F382392
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 278 | 173 | 556 | 308 |
Family's Representative Sequence
| Representative Sequence | 3300013308|Ga0157375_10206162|Ga0157375_102061622 |
| Length | 340 |
| Sequence | MSAPTGPQFRLVVTSEAGRSVAVVTAVAAGLREYTVNGIDLVETFAEGSTPPMAAGIVLVPWPNRTRDGAWTQRGVTRQLPLTEPAKHNASHGLLRFTPYRKVAGSASSVTLAATIYPQTGYPFHLDTTVSYALAPDGLTVTHGVTNVGADAAPYAVGAHPYLQIGGVPTGDLTVEVNAATRIRVDERQNPIGEQPVAGTAHDLRGGRLVGEIELDNGYADVALTDAGRVEHRLSAPDGRALTLWGDENMRYVQVFAPRTFPTPAAVDGPVPATHQAIAIEPMTAPADAFNSGDGLRWLEPGEQWSVSWGISHHLFGTGQRETARVAENSVPAPRSERDR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 3 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 4 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 7 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 23 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 28 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 29 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 30 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 31 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 32 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 33 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 34 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 35 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 36 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 37 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 38 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 50 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 51 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 52 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 53 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 54 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 55 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 56 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 57 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 58 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 59 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 60 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 61 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 62 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 63 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 64 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 65 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 66 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 67 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 68 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 69 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 70 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 71 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 82 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 83 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 84 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 85 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 86 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 87 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 88 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 89 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 90 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 91 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 92 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 93 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 94 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 95 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 96 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 97 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 98 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 99 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 