F382392

General Info

Members Datasets Scaffolds Average Seq Length
278 173 556 308

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10206162|Ga0157375_102061622
Length 340
Sequence MSAPTGPQFRLVVTSEAGRSVAVVTAVAAGLREYTVNGIDLVETFAEGSTPPMAAGIVLVPWPNRTRDGAWTQRGVTRQLPLTEPAKHNASHGLLRFTPYRKVAGSASSVTLAATIYPQTGYPFHLDTTVSYALAPDGLTVTHGVTNVGADAAPYAVGAHPYLQIGGVPTGDLTVEVNAATRIRVDERQNPIGEQPVAGTAHDLRGGRLVGEIELDNGYADVALTDAGRVEHRLSAPDGRALTLWGDENMRYVQVFAPRTFPTPAAVDGPVPATHQAIAIEPMTAPADAFNSGDGLRWLEPGEQWSVSWGISHHLFGTGQRETARVAENSVPAPRSERDR

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
23 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
24 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
32 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
33 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
35 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
37 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
50 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
51 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
52 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
53 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
54 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
55 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
56 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
57 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
58 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
59 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
60 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
61 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
62 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
63 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
64 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
65 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
66 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
67 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
68 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
69 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
70 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
71 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
72 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
73 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
74 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
75 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
76 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
77 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
78 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
79 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
80 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
81 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
82 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
83 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
84 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
85 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
86 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
87 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
88 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
89 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
90 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
91 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
92 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
93 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
94 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
