F382926

General Info

Members Datasets Scaffolds Average Seq Length
279 185 558 113

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100353981|Ga0070665_1003539812
Length 127
Sequence MYGYPIGGDLGDKDKADKTDVWQGTLALMVLKTLQAMGPLHGYGIARRIEQISGGELSVNYGTLYPALLKLEQEGYVAAAWGVSDNNRRAKFYRLTRAGRRHVLRETGEWRRTTAILARFLAVEGEP

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
80 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
123 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
133 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
134 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
136 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
137 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
138 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
139 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
147 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
148 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
149 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
150 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
155 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
156 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
159 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
167 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
168 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
169 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
170 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
171 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
172 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
181 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
184 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
185 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.57
Metatranscriptomes 1.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.72
Nodule 0
Rhizoplane 2.51
Rhizosphere 96.42
Stem 0
Stem Tuber 0
Unclassified 18.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100353981 3300005548 Bacteria 1474
2 Ga0058862_10246821 3300004803 Unclassified 571
3 Ga0065704_10437372 3300005289 Unclassified 717
4 Ga0065712_10259612 3300005290 Bacteria 940
5 Ga0065715_10035185 3300005293 Bacteria 1810
6 Ga0065715_10144364 3300005293 Bacteria 1808
7 Ga0065715_10353680 3300005293 Unclassified 947
8 Ga0070683_101051263 3300005329 Bacteria 782
9 Ga0070690_100060337 3300005330 Bacteria 2441
10 Ga0070670_100000897 3300005331 Bacteria 23457
11 Ga0070670_100065516 3300005331 Unclassified 3117
12 Ga0070670_100181154 3300005331 Bacteria 1829
13 Ga0070666_10015059 3300005335 Bacteria 4928
14 Ga0070680_100889567 3300005336 Bacteria 768
15 Ga0070680_101365139 3300005336 Bacteria 614
16 Ga0068868_100034429 3300005338 Bacteria 3910
17 Ga0070689_100223237 3300005340 Bacteria 1546
18 Ga0070689_101362587 3300005340 Bacteria 640
19 Ga0070661_100139287 3300005344 Bacteria 1828
20 Ga0070661_100431107 3300005344 Bacteria 1046
21 Ga0070675_100033875 3300005354 Bacteria 4142
22 Ga0070674_100425819 3300005356 Bacteria 1090
23 Ga0070674_101328643 3300005356 Unclassified 642
24 Ga0070688_100836784 3300005365 Bacteria 722
25 Ga0070667_100030299 3300005367 Bacteria 4511
26 Ga0070709_11470804 3300005434 Unclassified 553
27 Ga0070714_100234738 3300005435 Bacteria 1691
28 Ga0070713_101612067 3300005436 Bacteria 630
29 Ga0070701_10586975 3300005438 Bacteria 736