100 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 101 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 102 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 103 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 104 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 105 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 106 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 107 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 108 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 109 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 110 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 111 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 112 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 113 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 114 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 115 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 116 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 117 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 118 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 119 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 120 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 121 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 122 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 123 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 124 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 125 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 126 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 127 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 128 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 130 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 131 | 2585428157 | Microbacterium sp. CF335 | Isolate | Rhizosphere |
| 132 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 133 | 2643221619 | Agromyces sp. Root81 | Isolate | Unclassified |
| 134 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 135 | 2643221635 | Yonghaparkia sp. Root332 | Isolate | Unclassified |
| 136 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 137 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 138 | 2751185788 | Curtobacterium pusillum AA3 | Isolate | Unclassified |
| 139 | 2757320536 | Microbacterium sp. NFIX05 | Isolate | Unclassified |
| 140 | 2773857758 | Microbacterium chocolatum 1320 | Isolate | Unclassified |
| 141 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 142 | 2857479173 | Micrococcus sp. R-74225 | Isolate | Unclassified |
| 143 | 2857632687 | Micrococcus sp. R-73081 | Isolate | Unclassified |
| 144 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 145 | 2862993130 | Planctomonas deserti 13S1-3 v2 | Isolate | Rhizosphere |
| 146 | 2870801768 | Micrococcus endophyticus DSM 17945 | Isolate | Unclassified |
| 147 | 2870804320 | Micrococcus yunnanensis DSM 21948 | Isolate | Unclassified |
| 148 | 2884763398 | Leifsonia sp. PS1209 | Isolate | Stem Tuber |
| 149 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 150 | 2904430863 | Curtobacterium oceanosedimentum 1519 | Isolate | Rhizosphere |
| 151 | 2904501621 | Curtobacterium sp. 1909 | Isolate | Unclassified |
| 152 | 2904509784 | Microbacterium sp. 1676 | Isolate | Rhizosphere |
| 153 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 154 | 2908674828 | Curtobacterium sp. 1517 | Isolate | Rhizosphere |
| 155 | 2908678064 | Microbacterium sp. 1518 | Isolate | Rhizosphere |
| 156 | 2909074476 | Curtobacterium sp. 1310 | Isolate | Rhizosphere |
| 157 | 2919039151 | Curtobacterium sp. 260 | Isolate | Rhizosphere |
| 158 | 2919042368 | Curtobacterium sp. 320 | Isolate | Rhizosphere |
| 159 | 2919069694 | Microbacterium sp. 1154 | Isolate | Unclassified |