95 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
96 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
97 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
98 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
99 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
100 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
101 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
102 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
103 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
104 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
105 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
106 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
120 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
121 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
122 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
123 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
124 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
127 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
128 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
129 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
130 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
131 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
132 2643221572 Leifsonia sp. Root60 Isolate Unclassified
133 2643221619 Agromyces sp. Root81 Isolate Unclassified
134 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
135 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
136 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
137 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
138 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
139 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
140 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
141 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
142 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
143 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
144 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
145 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
146 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
147 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
148 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
149 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
150 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
151 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
152 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
153 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
154 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
155 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
156 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
157 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
158 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
159 2919069694 Microbacterium sp. 1154 Isolate Unclassified
160 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
161 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
162 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
163 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
164 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
165 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
166 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
167 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
168 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
169 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
170 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
171 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
172 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
173 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.17
Metatranscriptomes 0
Isolates 15.83

Biome Distribution

Category Percentage (%)
Aerial Root 0.72
Bulb 0
Endosphere 5.76
Nodule 0
Rhizoplane 10.79
Rhizosphere 60.07
Stem 0
Stem Tuber 0.36
Unclassified 0.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_10206162 3300013308 Bacteria 2122
2 JGI25154J39366_1001722 3300002738 Bacteria 7118
3 JGI25164J39214_1000361 3300002772 Bacteria 27742
4 JGI25165J46597_1000061 3300003214 Bacteria 208362
5 rootH1_10282109 3300003323 Bacteria 2710
6 Ga0055527_1000017 3300003760 Bacteria 242362
7 Ga0055542_1000044 3300003762 Bacteria 206982
8 Ga0055529_1000093 3300003763 Bacteria 137160
9 Ga0065714_10075106 3300005288 Bacteria 2948
10 Ga0070658_10072387 3300005327 Bacteria 2825
11 Ga0070676_10003239 3300005328 Bacteria 8445
12 Ga0070666_10018001 3300005335 Bacteria 4535
13 Ga0070668_100061571 3300005347 Bacteria 2907
14 Ga0070669_100060436 3300005353 Bacteria 2784
15 Ga0070675_100004373 3300005354 Bacteria 10780
16 Ga0070674_100011248 3300005356 Bacteria 5442
17 Ga0070673_100202309 3300005364 Bacteria 1711
18 Ga0070667_100019782 3300005367 Bacteria 5586
19 Ga0070678_100018129 3300005456 Bacteria 4556
20 Ga0070672_100049546 3300005543 Bacteria 3268
21 Ga0070665_100298982 3300005548 Bacteria 1612
22 Ga0075369_10029539 3300006186 Bacteria 2303
23 Ga0105251_10020620 3300009011 Bacteria 3459
24 Ga0105244_10010186 3300009036 Bacteria 5711
25 Ga0105244_10011581 3300009036 Bacteria 5273
26 Ga0105244_10025380 3300009036 Bacteria 3221
27 Ga0105248_10129689 3300009177 Bacteria 2845
28 Ga0105246_10045230 3300011119 Bacteria 2996
29 Ga0157369_10008976 3300013105 Bacteria 11451
30 Ga0157369_10029404 3300013105 Bacteria 6072
31 Ga0157369_10214275 3300013105 Bacteria 2018
32 Ga0157372_10141537 3300013307 Bacteria 2771
33 Ga0157375_10010664 3300013308 Bacteria 8093
34 Ga0209672_100039 3300025228 Bacteria 283064
35 Ga0209147_100366 3300025229 Bacteria 32070
36 Ga0207427_100042 3300025231 Bacteria 254170
37 Ga0209437_108120 3300025233 Bacteria 1686
38 Ga0209258_102578 3300025242 Bacteria 4548
39 Ga0209646_1000202 3300025246 Bacteria 70943
40 Ga0209148_1000004 3300025254 Bacteria 1844481
41 Ga0209233_1000001 3300025261 Bacteria 2992747
42 Ga0209455_1000117 3300025272 Bacteria 176940
43 Ga0207697_10006266 3300025315 Bacteria 5405
44 Ga0207655_1018512 3300025728 Bacteria 3688
45 Ga0207713_1026721 3300025735 Bacteria 2638
46 Ga0207647_10091326 3300025904 Bacteria 1816
47 Ga0207645_10001051 3300025907 Bacteria 22851
48 Ga0207705_10144268 3300025909 Bacteria 1780
49 Ga0207650_10024922 3300025925 Bacteria 4258
50 Ga0207659_10013264 3300025926 Bacteria 5272
51 Ga0207644_10284990 3300025931 Bacteria 1327
52 Ga0207691_10003865 3300025940 Bacteria 14539
53 Ga0207683_10001048 3300026121 Bacteria 25183
54 Ga0307408_100086790 3300031548 Bacteria 2353
55 Ga0307410_10022188 3300031852 Bacteria 3919
56 Ga0307406_10000390 3300031901 Bacteria 25368
57 Ga0307407_10077394 3300031903 Bacteria 2001
58 Ga0307412_10060164 3300031911 Bacteria 2549
59 Ga0307412_10281595 3300031911 Bacteria 1306
60 Ga0307416_100016324 3300032002 Bacteria 5156
61 Ga0307416_100207581 3300032002 Bacteria 1865
62 Ga0307415_100088546 3300032126 Bacteria 2234
63 Ga0395899_0183766 3300037312 Bacteria 1466
64 Ga0395900_0009655 3300037418 Bacteria 9898
65 Ga0395900_0014143 3300037418 Bacteria 8149