30 Ga0070701_10755388 3300005438 Bacteria 659
31 Ga0070711_100029197 3300005439 Unclassified 3637
32 Ga0070711_100382975 3300005439 Unclassified 1138
33 Ga0070700_100162230 3300005441 Bacteria 1540
34 Ga0070694_100551043 3300005444 Unclassified 923
35 Ga0070663_100572002 3300005455 Bacteria 947
36 Ga0070678_100001344 3300005456 Bacteria 13082
37 Ga0070678_100069035 3300005456 Bacteria 2637
38 Ga0070662_100126118 3300005457 Bacteria 1968
39 Ga0070662_100289266 3300005457 Bacteria 1328
40 Ga0070681_10065151 3300005458 Bacteria 3613
41 Ga0070681_11001211 3300005458 Bacteria 755
42 Ga0070681_11017708 3300005458 Bacteria 748
43 Ga0070706_101441173 3300005467 Unclassified 630
44 Ga0070706_102171447 3300005467 Bacteria 501
45 Ga0070707_100439056 3300005468 Unclassified 1266
46 Ga0070698_100079984 3300005471 Unclassified 3264
47 Ga0070699_100070060 3300005518 Bacteria 3048
48 Ga0070679_100054496 3300005530 Bacteria 3981
49 Ga0070697_100255251 3300005536 Bacteria 1500
50 Ga0068853_100864645 3300005539 Bacteria 868
51 Ga0070672_100494843 3300005543 Bacteria 1057
52 Ga0070695_100129090 3300005545 Bacteria 1740
53 Ga0070665_100056286 3300005548 Bacteria 3943
54 Ga0070665_101527958 3300005548 Bacteria 676
55 Ga0070704_100236453 3300005549 Unclassified 1493
56 Ga0068855_100070123 3300005563 Bacteria 4079
57 Ga0070664_100233166 3300005564 Bacteria 1650
58 Ga0070664_100970679 3300005564 Bacteria 798
59 Ga0068857_100152356 3300005577 Bacteria 2095
60 Ga0068857_101272426 3300005577 Bacteria 713
61 Ga0068864_100053380 3300005618 Bacteria 3486
62 Ga0068863_100063048 3300005841 Bacteria 3505
63 Ga0068858_100046473 3300005842 Bacteria 4024
64 Ga0068858_101396452 3300005842 Bacteria 690
65 Ga0068860_100836063 3300005843 Bacteria 935
66 Ga0081455_10364989 3300005937 Bacteria 1014
67 Ga0075432_10356696 3300006058 Bacteria 621
68 Ga0070715_10205530 3300006163 Bacteria 1003
69 Ga0070715_10746152 3300006163 Unclassified 589
70 Ga0070716_100183945 3300006173 Bacteria 1375
71 Ga0097621_100543788 3300006237 Unclassified 1056
72 Ga0068871_100123357 3300006358 Bacteria 2191
73 Ga0075428_100002692 3300006844 Bacteria 19327
74 Ga0075428_100007342 3300006844 Bacteria 12212
75 Ga0075428_100012933 3300006844 Bacteria 9282
76 Ga0075428_100019325 3300006844 Bacteria 7540
77 Ga0075428_100781922 3300006844 Bacteria 1015
78 Ga0075428_100952084 3300006844 Bacteria 910
79 Ga0075430_100009994 3300006846 Bacteria 8029
80 Ga0075430_100028148 3300006846 Bacteria 4774
81 Ga0075430_100055228 3300006846 Bacteria 3340
82 Ga0075431_100001899 3300006847 Bacteria 19823
83 Ga0075431_100050147 3300006847 Bacteria 4304
84 Ga0075431_100058722 3300006847 Bacteria 3970
85 Ga0075431_100071914 3300006847 Bacteria 3569
86 Ga0075431_100808148 3300006847 Unclassified 911
87 Ga0075431_101675667 3300006847 Unclassified 593
88 Ga0075433_10082703 3300006852 Bacteria 2832
89 Ga0075429_100000484 3300006880 Bacteria 29777
90 Ga0075429_100008621 3300006880 Bacteria 8868
91 Ga0075429_100022998 3300006880 Bacteria 5403
92 Ga0075429_100960819 3300006880 Bacteria 747
93 Ga0068865_100583163 3300006881 Bacteria 943
94 Ga0075435_100106519 3300007076 Bacteria 2328
95 Ga0075435_100122019 3300007076 Bacteria 2175
96 Ga0105251_10294398 3300009011 Unclassified 735
97 Ga0105240_10894938 3300009093 Bacteria 955
98 Ga0111539_10000204 3300009094 Bacteria 70002