| 160 | 2928104781 | Curtobacterium sp. 1544 | Isolate | Rhizosphere |
| 161 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 162 | 2928500415 | Curtobacterium oceanosedimentum 1257 | Isolate | Rhizosphere |
| 163 | 2939660829 | Mycetocola sp. 2940 | Isolate | Rhizosphere |
| 164 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 165 | 2964326757 | Planctomonas psychrotolerans J5903 | Isolate | Rhizosphere |
| 166 | 2974294766 | Microbacterium proteolyticum SORGH_AS 209 | Isolate | Unclassified |
| 167 | 2974324384 | Microbacterium sp. SORGH_AS 344 | Isolate | Unclassified |
| 168 | 2977236895 | Microbacterium testaceum SORGH_AS 426 | Isolate | Unclassified |
| 169 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 170 | 2984542743 | Microbacterium sp. SORGH_AS454 | Isolate | Aerial Root |
| 171 | 2984551494 | Curtobacterium sp. SORGH_AS776 | Isolate | Aerial Root |
| 172 | 8016254467 | Microbacterium sp. SLBN-111 (version 3) | Isolate | Rhizosphere |
| 173 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.17 |
| Metatranscriptomes | 0 |
| Isolates | 15.83 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.72 |
| Bulb | 0 |
| Endosphere | 5.76 |
| Nodule | 0 |
| Rhizoplane | 10.79 |
| Rhizosphere | 60.07 |
| Stem | 0 |
| Stem Tuber | 0.36 |
| Unclassified | 0.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157375_10206162 | 3300013308 | Bacteria | 2122 |
| 2 | JGI25154J39366_1001722 | 3300002738 | Bacteria | 7118 |
| 3 | JGI25164J39214_1000361 | 3300002772 | Bacteria | 27742 |
| 4 | JGI25165J46597_1000061 | 3300003214 | Bacteria | 208362 |
| 5 | rootH1_10282109 | 3300003323 | Bacteria | 2710 |
| 6 | Ga0055527_1000017 | 3300003760 | Bacteria | 242362 |
| 7 | Ga0055542_1000044 | 3300003762 | Bacteria | 206982 |
| 8 | Ga0055529_1000093 | 3300003763 | Bacteria | 137160 |
| 9 | Ga0065714_10075106 | 3300005288 | Bacteria | 2948 |
| 10 | Ga0070658_10072387 | 3300005327 | Bacteria | 2825 |
| 11 | Ga0070676_10003239 | 3300005328 | Bacteria | 8445 |
| 12 | Ga0070666_10018001 | 3300005335 | Bacteria | 4535 |
| 13 | Ga0070668_100061571 | 3300005347 | Bacteria | 2907 |
| 14 | Ga0070669_100060436 | 3300005353 | Bacteria | 2784 |
| 15 | Ga0070675_100004373 | 3300005354 | Bacteria | 10780 |
| 16 | Ga0070674_100011248 | 3300005356 | Bacteria | 5442 |
| 17 | Ga0070673_100202309 | 3300005364 | Bacteria | 1711 |
| 18 | Ga0070667_100019782 | 3300005367 | Bacteria | 5586 |
| 19 | Ga0070678_100018129 | 3300005456 | Bacteria | 4556 |
| 20 | Ga0070672_100049546 | 3300005543 | Bacteria | 3268 |
| 21 | Ga0070665_100298982 | 3300005548 | Bacteria | 1612 |
| 22 | Ga0075369_10029539 | 3300006186 | Bacteria | 2303 |
| 23 | Ga0105251_10020620 | 3300009011 | Bacteria | 3459 |
| 24 | Ga0105244_10010186 | 3300009036 | Bacteria | 5711 |
| 25 | Ga0105244_10011581 | 3300009036 | Bacteria | 5273 |
| 26 | Ga0105244_10025380 | 3300009036 | Bacteria | 3221 |
| 27 | Ga0105248_10129689 | 3300009177 | Bacteria | 2845 |
| 28 | Ga0105246_10045230 | 3300011119 | Bacteria | 2996 |
| 29 | Ga0157369_10008976 | 3300013105 | Bacteria | 11451 |
| 30 | Ga0157369_10029404 | 3300013105 | Bacteria | 6072 |
| 31 | Ga0157369_10214275 | 3300013105 | Bacteria | 2018 |
| 32 | Ga0157372_10141537 | 3300013307 | Bacteria | 2771 |
| 33 | Ga0157375_10010664 | 3300013308 | Bacteria | 8093 |
| 34 | Ga0209672_100039 | 3300025228 | Bacteria | 283064 |
| 35 | Ga0209147_100366 | 3300025229 | Bacteria | 32070 |
| 36 | Ga0207427_100042 | 3300025231 | Bacteria | 254170 |
| 37 | Ga0209437_108120 | 3300025233 | Bacteria | 1686 |
| 38 | Ga0209258_102578 | 3300025242 | Bacteria | 4548 |
| 39 | Ga0209646_1000202 | 3300025246 | Bacteria | 70943 |
| 40 | Ga0209148_1000004 | 3300025254 | Bacteria | 1844481 |
| 41 | Ga0209233_1000001 | 3300025261 | Bacteria | 2992747 |