66 Ga0395898_0000256 3300037466 Bacteria 130878
67 Ga0395898_0210966 3300037466 Bacteria 1852
68 Ga0439461_0028322 3300041410 Unclassified 1153
69 Ga0439466_0011551 3300041411 Bacteria 3265
70 Ga0439465_0000696 3300041413 Bacteria 10320
71 Ga0451806_541812 3300041462 Bacteria 968
72 Ga0439431_0006372 3300041997 Bacteria 2609
73 Ga0466965_0103966 3300044683 Bacteria 1454
74 Ga0466961_0075950 3300044693 Bacteria 2129
75 Ga0466971_0021444 3300044719 Bacteria 2875
76 Ga0466970_0035583 3300044765 Bacteria 2637
77 Ga0466957_0088241 3300044842 Bacteria 1940
78 Ga0466959_0012661 3300045049 Bacteria 6100
79 Ga0466967_0004767 3300045976 Bacteria 9235
80 Ga0466967_0006279 3300045976 Bacteria 8383
81 Ga0495580_0004788 3300046472 Bacteria 11334
82 Ga0495580_0095115 3300046472 Bacteria 2072
83 Ga0495582_0134115 3300046473 Bacteria 1400
84 Ga0495639_0028281 3300046475 Bacteria 2483
85 Ga0495607_0075918 3300046501 Bacteria 1861
86 Ga0495665_0029931 3300046531 Bacteria 2915
87 Ga0495586_0038003 3300046535 Bacteria 2584
88 Ga0495588_0008901 3300046674 Bacteria 4621
89 Ga0495588_0016760 3300046674 Bacteria 3544
90 Ga0495670_0130028 3300046691 Bacteria 1312
91 Ga0495677_0069696 3300047445 Bacteria 1310
92 Ga0495626_0040488 3300048091 Bacteria 2201
93 Ga0496100_0014892 3300048903 Bacteria 4528
94 Ga0496100_0056425 3300048903 Bacteria 2569
95 Ga0496101_0108529 3300048904 Bacteria 2087
96 Ga0496102_0050694 3300048905 Bacteria 3780
97 Ga0496102_0092342 3300048905 Bacteria 2803
98 Ga0496103_0013743 3300048906 Bacteria 4804
99 Ga0496103_0080504 3300048906 Bacteria 2048
100 Ga0496103_0193604 3300048906 Bacteria 1307
101 Ga0496104_0024563 3300048907 Bacteria 5544
102 Ga0496104_0129847 3300048907 Bacteria 2420
103 Ga0496105_0033355 3300048908 Bacteria 4227
104 Ga0496106_0026722 3300048909 Bacteria 4298
105 Ga0496106_0031768 3300048909 Bacteria 3934
106 Ga0496107_0001905 3300048910 Bacteria 13231
107 Ga0496107_0225234 3300048910 Bacteria 1395
108 Ga0496108_0225313 3300048911 Bacteria 1629
109 Ga0496109_0060345 3300048912 Bacteria 3465
110 Ga0496109_0072074 3300048912 Bacteria 3173
111 Ga0496110_0211894 3300048913 Bacteria 1761
112 Ga0496111_0225637 3300048914 Bacteria 1391
113 Ga0496111_0310505 3300048914 Bacteria 1168
114 Ga0496113_0013408 3300048916 Bacteria 5552
115 Ga0496113_0016241 3300048916 Bacteria 5138
116 Ga0496114_0010992 3300048917 Bacteria 7217
117 Ga0496114_0068572 3300048917 Bacteria 2977
118 Ga0496114_0780239 3300048917 Bacteria 834
119 Ga0496115_0053433 3300048918 Bacteria 3242
120 Ga0496115_0075129 3300048918 Bacteria 2744
121 Ga0496115_0146871 3300048918 Bacteria 1946
122 Ga0496117_0000014 3300048920 Bacteria 584427
123 Ga0496117_0000187 3300048920 Bacteria 127214
124 Ga0496117_0000515 3300048920 Bacteria 63759
125 Ga0496117_0012029 3300048920 Bacteria 7684
126 Ga0496117_0017928 3300048920 Bacteria 5894
127 Ga0496118_0000173 3300048921 Bacteria 116057
128 Ga0496118_0003252 3300048921 Bacteria 20716
129 Ga0496118_0030858 3300048921 Bacteria 4460
130 Ga0496118_0123766 3300048921 Bacteria 1679
131 Ga0496119_0001768 3300048922 Bacteria 25155
132 Ga0496119_0006205 3300048922 Bacteria 11177
133 Ga0496119_0012765 3300048922 Bacteria 6780
134 Ga0496119_0106261 3300048922 Bacteria 1567
135 Ga0496120_0000462 3300048923 Bacteria 64059
136 Ga0496120_0005946 3300048923 Bacteria 9517
137 Ga0496120_0076828 3300048923 Bacteria 1819
138 Ga0496120_0117032 3300048923 Bacteria 1383
139 Ga0496121_0164756 3300048924 Bacteria 1617
140 Ga0496122_0008143 3300048925 Bacteria 11415