99 Ga0111539_10068391 3300009094 Bacteria 4193
100 Ga0111539_10262513 3300009094 Bacteria 2010
101 Ga0114129_10000102 3300009147 Bacteria 84059
102 Ga0114129_10001187 3300009147 Bacteria 34607
103 Ga0114129_10007089 3300009147 Bacteria 15948
104 Ga0114129_10137466 3300009147 Bacteria 3352
105 Ga0114129_10147166 3300009147 Bacteria 3226
106 Ga0114129_10739447 3300009147 Bacteria 1260
107 Ga0105242_10861940 3300009176 Unclassified 902
108 Ga0105248_10015335 3300009177 Bacteria 8451
109 Ga0105248_10029279 3300009177 Bacteria 6143
110 Ga0105248_10223302 3300009177 Bacteria 2121
111 Ga0105248_10384541 3300009177 Bacteria 1580
112 Ga0105248_10464656 3300009177 Bacteria 1427
113 Ga0105248_10751606 3300009177 Bacteria 1100
114 Ga0105237_10685411 3300009545 Bacteria 1031
115 Ga0105238_10532512 3300009551 Bacteria 1178
116 Ga0157373_10427793 3300013100 Unclassified 951
117 Ga0157370_10054147 3300013104 Bacteria 3825
118 Ga0157369_10117833 3300013105 Bacteria 2819
119 Ga0157374_10001466 3300013296 Bacteria 19934
120 Ga0157378_10471644 3300013297 Bacteria 1249
121 Ga0157372_11316357 3300013307 Unclassified 834
122 Ga0157372_12474819 3300013307 Bacteria 596
123 Ga0157375_10040378 3300013308 Bacteria 4497
124 Ga0157375_10383949 3300013308 Bacteria 1571
125 Ga0163163_10035348 3300014325 Bacteria 4846
126 Ga0157380_13124029 3300014326 Bacteria 528
127 Ga0157377_10153042 3300014745 Bacteria 1427
128 Ga0157379_11174936 3300014968 Unclassified 737
129 Ga0157379_11228168 3300014968 Bacteria 722
130 Ga0157379_12426761 3300014968 Bacteria 523
131 Ga0157376_10295505 3300014969 Bacteria 1531
132 Ga0206355_1210983 3300020076 Unclassified 738
133 Ga0224712_10517828 3300022467 Unclassified 578
134 Ga0207685_10124026 3300025905 Bacteria 1138
135 Ga0207684_11697564 3300025910 Bacteria 509
136 Ga0207707_10128912 3300025912 Bacteria 2212
137 Ga0207695_10554570 3300025913 Bacteria 1031
138 Ga0207671_10481704 3300025914 Bacteria 989
139 Ga0207663_10329998 3300025916 Bacteria 1149
140 Ga0207660_10200683 3300025917 Bacteria 1558
141 Ga0207649_10088003 3300025920 Bacteria 2027
142 Ga0207649_10421051 3300025920 Unclassified 1003
143 Ga0207652_10097044 3300025921 Bacteria 2597
144 Ga0207646_11350916 3300025922 Unclassified 621
145 Ga0207681_10505873 3300025923 Bacteria 990
146 Ga0207650_10061673 3300025925 Bacteria 2800
147 Ga0207659_10046850 3300025926 Bacteria 3055
148 Ga0207659_10701213 3300025926 Bacteria 867
149 Ga0207687_10139849 3300025927 Bacteria 1835
150 Ga0207700_10767366 3300025928 Bacteria 862
151 Ga0207644_10021661 3300025931 Bacteria 4383
152 Ga0207644_10094235 3300025931 Bacteria 2237
153 Ga0207644_11008092 3300025931 Bacteria 699
154 Ga0207706_10169402 3300025933 Bacteria 1919
155 Ga0207670_10252012 3300025936 Bacteria 1365
156 Ga0207670_10512518 3300025936 Bacteria 976
157 Ga0207669_10059588 3300025937 Bacteria 2336
158 Ga0207704_10462249 3300025938 Bacteria 1015
159 Ga0207665_10389342 3300025939 Unclassified 1059
160 Ga0207691_10035255 3300025940 Bacteria 4646
161 Ga0207711_10034823 3300025941 Unclassified 4264
162 Ga0207711_10042647 3300025941 Bacteria 3866
163 Ga0207711_10209224 3300025941 Bacteria 1781
164 Ga0207711_10400058 3300025941 Bacteria 1276
165 Ga0207711_11175520 3300025941 Bacteria 708
166 Ga0207661_10735512 3300025944 Bacteria 908