| 42 | Ga0209455_1000117 | 3300025272 | Bacteria | 176940 |
| 43 | Ga0207697_10006266 | 3300025315 | Bacteria | 5405 |
| 44 | Ga0207655_1018512 | 3300025728 | Bacteria | 3688 |
| 45 | Ga0207713_1026721 | 3300025735 | Bacteria | 2638 |
| 46 | Ga0207647_10091326 | 3300025904 | Bacteria | 1816 |
| 47 | Ga0207645_10001051 | 3300025907 | Bacteria | 22851 |
| 48 | Ga0207705_10144268 | 3300025909 | Bacteria | 1780 |
| 49 | Ga0207650_10024922 | 3300025925 | Bacteria | 4258 |
| 50 | Ga0207659_10013264 | 3300025926 | Bacteria | 5272 |
| 51 | Ga0207644_10284990 | 3300025931 | Bacteria | 1327 |
| 52 | Ga0207691_10003865 | 3300025940 | Bacteria | 14539 |
| 53 | Ga0207683_10001048 | 3300026121 | Bacteria | 25183 |
| 54 | Ga0307408_100086790 | 3300031548 | Bacteria | 2353 |
| 55 | Ga0307410_10022188 | 3300031852 | Bacteria | 3919 |
| 56 | Ga0307406_10000390 | 3300031901 | Bacteria | 25368 |
| 57 | Ga0307407_10077394 | 3300031903 | Bacteria | 2001 |
| 58 | Ga0307412_10060164 | 3300031911 | Bacteria | 2549 |
| 59 | Ga0307412_10281595 | 3300031911 | Bacteria | 1306 |
| 60 | Ga0307416_100016324 | 3300032002 | Bacteria | 5156 |
| 61 | Ga0307416_100207581 | 3300032002 | Bacteria | 1865 |
| 62 | Ga0307415_100088546 | 3300032126 | Bacteria | 2234 |
| 63 | Ga0395899_0183766 | 3300037312 | Bacteria | 1466 |
| 64 | Ga0395900_0009655 | 3300037418 | Bacteria | 9898 |
| 65 | Ga0395900_0014143 | 3300037418 | Bacteria | 8149 |
| 66 | Ga0395898_0000256 | 3300037466 | Bacteria | 130878 |
| 67 | Ga0395898_0210966 | 3300037466 | Bacteria | 1852 |
| 68 | Ga0439461_0028322 | 3300041410 | Unclassified | 1153 |
| 69 | Ga0439466_0011551 | 3300041411 | Bacteria | 3265 |
| 70 | Ga0439465_0000696 | 3300041413 | Bacteria | 10320 |
| 71 | Ga0451806_541812 | 3300041462 | Bacteria | 968 |
| 72 | Ga0439431_0006372 | 3300041997 | Bacteria | 2609 |
| 73 | Ga0466965_0103966 | 3300044683 | Bacteria | 1454 |
| 74 | Ga0466961_0075950 | 3300044693 | Bacteria | 2129 |
| 75 | Ga0466971_0021444 | 3300044719 | Bacteria | 2875 |
| 76 | Ga0466970_0035583 | 3300044765 | Bacteria | 2637 |
| 77 | Ga0466957_0088241 | 3300044842 | Bacteria | 1940 |
| 78 | Ga0466959_0012661 | 3300045049 | Bacteria | 6100 |
| 79 | Ga0466967_0004767 | 3300045976 | Bacteria | 9235 |
| 80 | Ga0466967_0006279 | 3300045976 | Bacteria | 8383 |
| 81 | Ga0495580_0004788 | 3300046472 | Bacteria | 11334 |
| 82 | Ga0495580_0095115 | 3300046472 | Bacteria | 2072 |
| 83 | Ga0495582_0134115 | 3300046473 | Bacteria | 1400 |
| 84 | Ga0495639_0028281 | 3300046475 | Bacteria | 2483 |
| 85 | Ga0495607_0075918 | 3300046501 | Bacteria | 1861 |
| 86 | Ga0495665_0029931 | 3300046531 | Bacteria | 2915 |
| 87 | Ga0495586_0038003 | 3300046535 | Bacteria | 2584 |
| 88 | Ga0495588_0008901 | 3300046674 | Bacteria | 4621 |
| 89 | Ga0495588_0016760 | 3300046674 | Bacteria | 3544 |
| 90 | Ga0495670_0130028 | 3300046691 | Bacteria | 1312 |
| 91 | Ga0495677_0069696 | 3300047445 | Bacteria | 1310 |
| 92 | Ga0495626_0040488 | 3300048091 | Bacteria | 2201 |
| 93 | Ga0496100_0014892 | 3300048903 | Bacteria | 4528 |
| 94 | Ga0496100_0056425 | 3300048903 | Bacteria | 2569 |
| 95 | Ga0496101_0108529 | 3300048904 | Bacteria | 2087 |
| 96 | Ga0496102_0050694 | 3300048905 | Bacteria | 3780 |
| 97 | Ga0496102_0092342 | 3300048905 | Bacteria | 2803 |
| 98 | Ga0496103_0013743 | 3300048906 | Bacteria | 4804 |
| 99 | Ga0496103_0080504 | 3300048906 | Bacteria | 2048 |
| 100 | Ga0496103_0193604 | 3300048906 | Bacteria | 1307 |
| 101 | Ga0496104_0024563 | 3300048907 | Bacteria | 5544 |
| 102 | Ga0496104_0129847 | 3300048907 | Bacteria | 2420 |
| 103 | Ga0496105_0033355 | 3300048908 | Bacteria | 4227 |
| 104 | Ga0496106_0026722 | 3300048909 | Bacteria | 4298 |
| 105 | Ga0496106_0031768 | 3300048909 | Bacteria | 3934 |
