
29 Ga0070713_100129612 3300005436 Bacteria 2223
30 Ga0070711_100466210 3300005439 Bacteria 1036
31 Ga0070700_100098135 3300005441 Bacteria 1925
32 Ga0070694_100100612 3300005444 Bacteria 2045
33 Ga0070663_100930972 3300005455 Bacteria 752
34 Ga0070678_100122421 3300005456 Bacteria 2053
35 Ga0070681_10016359 3300005458 Bacteria 7403
36 Ga0068867_100049704 3300005459 Bacteria 3088
37 Ga0070706_100201674 3300005467 Bacteria 1858
38 Ga0070699_100202156 3300005518 Bacteria 1767
39 Ga0070697_100835319 3300005536 Bacteria 816
40 Ga0070672_100253072 3300005543 Bacteria 1484
41 Ga0070686_100082454 3300005544 Bacteria 2133
42 Ga0070686_100312789 3300005544 Bacteria 1168
43 Ga0070696_100147879 3300005546 Bacteria 1722
44 Ga0070693_100079446 3300005547 Bacteria 1952
45 Ga0070665_100036743 3300005548 Bacteria 4925
46 Ga0070704_100099016 3300005549 Bacteria 2192
47 Ga0068855_102132775 3300005563 Bacteria 564
48 Ga0068854_100340226 3300005578 Bacteria 1225
49 Ga0068854_100441817 3300005578 Bacteria 1084
50 Ga0070702_100272727 3300005615 Bacteria 1157
51 Ga0068859_100118958 3300005617 Bacteria 2708
52 Ga0068859_100620779 3300005617 Bacteria 1174
53 Ga0068859_101671682 3300005617 Bacteria 703
54 Ga0068866_10161627 3300005718 Bacteria 1306
55 Ga0068860_100380242 3300005843 Bacteria 1394
56 Ga0068860_100483273 3300005843 Bacteria 1235
57 Ga0075365_10033933 3300006038 Bacteria 3293
58 Ga0075365_10150890 3300006038 Bacteria 1616
59 Ga0075368_10009298 3300006042 Bacteria 3532
60 Ga0075363_100014165 3300006048 Bacteria 3888
61 Ga0075364_10001287 3300006051 Bacteria 13513
62 Ga0075364_10002057 3300006051 Bacteria 11229
63 Ga0075364_10097404 3300006051 Bacteria 1956
64 Ga0070715_10346552 3300006163 Bacteria 810
65 Ga0075362_10000973 3300006177 Bacteria 8756
66 Ga0075366_10055776 3300006195 Bacteria 2347
67 Ga0075366_10083937 3300006195 Bacteria 1904
68 Ga0097621_100004952 3300006237 Bacteria 9338
69 Ga0097621_100039119 3300006237 Bacteria 3808
70 Ga0075370_10012733 3300006353 Bacteria 4453
71 Ga0068871_100006973 3300006358 Bacteria 8050
72 Ga0068871_100084601 3300006358 Bacteria 2632
73 Ga0068871_100347664 3300006358 Bacteria 1311
74 Ga0068871_100778117 3300006358 Bacteria 881
75 Ga0075428_100009056 3300006844 Bacteria 11045
76 Ga0075430_100003981 3300006846 Bacteria 12460
77 Ga0075431_100050370 3300006847 Bacteria 4294
78 Ga0075431_100096046 3300006847 Bacteria 3060
79 Ga0075431_100562684 3300006847 Bacteria 1127
80 Ga0075431_100845497 3300006847 Bacteria 887
81 Ga0075433_10068280 3300006852 Bacteria 3121
82 Ga0075433_10168373 3300006852 Unclassified 1950
83 Ga0075434_100649805 3300006871 Bacteria 1073
84 Ga0075434_101095102 3300006871 Bacteria 810
85 Ga0075429_100019446 3300006880 Bacteria 5883
86 Ga0068865_100001335 3300006881 Bacteria 14362
87 Ga0068865_100333304 3300006881 Bacteria 1224
88 Ga0097620_100118960 3300006931 Bacteria 2708
89 Ga0097620_100491829 3300006931 Bacteria 1322
90 Ga0097620_100620746 3300006931 Bacteria 1174