167 Ga0207679_10062050 3300025945 Bacteria 2784
168 Ga0207679_10143752 3300025945 Bacteria 1932
169 Ga0207667_11361516 3300025949 Unclassified 684
170 Ga0207668_10742060 3300025972 Bacteria 866
171 Ga0207640_10031892 3300025981 Bacteria 3263
172 Ga0207658_10213712 3300025986 Bacteria 1618
173 Ga0207677_10055427 3300026023 Bacteria 2711
174 Ga0207703_11265507 3300026035 Bacteria 709
175 Ga0207639_10731890 3300026041 Bacteria 919
176 Ga0207678_11183574 3300026067 Bacteria 677
177 Ga0207641_10046487 3300026088 Bacteria 3659
178 Ga0207676_10017115 3300026095 Bacteria 5252
179 Ga0207674_10003629 3300026116 Bacteria 18823
180 Ga0207675_100432724 3300026118 Bacteria 1301
181 Ga0207675_101094646 3300026118 Bacteria 816
182 Ga0207683_10040373 3300026121 Bacteria 4072
183 Ga0207683_10085695 3300026121 Bacteria 2800
184 Ga0207428_10003213 3300027907 Bacteria 15968
185 Ga0207428_10343838 3300027907 Bacteria 1098
186 Ga0268266_10072461 3300028379 Bacteria 2987
187 Ga0268266_10251221 3300028379 Bacteria 1636
188 Ga0268264_10970557 3300028381 Bacteria 855
189 Ga0268264_11940964 3300028381 Bacteria 598
190 Ga0265323_10001854 3300028653 Bacteria 10006
191 Ga0265760_10149791 3300031090 Unclassified 764
192 Ga0265330_10088084 3300031235 Unclassified 1334
193 Ga0307408_100118587 3300031548 Bacteria 2046
194 Ga0307408_100205957 3300031548 Bacteria 1595
195 Ga0307408_101103549 3300031548 Bacteria 736
196 Ga0307405_10020056 3300031731 Bacteria 3728
197 Ga0307406_10143206 3300031901 Bacteria 1695
198 Ga0307406_11442259 3300031901 Unclassified 604
199 Ga0307409_100766072 3300031995 Bacteria 970
200 Ga0307416_100012061 3300032002 Bacteria 5802
201 Ga0307416_100047382 3300032002 Bacteria 3402
202 Ga0307416_102251118 3300032002 Bacteria 646
203 Ga0307411_10656944 3300032005 Bacteria 908
204 Ga0307415_100716922 3300032126 Unclassified 904
205 Ga0307507_10434155 3300033179 Unclassified 732
206 Ga0373934_0018938 3300035086 Bacteria 2638
207 Ga0373934_0073028 3300035086 Bacteria 1373
208 Ga0373923_0235453 3300035111 Bacteria 854
209 Ga0373939_0142087 3300035114 Bacteria 866
210 Ga0373953_0111120 3300035117 Bacteria 1159
211 Ga0373953_0367050 3300035117 Unclassified 632
212 Ga0373954_0259942 3300035118 Bacteria 855
213 Ga0373956_0043836 3300035119 Bacteria 1992
214 Ga0373957_0141435 3300035120 Unclassified 984
215 Ga0373955_0011542 3300035172 Bacteria 4216
216 Ga0373955_0304927 3300035172 Unclassified 960
217 Ga0373924_0300117 3300035410 Unclassified 713
218 Ga0373931_0638204 3300035691 Bacteria 699
219 Ga0373933_0378986 3300035724 Bacteria 921
220 Ga0373937_0032831 3300036401 Bacteria 4710
221 Ga0373937_0058255 3300036401 Bacteria 3548
222 Ga0373937_0830933 3300036401 Bacteria 872
223 Ga0373925_0003692 3300037068 Bacteria 11760
224 Ga0451807_2561156 3300041486 Bacteria 610
225 Ga0439445_0191047 3300042004 Bacteria 603
226 Ga0439446_0116310 3300042156 Bacteria 857
227 Ga0439435_0007521 3300042436 Bacteria 2495
228 Ga0439464_0066279 3300042439 Bacteria 1063
229 Ga0466958_0266335 3300045836 Unclassified 1097
230 Ga0495592_0360976 3300046454 Bacteria 929
231 Ga0495629_0606517 3300046459 Bacteria 732
232 Ga0495653_0290599 3300046463 Bacteria 1069
233 Ga0495580_0024994 3300046472 Bacteria 4368
234 Ga0495580_0492618 3300046472 Unclassified 819
235 Ga0495582_0184630 3300046473 Unclassified 1189
236 Ga0495667_0017013 3300046559 Bacteria 4909