| 106 | Ga0496107_0001905 | 3300048910 | Bacteria | 13231 |
| 107 | Ga0496107_0225234 | 3300048910 | Bacteria | 1395 |
| 108 | Ga0496108_0225313 | 3300048911 | Bacteria | 1629 |
| 109 | Ga0496109_0060345 | 3300048912 | Bacteria | 3465 |
| 110 | Ga0496109_0072074 | 3300048912 | Bacteria | 3173 |
| 111 | Ga0496110_0211894 | 3300048913 | Bacteria | 1761 |
| 112 | Ga0496111_0225637 | 3300048914 | Bacteria | 1391 |
| 113 | Ga0496111_0310505 | 3300048914 | Bacteria | 1168 |
| 114 | Ga0496113_0013408 | 3300048916 | Bacteria | 5552 |
| 115 | Ga0496113_0016241 | 3300048916 | Bacteria | 5138 |
| 116 | Ga0496114_0010992 | 3300048917 | Bacteria | 7217 |
| 117 | Ga0496114_0068572 | 3300048917 | Bacteria | 2977 |
| 118 | Ga0496114_0780239 | 3300048917 | Bacteria | 834 |
| 119 | Ga0496115_0053433 | 3300048918 | Bacteria | 3242 |
| 120 | Ga0496115_0075129 | 3300048918 | Bacteria | 2744 |
| 121 | Ga0496115_0146871 | 3300048918 | Bacteria | 1946 |
| 122 | Ga0496117_0000014 | 3300048920 | Bacteria | 584427 |
| 123 | Ga0496117_0000187 | 3300048920 | Bacteria | 127214 |
| 124 | Ga0496117_0000515 | 3300048920 | Bacteria | 63759 |
| 125 | Ga0496117_0012029 | 3300048920 | Bacteria | 7684 |
| 126 | Ga0496117_0017928 | 3300048920 | Bacteria | 5894 |
| 127 | Ga0496118_0000173 | 3300048921 | Bacteria | 116057 |
| 128 | Ga0496118_0003252 | 3300048921 | Bacteria | 20716 |
| 129 | Ga0496118_0030858 | 3300048921 | Bacteria | 4460 |
| 130 | Ga0496118_0123766 | 3300048921 | Bacteria | 1679 |
| 131 | Ga0496119_0001768 | 3300048922 | Bacteria | 25155 |
| 132 | Ga0496119_0006205 | 3300048922 | Bacteria | 11177 |
| 133 | Ga0496119_0012765 | 3300048922 | Bacteria | 6780 |
| 134 | Ga0496119_0106261 | 3300048922 | Bacteria | 1567 |
| 135 | Ga0496120_0000462 | 3300048923 | Bacteria | 64059 |
| 136 | Ga0496120_0005946 | 3300048923 | Bacteria | 9517 |
| 137 | Ga0496120_0076828 | 3300048923 | Bacteria | 1819 |
| 138 | Ga0496120_0117032 | 3300048923 | Bacteria | 1383 |
| 139 | Ga0496121_0164756 | 3300048924 | Bacteria | 1617 |
| 140 | Ga0496122_0008143 | 3300048925 | Bacteria | 11415 |
| 141 | Ga0496122_0016744 | 3300048925 | Bacteria | 6908 |
| 142 | Ga0496122_0026202 | 3300048925 | Bacteria | 5035 |
| 143 | Ga0496122_0031551 | 3300048925 | Bacteria | 4407 |
| 144 | Ga0496122_0091051 | 3300048925 | Bacteria | 2078 |
| 145 | Ga0496122_0130220 | 3300048925 | Bacteria | 1601 |
| 146 | Ga0496123_0005624 | 3300048926 | Bacteria | 12519 |
| 147 | Ga0496123_0005822 | 3300048926 | Bacteria | 12230 |
| 148 | Ga0496123_0032473 | 3300048926 | Bacteria | 3779 |
| 149 | Ga0496123_0260669 | 3300048926 | Bacteria | 849 |
| 150 | Ga0496124_0000135 | 3300048927 | Bacteria | 152458 |
| 151 | Ga0496124_0014894 | 3300048927 | Bacteria | 7492 |
| 152 | Ga0496124_0071744 | 3300048927 | Bacteria | 2869 |
| 153 | Ga0496124_0165728 | 3300048927 | Bacteria | 1717 |
| 154 | Ga0496124_0387367 | 3300048927 | Bacteria | 975 |
| 155 | Ga0496125_0002725 | 3300048928 | Bacteria | 22449 |
| 156 | Ga0496125_0081596 | 3300048928 | Bacteria | 2470 |
| 157 | Ga0496126_0000639 | 3300048929 | Bacteria | 65224 |
| 158 | Ga0496126_0005293 | 3300048929 | Bacteria | 14810 |
| 159 | Ga0496126_0011140 | 3300048929 | Bacteria | 9336 |
| 160 | Ga0496126_0187102 | 3300048929 | Bacteria | 1755 |
| 161 | Ga0501031_0005991 | 3300049568 | Bacteria | 7936 |
| 162 | Ga0501032_0012060 | 3300049569 | Bacteria | 6189 |
| 163 | Ga0501032_0014286 | 3300049569 | Bacteria | 5623 |
| 164 | Ga0501032_0016473 | 3300049569 | Bacteria | 5198 |
| 165 | Ga0501033_0004678 | 3300049570 | Bacteria | 10949 |
| 166 | Ga0501033_0010787 | 3300049570 | Bacteria | 7007 |
| 167 | Ga0501033_0011928 | 3300049570 | Bacteria | 6641 |
| 168 | Ga0501033_0034689 | 3300049570 | Bacteria | 3782 |