91 Ga0097620_101671916 3300006931 Bacteria 703
92 Ga0075435_100114216 3300007076 Unclassified 2248
93 Ga0075435_100116301 3300007076 Bacteria 2228
94 Ga0111539_10734022 3300009094 Bacteria 1150
95 Ga0111539_11189842 3300009094 Bacteria 885
96 Ga0105245_10001420 3300009098 Bacteria 21730
97 Ga0114129_10006244 3300009147 Bacteria 16894
98 Ga0114129_10006515 3300009147 Bacteria 16567
99 Ga0114129_10045859 3300009147 Bacteria 6144
100 Ga0114129_10047034 3300009147 Bacteria 6064
101 Ga0114129_10279738 3300009147 Bacteria 2230
102 Ga0114129_10338346 3300009147 Bacteria 1997
103 Ga0105243_10176639 3300009148 Bacteria 1854
104 Ga0105243_10508753 3300009148 Bacteria 1143
105 Ga0105241_10078991 3300009174 Bacteria 2572
106 Ga0105242_10003457 3300009176 Bacteria 12283
107 Ga0105242_10352087 3300009176 Bacteria 1360
108 Ga0105248_10086193 3300009177 Bacteria 3534
109 Ga0105248_10100161 3300009177 Bacteria 3265
110 Ga0105248_10178259 3300009177 Bacteria 2395
111 Ga0105248_10780651 3300009177 Bacteria 1078
112 Ga0105238_10040885 3300009551 Bacteria 4697
113 Ga0105249_10048098 3300009553 Bacteria 3889
114 Ga0105249_10132227 3300009553 Bacteria 2383
115 Ga0105249_10326592 3300009553 Unclassified 1547
116 Ga0105249_10653301 3300009553 Bacteria 1109
117 Ga0105249_10879889 3300009553 Bacteria 962
118 Ga0157378_10059169 3300013297 Bacteria 3418
119 Ga0157375_10266706 3300013308 Bacteria 1874
120 Ga0163163_10708019 3300014325 Bacteria 1070
121 Ga0163163_11326924 3300014325 Bacteria 781
122 Ga0157380_10106922 3300014326 Bacteria 2342
123 Ga0157380_10473192 3300014326 Bacteria 1210
124 Ga0157376_10047228 3300014969 Bacteria 3553
125 Ga0207682_10451786 3300025893 Bacteria 608
126 Ga0207642_10181873 3300025899 Bacteria 1146
127 Ga0207685_10024889 3300025905 Bacteria 2059
128 Ga0207685_10237970 3300025905 Bacteria 874
129 Ga0207645_10001201 3300025907 Bacteria 21361
130 Ga0207645_10373630 3300025907 Bacteria 956
131 Ga0207684_10367045 3300025910 Bacteria 1239
132 Ga0207654_10113612 3300025911 Bacteria 1689
133 Ga0207707_10012279 3300025912 Bacteria 7446
134 Ga0207660_10148149 3300025917 Bacteria 1801
135 Ga0207657_10071298 3300025919 Unclassified 2942
136 Ga0207657_10073340 3300025919 Bacteria 2893
137 Ga0207694_10303607 3300025924 Bacteria 1315
138 Ga0207650_10023912 3300025925 Bacteria 4338
139 Ga0207659_10168756 3300025926 Bacteria 1725
140 Ga0207687_10040316 3300025927 Bacteria 3201
141 Ga0207700_10101779 3300025928 Bacteria 2293
142 Ga0207690_10010928 3300025932 Bacteria 5413
143 Ga0207690_10077995 3300025932 Bacteria 2304
144 Ga0207690_10274922 3300025932 Bacteria 1310
145 Ga0207686_10041317 3300025934 Bacteria 2811
146 Ga0207669_10042675 3300025937 Bacteria 2650
147 Ga0207669_10638067 3300025937 Bacteria 870
148 Ga0207704_10506056 3300025938 Bacteria 974
149 Ga0207704_10896541 3300025938 Unclassified 745
150 Ga0207711_10025355 3300025941 Bacteria 4974
151 Ga0207711_10567332 3300025941 Bacteria 1059