237 Ga0495657_0660165 3300046675 Unclassified 603
238 Ga0495680_0425476 3300047322 Bacteria 913
239 Ga0496100_1380235 3300048903 Bacteria 556
240 Ga0496105_0816773 3300048908 Unclassified 708
241 Ga0496106_0438267 3300048909 Bacteria 1050
242 Ga0496112_1489705 3300048915 Unclassified 591
243 Ga0496114_0527165 3300048917 Bacteria 1044
244 Ga0496115_0104627 3300048918 Unclassified 2323
245 Ga0501299_009484 3300049522 Bacteria 1605
246 Ga0501201_051884 3300049651 Unclassified 514
247 Ga0501233_261071 3300049668 Unclassified 524
248 Ga0501250_006545 3300049680 Bacteria 1236
249 Ga0501273_089734 3300049770 Unclassified 521
250 nmdc:mga03683_428445_c1 3300050489 Bacteria 634
251 nmdc:mga00v17_166881_c1 3300050491 Bacteria 1418
252 nmdc:mga05p37_117422_c1 3300050507 Bacteria 3269
253 nmdc:mga05p37_45372_c1 3300050507 Bacteria 5406
254 nmdc:mga05p37_80109_c2 3300050507 Bacteria 3273
255 nmdc:mga05p37_8711_c1 3300050507 Bacteria 11988
256 nmdc:mga09592_1095218_c1 3300050508 Bacteria 662
257 nmdc:mga09592_3550_c1 3300050508 Bacteria 12593
258 nmdc:mga09592_8918_c1 3300050508 Bacteria 8156
259 nmdc:mga0qj67_160874_c1 3300050509 Bacteria 1823
260 nmdc:mga0qj67_29764_c1 3300050509 Bacteria 4242
261 nmdc:mga0qj67_349194_c1 3300050509 Bacteria 1196
262 nmdc:mga0qj67_963019_c1 3300050509 Bacteria 671
263 nmdc:mga06r32_105839_c1 3300050510 Bacteria 2764
264 nmdc:mga06r32_153672_c1 3300050510 Unclassified 2281
265 nmdc:mga06r32_72998_c1 3300050510 Bacteria 3323
266 nmdc:mga06r32_818063_c1 3300050510 Bacteria 891
267 nmdc:mga06r32_842412_c1 3300050510 Unclassified 876
268 nmdc:mga06r32_87010_c1 3300050510 Bacteria 3048
269 nmdc:mga08y16_141720_c1 3300050511 Bacteria 2499
270 nmdc:mga08y16_31924_c1 3300050511 Bacteria 5538
271 nmdc:mga08y16_486215_c1 3300050511 Bacteria 1256
272 nmdc:mga0n895_1408449_c1 3300050512 Unclassified 665
273 nmdc:mga0rr50_477082_c1 3300050513 Bacteria 1059
274 nmdc:mga0a205_71222_c1 3300050515 Bacteria 3357
275 Ga0495619_0202083 3300053085 Bacteria 1376
276 Ga0501084_1108812 3300054114 Bacteria 664
277 Ga0590071_067930 3300059421 Bacteria 876
278 Ga0590075_001077 3300059424 Bacteria 7062
279 Ga0590077_000596 3300059426 Bacteria 9840
280 Ga0070665_100353981
281 Ga0058862_10246821
282 Ga0065704_10437372
283 Ga0065712_10259612
284 Ga0065715_10035185
285 Ga0065715_10144364
286 Ga0065715_10353680
287 Ga0070683_101051263
288 Ga0070690_100060337
289 Ga0070670_100000897
290 Ga0070670_100065516
291 Ga0070670_100181154
292 Ga0070666_10015059
293 Ga0070680_100889567
294 Ga0070680_101365139
295 Ga0068868_100034429
296 Ga0070689_100223237
297 Ga0070689_101362587
298 Ga0070661_100139287
299 Ga0070661_100431107
300 Ga0070675_100033875
301 Ga0070674_100425819
302 Ga0070674_101328643
303 Ga0070688_100836784
304 Ga0070667_100030299
305 Ga0070709_11470804
306 Ga0070714_100234738
307 Ga0070713_101612067
308 Ga0070701_10586975
309 Ga0070701_10755388
310 Ga0070711_100029197
311 Ga0070711_100382975
312 Ga0070700_100162230
313 Ga0070694_100551043
314 Ga0070663_100572002
315 Ga0070678_100001344
316 Ga0070678_100069035
317 Ga0070662_100126118
318 Ga0070662_100289266
319 Ga0070681_10065151
320 Ga0070681_11001211
321 Ga0070681_11017708
322 Ga0070706_101441173
323 Ga0070706_102171447
324 Ga0070707_100439056
325 Ga0070698_100079984
326 Ga0070699_100070060
327 Ga0070679_100054496