141 Ga0496122_0016744 3300048925 Bacteria 6908
142 Ga0496122_0026202 3300048925 Bacteria 5035
143 Ga0496122_0031551 3300048925 Bacteria 4407
144 Ga0496122_0091051 3300048925 Bacteria 2078
145 Ga0496122_0130220 3300048925 Bacteria 1601
146 Ga0496123_0005624 3300048926 Bacteria 12519
147 Ga0496123_0005822 3300048926 Bacteria 12230
148 Ga0496123_0032473 3300048926 Bacteria 3779
149 Ga0496123_0260669 3300048926 Bacteria 849
150 Ga0496124_0000135 3300048927 Bacteria 152458
151 Ga0496124_0014894 3300048927 Bacteria 7492
152 Ga0496124_0071744 3300048927 Bacteria 2869
153 Ga0496124_0165728 3300048927 Bacteria 1717
154 Ga0496124_0387367 3300048927 Bacteria 975
155 Ga0496125_0002725 3300048928 Bacteria 22449
156 Ga0496125_0081596 3300048928 Bacteria 2470
157 Ga0496126_0000639 3300048929 Bacteria 65224
158 Ga0496126_0005293 3300048929 Bacteria 14810
159 Ga0496126_0011140 3300048929 Bacteria 9336
160 Ga0496126_0187102 3300048929 Bacteria 1755
161 Ga0501031_0005991 3300049568 Bacteria 7936
162 Ga0501032_0012060 3300049569 Bacteria 6189
163 Ga0501032_0014286 3300049569 Bacteria 5623
164 Ga0501032_0016473 3300049569 Bacteria 5198
165 Ga0501033_0004678 3300049570 Bacteria 10949
166 Ga0501033_0010787 3300049570 Bacteria 7007
167 Ga0501033_0011928 3300049570 Bacteria 6641
168 Ga0501033_0034689 3300049570 Bacteria 3782
169 Ga0501033_0086767 3300049570 Bacteria 2291
170 Ga0501034_0007613 3300049571 Bacteria 11521
171 Ga0501034_0015626 3300049571 Bacteria 7797
172 Ga0501034_0141375 3300049571 Bacteria 2386
173 Ga0501034_0162506 3300049571 Bacteria 2203
174 Ga0501034_0216615 3300049571 Bacteria 1868
175 Ga0501034_0340656 3300049571 Bacteria 1429
176 Ga0501036_0013730 3300049572 Bacteria 6734
177 Ga0501036_0015287 3300049572 Bacteria 6407
178 Ga0501036_0057463 3300049572 Bacteria 3295
179 Ga0501036_0235623 3300049572 Bacteria 1535
180 Ga0501037_0007759 3300049573 Bacteria 7856
181 Ga0501037_0009584 3300049573 Bacteria 7106
182 Ga0501037_0020512 3300049573 Bacteria 4880
183 Ga0501038_0005743 3300049574 Bacteria 11492
184 Ga0501038_0027091 3300049574 Bacteria 5101
185 Ga0501038_0028876 3300049574 Bacteria 4923
186 Ga0501038_0064798 3300049574 Bacteria 3115
187 Ga0501039_0006255 3300049575 Bacteria 9045
188 Ga0501042_0000296 3300049578 Bacteria 24701
189 Ga0501042_0102390 3300049578 Bacteria 2060
190 Ga0501043_0003890 3300049579 Bacteria 12260
191 Ga0501043_0077650 3300049579 Bacteria 2608
192 Ga0501043_0087232 3300049579 Bacteria 2452
193 Ga0501043_0111903 3300049579 Bacteria 2144
194 Ga0501043_0192522 3300049579 Bacteria 1585
195 Ga0501046_0010930 3300049580 Bacteria 7782
196 Ga0501046_0022327 3300049580 Bacteria 5213
197 Ga0501046_0048917 3300049580 Bacteria 3346
198 Ga0501047_0006203 3300049581 Bacteria 11240
199 Ga0501047_0011483 3300049581 Bacteria 8383
200 Ga0501047_0043744 3300049581 Bacteria 4326
201 Ga0501047_0045313 3300049581 Bacteria 4252
202 Ga0501047_0192692 3300049581 Bacteria 1901
203 Ga0501047_0365367 3300049581 Bacteria 1278
204 Ga0501048_0001986 3300049582 Bacteria 15545
205 Ga0501048_0045365 3300049582 Bacteria 3139
206 Ga0501068_0069580 3300049584 Bacteria 2146
207 Ga0501070_0001029 3300049586 Bacteria 25057
208 Ga0501070_0047651 3300049586 Bacteria 3561
209 Ga0501070_0091564 3300049586 Bacteria 2516
210 Ga0501070_0253733 3300049586 Bacteria 1438
211 Ga0501073_0035323 3300049589 Bacteria 3554
212 Ga0501073_0049168 3300049589 Bacteria 2957
213 Ga0501080_0087144 3300049742 Bacteria 2900
214 Ga0501080_0493964 3300049742 Bacteria 1094
215 Ga0501083_0000059 3300049744 Bacteria 78374