152 Ga0207711_10791102 3300025941 Bacteria 883
153 Ga0207689_10573136 3300025942 Bacteria 949
154 Ga0207661_10043606 3300025944 Bacteria 3541
155 Ga0207661_10220665 3300025944 Bacteria 1676
156 Ga0207651_10156160 3300025960 Bacteria 1783
157 Ga0207651_10705124 3300025960 Bacteria 889
158 Ga0207712_10653873 3300025961 Bacteria 914
159 Ga0207712_11555300 3300025961 Bacteria 593
160 Ga0207668_10413151 3300025972 Bacteria 1144
161 Ga0207640_10307360 3300025981 Bacteria 1257
162 Ga0207677_10066069 3300026023 Bacteria 2527
163 Ga0207678_10497369 3300026067 Bacteria 1063
164 Ga0207708_10002590 3300026075 Bacteria 13313
165 Ga0207648_10005374 3300026089 Bacteria 12912
166 Ga0207648_10212872 3300026089 Bacteria 1716
167 Ga0207675_100029770 3300026118 Bacteria 5084
168 Ga0207675_100220941 3300026118 Bacteria 1825
169 Ga0207675_100867732 3300026118 Bacteria 918
170 Ga0207675_101688992 3300026118 Bacteria 653
171 Ga0207683_10073686 3300026121 Bacteria 3020
172 Ga0209813_10118955 3300027866 Bacteria 918
173 Ga0268266_10070748 3300028379 Bacteria 3023
174 Ga0268264_10993622 3300028381 Bacteria 845
175 Ga0307409_100328085 3300031995 Bacteria 1435
176 Ga0307415_100284165 3300032126 Bacteria 1362
177 Ga0373936_0146417 3300035113 Bacteria 1022
178 Ga0373946_0615219 3300035171 Bacteria 564
179 Ga0373955_0189414 3300035172 Bacteria 1223
180 Ga0373947_0082114 3300035725 Bacteria 1997
181 Ga0373947_1083583 3300035725 Bacteria 546
182 Ga0373937_0003095 3300036401 Bacteria 13915
183 Ga0373937_0653893 3300036401 Bacteria 997
184 Ga0373925_0006484 3300037068 Bacteria 8607
185 Ga0495644_0235860 3300046523 Bacteria 709
186 Ga0495647_0167863 3300046681 Bacteria 949
187 Ga0495658_0073640 3300046683 Bacteria 1989
188 Ga0496100_0012271 3300048903 Bacteria 4907
189 Ga0496100_0124226 3300048903 Bacteria 1810
190 Ga0496101_0002864 3300048904 Bacteria 10603
191 Ga0496101_1064873 3300048904 Bacteria 635
192 Ga0496102_0342414 3300048905 Bacteria 1408
193 Ga0496102_0368686 3300048905 Bacteria 1352
194 Ga0496104_0024964 3300048907 Bacteria 5505
195 Ga0496104_0051873 3300048907 Bacteria 3873
196 Ga0496104_0352202 3300048907 Unclassified 1385
197 Ga0496104_0807813 3300048907 Unclassified 844
198 Ga0496105_0122389 3300048908 Bacteria 2145
199 Ga0496105_0499740 3300048908 Bacteria 955
200 Ga0496106_0566196 3300048909 Bacteria 911
201 Ga0496107_0054016 3300048910 Bacteria 2899
202 Ga0496107_0510525 3300048910 Bacteria 891
203 Ga0496108_0111097 3300048911 Bacteria 2344
204 Ga0496110_0235159 3300048913 Bacteria 1667
205 Ga0496111_0108583 3300048914 Bacteria 2043
206 Ga0496112_0058256 3300048915 Unclassified 3804
207 Ga0496114_0000373 3300048917 Bacteria 33059
208 Ga0496115_0466473 3300048918 Bacteria 1018
209 Ga0501031_0073090 3300049568 Bacteria 2233
210 Ga0501034_0170676 3300049571 Bacteria 2142
211 Ga0501034_0177825 3300049571 Bacteria 2093
212 Ga0501034_0213288 3300049571 Bacteria 1885
213 Ga0501036_0007207 3300049572 Bacteria 9056
214 Ga0501036_0931560 3300049572 Bacteria 712