328 Ga0070697_100255251
329 Ga0068853_100864645
330 Ga0070672_100494843
331 Ga0070695_100129090
332 Ga0070665_100056286
333 Ga0070665_101527958
334 Ga0070704_100236453
335 Ga0068855_100070123
336 Ga0070664_100233166
337 Ga0070664_100970679
338 Ga0068857_100152356
339 Ga0068857_101272426
340 Ga0068864_100053380
341 Ga0068863_100063048
342 Ga0068858_100046473
343 Ga0068858_101396452
344 Ga0068860_100836063
345 Ga0081455_10364989
346 Ga0075432_10356696
347 Ga0070715_10205530
348 Ga0070715_10746152
349 Ga0070716_100183945
350 Ga0097621_100543788
351 Ga0068871_100123357
352 Ga0075428_100002692
353 Ga0075428_100007342
354 Ga0075428_100012933
355 Ga0075428_100019325
356 Ga0075428_100781922
357 Ga0075428_100952084
358 Ga0075430_100009994
359 Ga0075430_100028148
360 Ga0075430_100055228
361 Ga0075431_100001899
362 Ga0075431_100050147
363 Ga0075431_100058722
364 Ga0075431_100071914
365 Ga0075431_100808148
366 Ga0075431_101675667
367 Ga0075433_10082703
368 Ga0075429_100000484
369 Ga0075429_100008621
370 Ga0075429_100022998
371 Ga0075429_100960819
372 Ga0068865_100583163
373 Ga0075435_100106519
374 Ga0075435_100122019
375 Ga0105251_10294398
376 Ga0105240_10894938
377 Ga0111539_10000204
378 Ga0111539_10068391
379 Ga0111539_10262513
380 Ga0114129_10000102
381 Ga0114129_10001187
382 Ga0114129_10007089
383 Ga0114129_10137466
384 Ga0114129_10147166
385 Ga0114129_10739447
386 Ga0105242_10861940
387 Ga0105248_10015335
388 Ga0105248_10029279
389 Ga0105248_10223302
390 Ga0105248_10384541
391 Ga0105248_10464656
392 Ga0105248_10751606
393 Ga0105237_10685411
394 Ga0105238_10532512
395 Ga0157373_10427793
396 Ga0157370_10054147
397 Ga0157369_10117833
398 Ga0157374_10001466
399 Ga0157378_10471644
400 Ga0157372_11316357
401 Ga0157372_12474819
402 Ga0157375_10040378
403 Ga0157375_10383949
404 Ga0163163_10035348
405 Ga0157380_13124029
406 Ga0157377_10153042
407 Ga0157379_11174936
408 Ga0157379_11228168
409 Ga0157379_12426761
410 Ga0157376_10295505
411 Ga0206355_1210983
412 Ga0224712_10517828
413 Ga0207685_10124026
414 Ga0207684_11697564
415 Ga0207707_10128912
416 Ga0207695_10554570
417 Ga0207671_10481704
418 Ga0207663_10329998
419 Ga0207660_10200683
420 Ga0207649_10088003
421 Ga0207649_10421051
422 Ga0207652_10097044
423 Ga0207646_11350916
424 Ga0207681_10505873
425 Ga0207650_10061673
426 Ga0207659_10046850
427 Ga0207659_10701213
428 Ga0207687_10139849
429 Ga0207700_10767366
430 Ga0207644_10021661
431 Ga0207644_10094235
432 Ga0207644_11008092
433 Ga0207706_10169402
434 Ga0207670_10252012
435 Ga0207670_10512518
436 Ga0207669_10059588
437 Ga0207704_10462249
438 Ga0207665_10389342
439 Ga0207691_10035255
440 Ga0207711_10034823
441 Ga0207711_10042647
442 Ga0207711_10209224
443 Ga0207711_10400058
444 Ga0207711_11175520
445 Ga0207661_10735512
446 Ga0207679_10062050
447 Ga0207679_10143752
448 Ga0207667_11361516
449 Ga0207668_10742060
450 Ga0207640_10031892
451 Ga0207658_10213712
452 Ga0207677_10055427
453 Ga0207703_11265507
454 Ga0207639_10731890
455 Ga0207678_11183574
456 Ga0207641_10046487
457 Ga0207676_10017115
458 Ga0207674_10003629
459 Ga0207675_100432724
460 Ga0207675_101094646
461 Ga0207683_10040373
462 Ga0207683_10085695
463 Ga0207428_10003213
464 Ga0207428_10343838
465 Ga0268266_10072461
466 Ga0268266_10251221
467 Ga0268264_10970557
468 Ga0268264_11940964
469 Ga0265323_10001854
470 Ga0265760_10149791