216 Ga0501083_0079617 3300049744 Bacteria 2172
217 Ga0501035_0004345 3300049822 Bacteria 13451
218 Ga0501035_0008147 3300049822 Bacteria 9766
219 Ga0501035_0055451 3300049822 Bacteria 3538
220 Ga0501035_0067066 3300049822 Bacteria 3184
221 Ga0501035_0081973 3300049822 Bacteria 2846
222 Ga0501035_0111448 3300049822 Bacteria 2398
223 Ga0501035_0146874 3300049822 Bacteria 2047
224 Ga0501044_0014298 3300049823 Bacteria 8568
225 Ga0501044_0023486 3300049823 Bacteria 6558
226 Ga0501044_0028791 3300049823 Bacteria 5859
227 Ga0501044_0031275 3300049823 Bacteria 5603
228 Ga0501044_0036240 3300049823 Bacteria 5161
229 Ga0501044_0115636 3300049823 Bacteria 2688
230 Ga0501044_0354757 3300049823 Bacteria 1385
231 Ga0501045_0020289 3300049824 Bacteria 4747
232 Ga0500635_0000148 3300053080 Bacteria 39620
233 Ga0495655_0001528 3300053083 Bacteria 3554
234 Ga0500616_0000027 3300053153 Bacteria 441053
235 2537900828 2537561592 Bacteria 4348607
236 2588107700 2585428157 Bacteria 3018951
237 2643876320 2643221572 Bacteria 3614809
238 2644113670 2643221619 Bacteria 4158469
239 2644182522 2643221632 Bacteria 3406696
240 2644197233 2643221635 Bacteria 2632343
241 2644383375 2643221669 Bacteria 3611286
242 2747953516 2747842429 Bacteria 3914386
243 2753303566 2751185788 Bacteria 4541048
244 2758225049 2757320536 Bacteria 3629334
245 2774379089 2773857758 Bacteria 3592392
246 2810365935 2808606700 Bacteria 3482157
247 2857480069 2857479173 Bacteria 2469263
248 2857633333 2857632687 Bacteria 2448521
249 2857729831 2857729791 Bacteria 4040535
250 2862993506 2862993130 Bacteria 3860849
251 2870803224 2870801768 Bacteria 2710986
252 2870805269 2870804320 Bacteria 2552467
253 2884766257 2884763398 Bacteria 4091164
254 2895660500 2895660088 Bacteria 3782833
255 2904432520 2904430863 Bacteria 3486923
256 2904501696 2904501621 Bacteria 3401437
257 2904510554 2904509784 Bacteria 3520416
258 2905928288 2905926851 Bacteria 4423176
259 2908676250 2908674828 Bacteria 3382763
260 2908678228 2908678064 Bacteria 3482747
261 2909077135 2909074476 Bacteria 3436050
262 2919041891 2919039151 Bacteria 3391018
263 2919043326 2919042368 Bacteria 3905917
264 2919070537 2919069694 Bacteria 3622919
265 2928105607 2928104781 Bacteria 3877447
266 2928123081 2928121344 Bacteria 3972376
267 2928500873 2928500415 Bacteria 3384541
268 2939662845 2939660829 Bacteria 3784848
269 2946003748 2946003308 Bacteria 3857229
270 2964328568 2964326757 Bacteria 3290868
271 2974295104 2974294766 Bacteria 3767688
272 2974325094 2974324384 Bacteria 3750535
273 2977238918 2977236895 Bacteria 3569373
274 2977265311 2977264416 Bacteria 3750737
275 2984543298 2984542743 Bacteria 3569378
276 2984551847 2984551494 Bacteria 3877562
277 8016255390 8016254467 Bacteria 3797036
278 8057347508 8057345674 Bacteria 4160394
279 Ga0157375_10206162
280 JGI25154J39366_1001722
281 JGI25164J39214_1000361
282 JGI25165J46597_1000061
283 rootH1_10282109
284 Ga0055527_1000017
285 Ga0055542_1000044
286 Ga0055529_1000093
287 Ga0065714_10075106
288 Ga0070658_10072387
289 Ga0070676_10003239
290 Ga0070666_10018001
291 Ga0070668_100061571
292 Ga0070669_100060436
293 Ga0070675_100004373
294 Ga0070674_100011248
295 Ga0070673_100202309
296 Ga0070667_100019782
297 Ga0070678_100018129
298 Ga0070672_100049546
299 Ga0070665_100298982
300 Ga0075369_10029539
301 Ga0105251_10020620
302 Ga0105244_10010186
303 Ga0105244_10011581
304 Ga0105244_10025380
305 Ga0105248_10129689
306 Ga0105246_10045230
307 Ga0157369_10008976
308 Ga0157369_10029404