| 169 | Ga0501033_0086767 | 3300049570 | Bacteria | 2291 |
| 170 | Ga0501034_0007613 | 3300049571 | Bacteria | 11521 |
| 171 | Ga0501034_0015626 | 3300049571 | Bacteria | 7797 |
| 172 | Ga0501034_0141375 | 3300049571 | Bacteria | 2386 |
| 173 | Ga0501034_0162506 | 3300049571 | Bacteria | 2203 |
| 174 | Ga0501034_0216615 | 3300049571 | Bacteria | 1868 |
| 175 | Ga0501034_0340656 | 3300049571 | Bacteria | 1429 |
| 176 | Ga0501036_0013730 | 3300049572 | Bacteria | 6734 |
| 177 | Ga0501036_0015287 | 3300049572 | Bacteria | 6407 |
| 178 | Ga0501036_0057463 | 3300049572 | Bacteria | 3295 |
| 179 | Ga0501036_0235623 | 3300049572 | Bacteria | 1535 |
| 180 | Ga0501037_0007759 | 3300049573 | Bacteria | 7856 |
| 181 | Ga0501037_0009584 | 3300049573 | Bacteria | 7106 |
| 182 | Ga0501037_0020512 | 3300049573 | Bacteria | 4880 |
| 183 | Ga0501038_0005743 | 3300049574 | Bacteria | 11492 |
| 184 | Ga0501038_0027091 | 3300049574 | Bacteria | 5101 |
| 185 | Ga0501038_0028876 | 3300049574 | Bacteria | 4923 |
| 186 | Ga0501038_0064798 | 3300049574 | Bacteria | 3115 |
| 187 | Ga0501039_0006255 | 3300049575 | Bacteria | 9045 |
| 188 | Ga0501042_0000296 | 3300049578 | Bacteria | 24701 |
| 189 | Ga0501042_0102390 | 3300049578 | Bacteria | 2060 |
| 190 | Ga0501043_0003890 | 3300049579 | Bacteria | 12260 |
| 191 | Ga0501043_0077650 | 3300049579 | Bacteria | 2608 |
| 192 | Ga0501043_0087232 | 3300049579 | Bacteria | 2452 |
| 193 | Ga0501043_0111903 | 3300049579 | Bacteria | 2144 |
| 194 | Ga0501043_0192522 | 3300049579 | Bacteria | 1585 |
| 195 | Ga0501046_0010930 | 3300049580 | Bacteria | 7782 |
| 196 | Ga0501046_0022327 | 3300049580 | Bacteria | 5213 |
| 197 | Ga0501046_0048917 | 3300049580 | Bacteria | 3346 |
| 198 | Ga0501047_0006203 | 3300049581 | Bacteria | 11240 |
| 199 | Ga0501047_0011483 | 3300049581 | Bacteria | 8383 |
| 200 | Ga0501047_0043744 | 3300049581 | Bacteria | 4326 |
| 201 | Ga0501047_0045313 | 3300049581 | Bacteria | 4252 |
| 202 | Ga0501047_0192692 | 3300049581 | Bacteria | 1901 |
| 203 | Ga0501047_0365367 | 3300049581 | Bacteria | 1278 |
| 204 | Ga0501048_0001986 | 3300049582 | Bacteria | 15545 |
| 205 | Ga0501048_0045365 | 3300049582 | Bacteria | 3139 |
| 206 | Ga0501068_0069580 | 3300049584 | Bacteria | 2146 |
| 207 | Ga0501070_0001029 | 3300049586 | Bacteria | 25057 |
| 208 | Ga0501070_0047651 | 3300049586 | Bacteria | 3561 |
| 209 | Ga0501070_0091564 | 3300049586 | Bacteria | 2516 |
| 210 | Ga0501070_0253733 | 3300049586 | Bacteria | 1438 |
| 211 | Ga0501073_0035323 | 3300049589 | Bacteria | 3554 |
| 212 | Ga0501073_0049168 | 3300049589 | Bacteria | 2957 |
| 213 | Ga0501080_0087144 | 3300049742 | Bacteria | 2900 |
| 214 | Ga0501080_0493964 | 3300049742 | Bacteria | 1094 |
| 215 | Ga0501083_0000059 | 3300049744 | Bacteria | 78374 |
| 216 | Ga0501083_0079617 | 3300049744 | Bacteria | 2172 |
| 217 | Ga0501035_0004345 | 3300049822 | Bacteria | 13451 |
| 218 | Ga0501035_0008147 | 3300049822 | Bacteria | 9766 |
| 219 | Ga0501035_0055451 | 3300049822 | Bacteria | 3538 |
| 220 | Ga0501035_0067066 | 3300049822 | Bacteria | 3184 |
| 221 | Ga0501035_0081973 | 3300049822 | Bacteria | 2846 |
| 222 | Ga0501035_0111448 | 3300049822 | Bacteria | 2398 |
| 223 | Ga0501035_0146874 | 3300049822 | Bacteria | 2047 |
| 224 | Ga0501044_0014298 | 3300049823 | Bacteria | 8568 |
| 225 | Ga0501044_0023486 | 3300049823 | Bacteria | 6558 |
| 226 | Ga0501044_0028791 | 3300049823 | Bacteria | 5859 |
| 227 | Ga0501044_0031275 | 3300049823 | Bacteria | 5603 |
| 228 | Ga0501044_0036240 | 3300049823 | Bacteria | 5161 |
| 229 | Ga0501044_0115636 | 3300049823 | Bacteria | 2688 |
| 230 | Ga0501044_0354757 | 3300049823 | Bacteria | 1385 |
| 231 | Ga0501045_0020289 | 3300049824 | Bacteria | 4747 |
| 232 | Ga0500635_0000148 | 3300053080 | Bacteria | 39620 |