471 Ga0265330_10088084
472 Ga0307408_100118587
473 Ga0307408_100205957
474 Ga0307408_101103549
475 Ga0307405_10020056
476 Ga0307406_10143206
477 Ga0307406_11442259
478 Ga0307409_100766072
479 Ga0307416_100012061
480 Ga0307416_100047382
481 Ga0307416_102251118
482 Ga0307411_10656944
483 Ga0307415_100716922
484 Ga0307507_10434155
485 Ga0373934_0018938
486 Ga0373934_0073028
487 Ga0373923_0235453
488 Ga0373939_0142087
489 Ga0373953_0111120
490 Ga0373953_0367050
491 Ga0373954_0259942
492 Ga0373956_0043836
493 Ga0373957_0141435
494 Ga0373955_0011542
495 Ga0373955_0304927
496 Ga0373924_0300117
497 Ga0373931_0638204
498 Ga0373933_0378986
499 Ga0373937_0032831
500 Ga0373937_0058255
501 Ga0373937_0830933
502 Ga0373925_0003692
503 Ga0451807_2561156
504 Ga0439445_0191047
505 Ga0439446_0116310
506 Ga0439435_0007521
507 Ga0439464_0066279
508 Ga0466958_0266335
509 Ga0495592_0360976
510 Ga0495629_0606517
511 Ga0495653_0290599
512 Ga0495580_0024994
513 Ga0495580_0492618
514 Ga0495582_0184630
515 Ga0495667_0017013
516 Ga0495657_0660165
517 Ga0495680_0425476
518 Ga0496100_1380235
519 Ga0496105_0816773
520 Ga0496106_0438267
521 Ga0496112_1489705
522 Ga0496114_0527165
523 Ga0496115_0104627
524 Ga0501299_009484
525 Ga0501201_051884
526 Ga0501233_261071
527 Ga0501250_006545
528 Ga0501273_089734
529 nmdc:mga03683_428445_c1
530 nmdc:mga00v17_166881_c1
531 nmdc:mga05p37_117422_c1
532 nmdc:mga05p37_45372_c1
533 nmdc:mga05p37_80109_c2
534 nmdc:mga05p37_8711_c1
535 nmdc:mga09592_1095218_c1
536 nmdc:mga09592_3550_c1
537 nmdc:mga09592_8918_c1
538 nmdc:mga0qj67_160874_c1
539 nmdc:mga0qj67_29764_c1
540 nmdc:mga0qj67_349194_c1
541 nmdc:mga0qj67_963019_c1
542 nmdc:mga06r32_105839_c1
543 nmdc:mga06r32_153672_c1
544 nmdc:mga06r32_72998_c1
545 nmdc:mga06r32_818063_c1
546 nmdc:mga06r32_842412_c1
547 nmdc:mga06r32_87010_c1
548 nmdc:mga08y16_141720_c1
549 nmdc:mga08y16_31924_c1
550 nmdc:mga08y16_486215_c1
551 nmdc:mga0n895_1408449_c1
552 nmdc:mga0rr50_477082_c1
553 nmdc:mga0a205_71222_c1
554 Ga0495619_0202083
555 Ga0501084_1108812
556 Ga0590071_067930
557 Ga0590075_001077
558 Ga0590077_000596

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

30

105

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9422 10 108
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9343 9 108
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9223 9 106
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9202 9 108
6abq-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.9151 9 108
ID Description Score Start End Superfamily
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9422 9 108 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9202 9 108 1.10.10.10
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9169 9 112 1.10.10.10
4g9yA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8994 11 104 1.10.10.10
af_Q9C106_1_81_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8959 10 82 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2V9QX45-F1-model_v4 PadR family transcriptional regulator 1.001 1 79
AF-A0A4V2G1F2-F1-model_v4 PadR family transcriptional regulator 0.9901 9 110
AF-A0A3N5LS61-F1-model_v4 PadR family transcriptional regulator 0.99 9 107
AF-A0A2V9R0R6-F1-model_v4 PadR family transcriptional regulator 0.989 15 108
AF-A0A2V8EA09-F1-model_v4 PadR family transcriptional regulator 0.9879 9 88

Map