215 Ga0501037_0094994 3300049573 Bacteria 2155
216 Ga0501038_0103664 3300049574 Bacteria 2365
217 Ga0501038_0630877 3300049574 Bacteria 808
218 Ga0501039_0085919 3300049575 Bacteria 2450
219 Ga0501041_0074252 3300049577 Bacteria 2089
220 Ga0501042_0208299 3300049578 Bacteria 1410
221 Ga0501043_0002834 3300049579 Bacteria 14496
222 Ga0501046_1119229 3300049580 Bacteria 543
223 Ga0501047_0000902 3300049581 Bacteria 30295
224 Ga0501047_0006103 3300049581 Bacteria 11324
225 Ga0501047_0572689 3300049581 Bacteria 952
226 Ga0501048_0064449 3300049582 Bacteria 2592
227 Ga0501068_0090314 3300049584 Bacteria 1889
228 Ga0501068_0174733 3300049584 Bacteria 1357
229 Ga0501073_0106417 3300049589 Bacteria 1946
230 Ga0501073_0231848 3300049589 Bacteria 1275
231 Ga0501073_0341891 3300049589 Bacteria 1033
232 Ga0501075_0128777 3300049591 Bacteria 1928
233 Ga0501075_1239625 3300049591 Bacteria 566
234 Ga0501077_0114101 3300049593 Bacteria 1713
235 Ga0501077_0254436 3300049593 Bacteria 1117
236 Ga0501079_0119552 3300049741 Bacteria 2049
237 Ga0501080_0076205 3300049742 Bacteria 3119
238 Ga0501080_0272452 3300049742 Bacteria 1540
239 Ga0501081_0047560 3300049743 Bacteria 2951
240 Ga0501083_0000224 3300049744 Bacteria 36571
241 Ga0501083_0019366 3300049744 Bacteria 4741
242 Ga0501035_0081357 3300049822 Bacteria 2858
243 Ga0501045_0101865 3300049824 Bacteria 2126
244 nmdc:mga03683_285_c1 3300050489 Bacteria 15049
245 nmdc:mga03n38_64265_c1 3300050490 Bacteria 1679
246 nmdc:mga00v17_2652_c1 3300050491 Bacteria 9173
247 nmdc:mga00v17_32827_c1 3300050491 Bacteria 3071
248 nmdc:mga00v17_71954_c1 3300050491 Bacteria 2144
249 nmdc:mga0yw44_75513_c1 3300050492 Bacteria 2101
250 nmdc:mga0yw44_83728_c1 3300050492 Bacteria 2004
251 nmdc:mga0k408_129446_c1 3300050493 Bacteria 1498
252 nmdc:mga0k408_13527_c1 3300050493 Bacteria 4478
253 nmdc:mga0k408_216466_c1 3300050493 Bacteria 1144
254 nmdc:mga0k408_574456_c1 3300050493 Bacteria 666
255 nmdc:mga06z11_537221_c1 3300050494 Bacteria 709
256 nmdc:mga06z11_79051_c1 3300050494 Bacteria 1760
257 nmdc:mga05p37_1218897_c1 3300050507 Bacteria 775
258 nmdc:mga05p37_127535_c1 3300050507 Bacteria 3124
259 nmdc:mga05p37_1610686_c1 3300050507 Bacteria 639
260 nmdc:mga05p37_2007_c1 3300050507 Bacteria 23766
261 nmdc:mga05p37_386521_c1 3300050507 Bacteria 1638
262 nmdc:mga05p37_5836_c1 3300050507 Bacteria 14478
263 nmdc:mga05p37_87581_c1 3300050507 Bacteria 3838
264 nmdc:mga05p37_878699_c1 3300050507 Bacteria 970
265 nmdc:mga09592_354323_c1 3300050508 Bacteria 1270
266 nmdc:mga06r32_112155_c1 3300050510 Bacteria 2684
267 nmdc:mga06r32_276941_c1 3300050510 Bacteria 1665
268 nmdc:mga06r32_541127_c1 3300050510 Bacteria 1139
269 nmdc:mga06r32_94943_c1 3300050510 Bacteria 2918
270 nmdc:mga08y16_942124_c1 3300050511 Bacteria 847
271 nmdc:mga0rr50_1526255_c1 3300050513 Bacteria 564
272 nmdc:mga0rr50_450445_c1 3300050513 Bacteria 1091
273 nmdc:mga0a205_174067_c1 3300050515 Unclassified 2048