309 Ga0157369_10214275
310 Ga0157372_10141537
311 Ga0157375_10010664
312 Ga0209672_100039
313 Ga0209147_100366
314 Ga0207427_100042
315 Ga0209437_108120
316 Ga0209258_102578
317 Ga0209646_1000202
318 Ga0209148_1000004
319 Ga0209233_1000001
320 Ga0209455_1000117
321 Ga0207697_10006266
322 Ga0207655_1018512
323 Ga0207713_1026721
324 Ga0207647_10091326
325 Ga0207645_10001051
326 Ga0207705_10144268
327 Ga0207650_10024922
328 Ga0207659_10013264
329 Ga0207644_10284990
330 Ga0207691_10003865
331 Ga0207683_10001048
332 Ga0307408_100086790
333 Ga0307410_10022188
334 Ga0307406_10000390
335 Ga0307407_10077394
336 Ga0307412_10060164
337 Ga0307412_10281595
338 Ga0307416_100016324
339 Ga0307416_100207581
340 Ga0307415_100088546
341 Ga0395899_0183766
342 Ga0395900_0009655
343 Ga0395900_0014143
344 Ga0395898_0000256
345 Ga0395898_0210966
346 Ga0439461_0028322
347 Ga0439466_0011551
348 Ga0439465_0000696
349 Ga0451806_541812
350 Ga0439431_0006372
351 Ga0466965_0103966
352 Ga0466961_0075950
353 Ga0466971_0021444
354 Ga0466970_0035583
355 Ga0466957_0088241
356 Ga0466959_0012661
357 Ga0466967_0004767
358 Ga0466967_0006279
359 Ga0495580_0004788
360 Ga0495580_0095115
361 Ga0495582_0134115
362 Ga0495639_0028281
363 Ga0495607_0075918
364 Ga0495665_0029931
365 Ga0495586_0038003
366 Ga0495588_0008901
367 Ga0495588_0016760
368 Ga0495670_0130028
369 Ga0495677_0069696
370 Ga0495626_0040488
371 Ga0496100_0014892
372 Ga0496100_0056425
373 Ga0496101_0108529
374 Ga0496102_0050694
375 Ga0496102_0092342
376 Ga0496103_0013743
377 Ga0496103_0080504
378 Ga0496103_0193604
379 Ga0496104_0024563
380 Ga0496104_0129847
381 Ga0496105_0033355
382 Ga0496106_0026722
383 Ga0496106_0031768
384 Ga0496107_0001905
385 Ga0496107_0225234
386 Ga0496108_0225313
387 Ga0496109_0060345
388 Ga0496109_0072074
389 Ga0496110_0211894
390 Ga0496111_0225637
391 Ga0496111_0310505
392 Ga0496113_0013408
393 Ga0496113_0016241
394 Ga0496114_0010992
395 Ga0496114_0068572
396 Ga0496114_0780239
397 Ga0496115_0053433
398 Ga0496115_0075129
399 Ga0496115_0146871
400 Ga0496117_0000014
401 Ga0496117_0000187
402 Ga0496117_0000515
403 Ga0496117_0012029
404 Ga0496117_0017928
405 Ga0496118_0000173
406 Ga0496118_0003252
407 Ga0496118_0030858
408 Ga0496118_0123766
409 Ga0496119_0001768
410 Ga0496119_0006205
411 Ga0496119_0012765
412 Ga0496119_0106261
413 Ga0496120_0000462
414 Ga0496120_0005946
415 Ga0496120_0076828
416 Ga0496120_0117032
417 Ga0496121_0164756
418 Ga0496122_0008143
419 Ga0496122_0016744
420 Ga0496122_0026202
421 Ga0496122_0031551
422 Ga0496122_0091051
423 Ga0496122_0130220
424 Ga0496123_0005624
425 Ga0496123_0005822
426 Ga0496123_0032473
427 Ga0496123_0260669
428 Ga0496124_0000135
429 Ga0496124_0014894
430 Ga0496124_0071744
431 Ga0496124_0165728
432 Ga0496124_0387367
433 Ga0496125_0002725
434 Ga0496125_0081596
435 Ga0496126_0000639
436 Ga0496126_0005293
437 Ga0496126_0011140
438 Ga0496126_0187102
439 Ga0501031_0005991
440 Ga0501032_0012060
441 Ga0501032_0014286
442 Ga0501032_0016473
443 Ga0501033_0004678
444 Ga0501033_0010787
445 Ga0501033_0011928
446 Ga0501033_0034689
447 Ga0501033_0086767
448 Ga0501034_0007613
449 Ga0501034_0015626
450 Ga0501034_0141375
451 Ga0501034_0162506
452 Ga0501034_0216615
453 Ga0501034_0340656
454 Ga0501036_0013730
455 Ga0501036_0015287
456 Ga0501036_0057463
457 Ga0501036_0235623
458 Ga0501037_0007759
459 Ga0501037_0009584
460 Ga0501037_0020512
461 Ga0501038_0005743
462 Ga0501038_0027091
463 Ga0501038_0028876
464 Ga0501038_0064798
465 Ga0501039_0006255
466 Ga0501042_0000296
467 Ga0501042_0102390