| 233 | Ga0495655_0001528 | 3300053083 | Bacteria | 3554 |
| 234 | Ga0500616_0000027 | 3300053153 | Bacteria | 441053 |
| 235 | 2537900828 | 2537561592 | Bacteria | 4348607 |
| 236 | 2588107700 | 2585428157 | Bacteria | 3018951 |
| 237 | 2643876320 | 2643221572 | Bacteria | 3614809 |
| 238 | 2644113670 | 2643221619 | Bacteria | 4158469 |
| 239 | 2644182522 | 2643221632 | Bacteria | 3406696 |
| 240 | 2644197233 | 2643221635 | Bacteria | 2632343 |
| 241 | 2644383375 | 2643221669 | Bacteria | 3611286 |
| 242 | 2747953516 | 2747842429 | Bacteria | 3914386 |
| 243 | 2753303566 | 2751185788 | Bacteria | 4541048 |
| 244 | 2758225049 | 2757320536 | Bacteria | 3629334 |
| 245 | 2774379089 | 2773857758 | Bacteria | 3592392 |
| 246 | 2810365935 | 2808606700 | Bacteria | 3482157 |
| 247 | 2857480069 | 2857479173 | Bacteria | 2469263 |
| 248 | 2857633333 | 2857632687 | Bacteria | 2448521 |
| 249 | 2857729831 | 2857729791 | Bacteria | 4040535 |
| 250 | 2862993506 | 2862993130 | Bacteria | 3860849 |
| 251 | 2870803224 | 2870801768 | Bacteria | 2710986 |
| 252 | 2870805269 | 2870804320 | Bacteria | 2552467 |
| 253 | 2884766257 | 2884763398 | Bacteria | 4091164 |
| 254 | 2895660500 | 2895660088 | Bacteria | 3782833 |
| 255 | 2904432520 | 2904430863 | Bacteria | 3486923 |
| 256 | 2904501696 | 2904501621 | Bacteria | 3401437 |
| 257 | 2904510554 | 2904509784 | Bacteria | 3520416 |
| 258 | 2905928288 | 2905926851 | Bacteria | 4423176 |
| 259 | 2908676250 | 2908674828 | Bacteria | 3382763 |
| 260 | 2908678228 | 2908678064 | Bacteria | 3482747 |
| 261 | 2909077135 | 2909074476 | Bacteria | 3436050 |
| 262 | 2919041891 | 2919039151 | Bacteria | 3391018 |
| 263 | 2919043326 | 2919042368 | Bacteria | 3905917 |
| 264 | 2919070537 | 2919069694 | Bacteria | 3622919 |
| 265 | 2928105607 | 2928104781 | Bacteria | 3877447 |
| 266 | 2928123081 | 2928121344 | Bacteria | 3972376 |
| 267 | 2928500873 | 2928500415 | Bacteria | 3384541 |
| 268 | 2939662845 | 2939660829 | Bacteria | 3784848 |
| 269 | 2946003748 | 2946003308 | Bacteria | 3857229 |
| 270 | 2964328568 | 2964326757 | Bacteria | 3290868 |
| 271 | 2974295104 | 2974294766 | Bacteria | 3767688 |
| 272 | 2974325094 | 2974324384 | Bacteria | 3750535 |
| 273 | 2977238918 | 2977236895 | Bacteria | 3569373 |
| 274 | 2977265311 | 2977264416 | Bacteria | 3750737 |
| 275 | 2984543298 | 2984542743 | Bacteria | 3569378 |
| 276 | 2984551847 | 2984551494 | Bacteria | 3877562 |
| 277 | 8016255390 | 8016254467 | Bacteria | 3797036 |
| 278 | 8057347508 | 8057345674 | Bacteria | 4160394 |
| 279 | Ga0157375_10206162 | |||
| 280 | JGI25154J39366_1001722 | |||
| 281 | JGI25164J39214_1000361 | |||
| 282 | JGI25165J46597_1000061 | |||
| 283 | rootH1_10282109 | |||
| 284 | Ga0055527_1000017 | |||
| 285 | Ga0055542_1000044 | |||
| 286 | Ga0055529_1000093 | |||
| 287 | Ga0065714_10075106 | |||
| 288 | Ga0070658_10072387 | |||
| 289 | Ga0070676_10003239 | |||
| 290 | Ga0070666_10018001 | |||
| 291 | Ga0070668_100061571 | |||
| 292 | Ga0070669_100060436 | |||
| 293 | Ga0070675_100004373 | |||
| 294 | Ga0070674_100011248 | |||
| 295 | Ga0070673_100202309 | |||
| 296 | Ga0070667_100019782 | |||
| 297 | Ga0070678_100018129 | |||
| 298 | Ga0070672_100049546 | |||
| 299 | Ga0070665_100298982 | |||
| 300 | Ga0075369_10029539 | |||
| 301 | Ga0105251_10020620 | |||
| 302 | Ga0105244_10010186 | |||
| 303 | Ga0105244_10011581 | |||
| 304 | Ga0105244_10025380 | |||
| 305 | Ga0105248_10129689 | |||
| 306 | Ga0105246_10045230 | |||
| 307 | Ga0157369_10008976 | |||
| 308 | Ga0157369_10029404 | |||
| 309 | Ga0157369_10214275 | |||
| 310 | Ga0157372_10141537 | |||
| 311 | Ga0157375_10010664 | |||
| 312 | Ga0209672_100039 | |||
| 313 | Ga0209147_100366 | |||
| 314 | Ga0207427_100042 | |||