274 nmdc:mga0a205_327502_c1 3300050515 Bacteria 1402
275 Ga0501084_0000621 3300054114 Bacteria 27026
276 Ga0501084_0217337 3300054114 Bacteria 1613
277 Ga0501084_0381958 3300054114 Bacteria 1190
278 Ga0501082_0180643 3300060353 Bacteria 1835
279 Ga0501082_0362725 3300060353 Bacteria 1264
280 Ga0068859_100491731
281 Ga0065712_10008199
282 Ga0065712_10029842
283 Ga0065712_10156189
284 Ga0065715_10038915
285 Ga0065715_10291448
286 Ga0070676_10312394
287 Ga0070683_100014940
288 Ga0070690_100305957
289 Ga0070670_100030959
290 Ga0068869_100341813
291 Ga0070680_100088253
292 Ga0070680_101019658
293 Ga0068868_100052932
294 Ga0070660_100014656
295 Ga0070660_100379871
296 Ga0070691_10140652
297 Ga0070692_10171037
298 Ga0070668_100315856
299 Ga0070669_100051469
300 Ga0070669_100448752
301 Ga0070675_100363367
302 Ga0070671_100344706
303 Ga0070674_100054813
304 Ga0070673_100141990
305 Ga0070659_100017543
306 Ga0070659_100054103
307 Ga0070659_100140839
308 Ga0070713_100129612
309 Ga0070711_100466210
310 Ga0070700_100098135
311 Ga0070694_100100612
312 Ga0070663_100930972
313 Ga0070678_100122421
314 Ga0070681_10016359
315 Ga0068867_100049704
316 Ga0070706_100201674
317 Ga0070699_100202156
318 Ga0070697_100835319
319 Ga0070672_100253072
320 Ga0070686_100082454
321 Ga0070686_100312789
322 Ga0070696_100147879
323 Ga0070693_100079446
324 Ga0070665_100036743
325 Ga0070704_100099016
326 Ga0068855_102132775
327 Ga0068854_100340226
328 Ga0068854_100441817
329 Ga0070702_100272727
330 Ga0068859_100118958
331 Ga0068859_100620779
332 Ga0068859_101671682
333 Ga0068866_10161627
334 Ga0068860_100380242
335 Ga0068860_100483273
336 Ga0075365_10033933
337 Ga0075365_10150890
338 Ga0075368_10009298
339 Ga0075363_100014165
340 Ga0075364_10001287
341 Ga0075364_10002057
342 Ga0075364_10097404
343 Ga0070715_10346552
344 Ga0075362_10000973
345 Ga0075366_10055776
346 Ga0075366_10083937
347 Ga0097621_100004952
348 Ga0097621_100039119
349 Ga0075370_10012733
350 Ga0068871_100006973
351 Ga0068871_100084601
352 Ga0068871_100347664
353 Ga0068871_100778117
354 Ga0075428_100009056
355 Ga0075430_100003981
356 Ga0075431_100050370
357 Ga0075431_100096046
358 Ga0075431_100562684
359 Ga0075431_100845497
360 Ga0075433_10068280
361 Ga0075433_10168373
362 Ga0075434_100649805
363 Ga0075434_101095102
364 Ga0075429_100019446
365 Ga0068865_100001335
366 Ga0068865_100333304
367 Ga0097620_100118960
368 Ga0097620_100491829
369 Ga0097620_100620746
370 Ga0097620_101671916
371 Ga0075435_100114216
372 Ga0075435_100116301
373 Ga0111539_10734022
374 Ga0111539_11189842
375 Ga0105245_10001420
376 Ga0114129_10006244
377 Ga0114129_10006515
378 Ga0114129_10045859
379 Ga0114129_10047034
380 Ga0114129_10279738
381 Ga0114129_10338346
382 Ga0105243_10176639
383 Ga0105243_10508753
384 Ga0105241_10078991
385 Ga0105242_10003457
386 Ga0105242_10352087
387 Ga0105248_10086193
388 Ga0105248_10100161
389 Ga0105248_10178259
390 Ga0105248_10780651
391 Ga0105238_10040885
392 Ga0105249_10048098