468 Ga0501043_0003890
469 Ga0501043_0077650
470 Ga0501043_0087232
471 Ga0501043_0111903
472 Ga0501043_0192522
473 Ga0501046_0010930
474 Ga0501046_0022327
475 Ga0501046_0048917
476 Ga0501047_0006203
477 Ga0501047_0011483
478 Ga0501047_0043744
479 Ga0501047_0045313
480 Ga0501047_0192692
481 Ga0501047_0365367
482 Ga0501048_0001986
483 Ga0501048_0045365
484 Ga0501068_0069580
485 Ga0501070_0001029
486 Ga0501070_0047651
487 Ga0501070_0091564
488 Ga0501070_0253733
489 Ga0501073_0035323
490 Ga0501073_0049168
491 Ga0501080_0087144
492 Ga0501080_0493964
493 Ga0501083_0000059
494 Ga0501083_0079617
495 Ga0501035_0004345
496 Ga0501035_0008147
497 Ga0501035_0055451
498 Ga0501035_0067066
499 Ga0501035_0081973
500 Ga0501035_0111448
501 Ga0501035_0146874
502 Ga0501044_0014298
503 Ga0501044_0023486
504 Ga0501044_0028791
505 Ga0501044_0031275
506 Ga0501044_0036240
507 Ga0501044_0115636
508 Ga0501044_0354757
509 Ga0501045_0020289
510 Ga0500635_0000148
511 Ga0495655_0001528
512 Ga0500616_0000027
513 2537900828
514 2588107700
515 2643876320
516 2644113670
517 2644182522
518 2644197233
519 2644383375
520 2747953516
521 2753303566
522 2758225049
523 2774379089
524 2810365935
525 2857480069
526 2857633333
527 2857729831
528 2862993506
529 2870803224
530 2870805269
531 2884766257
532 2895660500
533 2904432520
534 2904501696
535 2904510554
536 2905928288
537 2908676250
538 2908678228
539 2909077135
540 2919041891
541 2919043326
542 2919070537
543 2928105607
544 2928123081
545 2928500873
546 2939662845
547 2946003748
548 2964328568
549 2974295104
550 2974325094
551 2977238918
552 2977265311
553 2984543298
554 2984551847
555 8016255390
556 8057347508

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01263

Aldose_epim

Aldose 1-epimerase

10

312

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3os7-assembly4.cif.gz_D crystal structure of a galactose mutarotase-like protein (ca_c0697) from clostridium acetobutylicum at 1.80 a resolution 0.8832 38 326
3mwx-assembly2.cif.gz_B crystal structure of a putative galactose mutarotase (bsu18360) from bacillus subtilis at 1.45 a resolution 0.8734 38 326
1lur-assembly2.cif.gz_B crystal structure of the galm/aldose epimerase homologue from c. elegans, northeast structural genomics target wr66 0.8669 37 326
3nre-assembly4.cif.gz_D crystal structure of a putative aldose 1-epimerase (b2544) from escherichia coli k12 at 1.59 a resolution 0.8617 37 326
1so0-assembly4.cif.gz_D crystal structure of human galactose mutarotase complexed with galactose 0.8527 35 326
ID Description Score Start End Superfamily
af_P32139_19_304_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.9289 37 323 2.70.98.10
af_P32139_19_304_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.9226 37 323 2.70.98.10
3os7B00 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.8776 38 326 2.70.98.10
af_Q33AZ5_28_362_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.8602 34 326 2.70.98.10
af_Q9VRU1_15_363_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.8568 37 326 2.70.98.10
ID Description Score Start End GO Terms
AF-A0A2S5IYL1-F1-model_v4 Aldose epimerase 0.9842 35 326 GO:0004034
GO:0006006
GO:0030246
GO:0033499
AF-A0A177K5Q4-F1-model_v4 Galactose mutarotase 0.9834 30 326 GO:0004034
GO:0006006
GO:0030246
GO:0033499
AF-A0A7K1FS54-F1-model_v4 Aldose epimerase 0.9813 33 325 GO:0005975
GO:0016853
GO:0030246
AF-A0A7W8ZF07-F1-model_v4 deleted 0.9812 54 326
AF-A0A6J6C7G5-F1-model_v4 Unannotated protein 0.9778 57 326 GO:0004034
GO:0006006
GO:0030246
GO:0033499

Map