393 Ga0105249_10132227
394 Ga0105249_10326592
395 Ga0105249_10653301
396 Ga0105249_10879889
397 Ga0157378_10059169
398 Ga0157375_10266706
399 Ga0163163_10708019
400 Ga0163163_11326924
401 Ga0157380_10106922
402 Ga0157380_10473192
403 Ga0157376_10047228
404 Ga0207682_10451786
405 Ga0207642_10181873
406 Ga0207685_10024889
407 Ga0207685_10237970
408 Ga0207645_10001201
409 Ga0207645_10373630
410 Ga0207684_10367045
411 Ga0207654_10113612
412 Ga0207707_10012279
413 Ga0207660_10148149
414 Ga0207657_10071298
415 Ga0207657_10073340
416 Ga0207694_10303607
417 Ga0207650_10023912
418 Ga0207659_10168756
419 Ga0207687_10040316
420 Ga0207700_10101779
421 Ga0207690_10010928
422 Ga0207690_10077995
423 Ga0207690_10274922
424 Ga0207686_10041317
425 Ga0207669_10042675
426 Ga0207669_10638067
427 Ga0207704_10506056
428 Ga0207704_10896541
429 Ga0207711_10025355
430 Ga0207711_10567332
431 Ga0207711_10791102
432 Ga0207689_10573136
433 Ga0207661_10043606
434 Ga0207661_10220665
435 Ga0207651_10156160
436 Ga0207651_10705124
437 Ga0207712_10653873
438 Ga0207712_11555300
439 Ga0207668_10413151
440 Ga0207640_10307360
441 Ga0207677_10066069
442 Ga0207678_10497369
443 Ga0207708_10002590
444 Ga0207648_10005374
445 Ga0207648_10212872
446 Ga0207675_100029770
447 Ga0207675_100220941
448 Ga0207675_100867732
449 Ga0207675_101688992
450 Ga0207683_10073686
451 Ga0209813_10118955
452 Ga0268266_10070748
453 Ga0268264_10993622
454 Ga0307409_100328085
455 Ga0307415_100284165
456 Ga0373936_0146417
457 Ga0373946_0615219
458 Ga0373955_0189414
459 Ga0373947_0082114
460 Ga0373947_1083583
461 Ga0373937_0003095
462 Ga0373937_0653893
463 Ga0373925_0006484
464 Ga0495644_0235860
465 Ga0495647_0167863
466 Ga0495658_0073640
467 Ga0496100_0012271
468 Ga0496100_0124226
469 Ga0496101_0002864
470 Ga0496101_1064873
471 Ga0496102_0342414
472 Ga0496102_0368686
473 Ga0496104_0024964
474 Ga0496104_0051873
475 Ga0496104_0352202
476 Ga0496104_0807813
477 Ga0496105_0122389
478 Ga0496105_0499740
479 Ga0496106_0566196
480 Ga0496107_0054016
481 Ga0496107_0510525
482 Ga0496108_0111097
483 Ga0496110_0235159
484 Ga0496111_0108583
485 Ga0496112_0058256
486 Ga0496114_0000373
487 Ga0496115_0466473
488 Ga0501031_0073090
489 Ga0501034_0170676
490 Ga0501034_0177825
491 Ga0501034_0213288
492 Ga0501036_0007207
493 Ga0501036_0931560
494 Ga0501037_0094994
495 Ga0501038_0103664
496 Ga0501038_0630877
497 Ga0501039_0085919
498 Ga0501041_0074252
499 Ga0501042_0208299
500 Ga0501043_0002834
501 Ga0501046_1119229
502 Ga0501047_0000902
503 Ga0501047_0006103
504 Ga0501047_0572689
505 Ga0501048_0064449
506 Ga0501068_0090314
507 Ga0501068_0174733
508 Ga0501073_0106417
509 Ga0501073_0231848
510 Ga0501073_0341891
511 Ga0501075_0128777
512 Ga0501075_1239625
513 Ga0501077_0114101
514 Ga0501077_0254436
515 Ga0501079_0119552
516 Ga0501080_0076205
517 Ga0501080_0272452
518 Ga0501081_0047560
519 Ga0501083_0000224
520 Ga0501083_0019366
521 Ga0501035_0081357
522 Ga0501045_0101865
523 nmdc:mga03683_285_c1
524 nmdc:mga03n38_64265_c1
525 nmdc:mga00v17_2652_c1
526 nmdc:mga00v17_32827_c1
527 nmdc:mga00v17_71954_c1
528 nmdc:mga0yw44_75513_c1
529 nmdc:mga0yw44_83728_c1
530 nmdc:mga0k408_129446_c1
531 nmdc:mga0k408_13527_c1
532 nmdc:mga0k408_216466_c1
533 nmdc:mga0k408_574456_c1
534 nmdc:mga06z11_537221_c1
535 nmdc:mga06z11_79051_c1
536 nmdc:mga05p37_1218897_c1
537 nmdc:mga05p37_127535_c1
538 nmdc:mga05p37_1610686_c1
539 nmdc:mga05p37_2007_c1
540 nmdc:mga05p37_386521_c1
541 nmdc:mga05p37_5836_c1
542 nmdc:mga05p37_87581_c1
543 nmdc:mga05p37_878699_c1
544 nmdc:mga09592_354323_c1
545 nmdc:mga06r32_112155_c1
546 nmdc:mga06r32_276941_c1
547 nmdc:mga06r32_541127_c1
548 nmdc:mga06r32_94943_c1
549 nmdc:mga08y16_942124_c1
550 nmdc:mga0rr50_1526255_c1
551 nmdc:mga0rr50_450445_c1
552 nmdc:mga0a205_174067_c1
553 nmdc:mga0a205_327502_c1
554 Ga0501084_0000621
555 Ga0501084_0217337
556 Ga0501084_0381958
557 Ga0501082_0180643
558 Ga0501082_0362725

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

33

172

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lza-assembly1.cif.gz_B crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. 0.9759 6 176
4m0k-assembly2.cif.gz_D crystal structure of adenine phosphoribosyltransferase from rhodothermus marinus dsm 4252, nysgrc target 029775. 0.9702 2 176
4lza-assembly1.cif.gz_A crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. 0.9687 7 176
4lza-assembly1.cif.gz_B crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. 0.9648 6 176
6fd6-assembly1.cif.gz_B crystal structure of human aprt-tyr105phe variant in complex with adenine, prpp and mg2+, 30 days post crystallization (with amp and ppi products fully generated) 0.9581 4 176
ID Description Score Start End Superfamily
af_P69503_1_183_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9725 1 176 3.40.50.2020
af_P69503_1_183_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9671 1 176 3.40.50.2020
4m0kC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9627 2 176 3.40.50.2020
4m0kC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9573 2 176 3.40.50.2020
af_A0A0P0WCD3_31_176_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9566 1 139 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A849EMC6-F1-model_v4 adenine phosphoribosyltransferase (EC 2.4.2.7) 0.9984 72 176 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-A0A1F2VH06-F1-model_v4 Adenine phosphoribosyltransferase (APRT) (EC 2.4.2.7) 0.9952 9 176 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-A0A1F2UC55-F1-model_v4 Adenine phosphoribosyltransferase (APRT) (EC 2.4.2.7) 0.9951 9 176 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-A0A829HBD2-F1-model_v4 adenine phosphoribosyltransferase (EC 2.4.2.7) 0.9939 109 176 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0006520
GO:0016208
GO:0044209
AF-A0A645FSY4-F1-model_v4 adenine phosphoribosyltransferase (EC 2.4.2.7) 0.9938 109 176 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209

Map