| 315 | Ga0209437_108120 | |||
| 316 | Ga0209258_102578 | |||
| 317 | Ga0209646_1000202 | |||
| 318 | Ga0209148_1000004 | |||
| 319 | Ga0209233_1000001 | |||
| 320 | Ga0209455_1000117 | |||
| 321 | Ga0207697_10006266 | |||
| 322 | Ga0207655_1018512 | |||
| 323 | Ga0207713_1026721 | |||
| 324 | Ga0207647_10091326 | |||
| 325 | Ga0207645_10001051 | |||
| 326 | Ga0207705_10144268 | |||
| 327 | Ga0207650_10024922 | |||
| 328 | Ga0207659_10013264 | |||
| 329 | Ga0207644_10284990 | |||
| 330 | Ga0207691_10003865 | |||
| 331 | Ga0207683_10001048 | |||
| 332 | Ga0307408_100086790 | |||
| 333 | Ga0307410_10022188 | |||
| 334 | Ga0307406_10000390 | |||
| 335 | Ga0307407_10077394 | |||
| 336 | Ga0307412_10060164 | |||
| 337 | Ga0307412_10281595 | |||
| 338 | Ga0307416_100016324 | |||
| 339 | Ga0307416_100207581 | |||
| 340 | Ga0307415_100088546 | |||
| 341 | Ga0395899_0183766 | |||
| 342 | Ga0395900_0009655 | |||
| 343 | Ga0395900_0014143 | |||
| 344 | Ga0395898_0000256 | |||
| 345 | Ga0395898_0210966 | |||
| 346 | Ga0439461_0028322 | |||
| 347 | Ga0439466_0011551 | |||
| 348 | Ga0439465_0000696 | |||
| 349 | Ga0451806_541812 | |||
| 350 | Ga0439431_0006372 | |||
| 351 | Ga0466965_0103966 | |||
| 352 | Ga0466961_0075950 | |||
| 353 | Ga0466971_0021444 | |||
| 354 | Ga0466970_0035583 | |||
| 355 | Ga0466957_0088241 | |||
| 356 | Ga0466959_0012661 | |||
| 357 | Ga0466967_0004767 | |||
| 358 | Ga0466967_0006279 | |||
| 359 | Ga0495580_0004788 | |||
| 360 | Ga0495580_0095115 | |||
| 361 | Ga0495582_0134115 | |||
| 362 | Ga0495639_0028281 | |||
| 363 | Ga0495607_0075918 | |||
| 364 | Ga0495665_0029931 | |||
| 365 | Ga0495586_0038003 | |||
| 366 | Ga0495588_0008901 | |||
| 367 | Ga0495588_0016760 | |||
| 368 | Ga0495670_0130028 | |||
| 369 | Ga0495677_0069696 | |||
| 370 | Ga0495626_0040488 | |||
| 371 | Ga0496100_0014892 | |||
| 372 | Ga0496100_0056425 | |||
| 373 | Ga0496101_0108529 | |||
| 374 | Ga0496102_0050694 | |||
| 375 | Ga0496102_0092342 | |||
| 376 | Ga0496103_0013743 | |||
| 377 | Ga0496103_0080504 | |||
| 378 | Ga0496103_0193604 | |||
| 379 | Ga0496104_0024563 | |||
| 380 | Ga0496104_0129847 | |||
| 381 | Ga0496105_0033355 | |||
| 382 | Ga0496106_0026722 | |||
| 383 | Ga0496106_0031768 | |||
| 384 | Ga0496107_0001905 | |||
| 385 | Ga0496107_0225234 | |||
| 386 | Ga0496108_0225313 | |||
| 387 | Ga0496109_0060345 | |||
| 388 | Ga0496109_0072074 | |||
| 389 | Ga0496110_0211894 | |||
| 390 | Ga0496111_0225637 | |||
| 391 | Ga0496111_0310505 | |||
| 392 | Ga0496113_0013408 | |||
| 393 | Ga0496113_0016241 | |||
| 394 | Ga0496114_0010992 | |||
| 395 | Ga0496114_0068572 | |||
| 396 | Ga0496114_0780239 | |||
| 397 | Ga0496115_0053433 | |||
| 398 | Ga0496115_0075129 | |||
| 399 | Ga0496115_0146871 | |||
| 400 | Ga0496117_0000014 | |||
| 401 | Ga0496117_0000187 | |||
| 402 | Ga0496117_0000515 | |||
| 403 | Ga0496117_0012029 | |||
| 404 | Ga0496117_0017928 | |||
| 405 | Ga0496118_0000173 | |||
| 406 | Ga0496118_0003252 | |||
| 407 | Ga0496118_0030858 | |||
| 408 | Ga0496118_0123766 | |||
| 409 | Ga0496119_0001768 | |||
| 410 | Ga0496119_0006205 | |||
| 411 | Ga0496119_0012765 | |||
| 412 | Ga0496119_0106261 | |||
| 413 | Ga0496120_0000462 | |||
| 414 | Ga0496120_0005946 | |||
| 415 | Ga0496120_0076828 | |||
| 416 | Ga0496120_0117032 | |||
| 417 | Ga0496121_0164756 | |||
| 418 | Ga0496122_0008143 | |||
| 419 | Ga0496122_0016744 | |||
| 420 | Ga0496122_0026202 | |||
| 421 | Ga0496122_0031551 | |||
| 422 | Ga0496122_0091051 | |||
| 423 | Ga0496122_0130220 | |||
| 424 | Ga0496123_0005624 | |||
| 425 | Ga0496123_0005822 | |||
| 426 | Ga0496123_0032473 | |||
| 427 | Ga0496123_0260669 | |||
| 428 | Ga0496124_0000135 | |||
| 429 | Ga0496124_0014894 | |||
| 430 | Ga0496124_0071744 | |||
| 431 | Ga0496124_0165728 | |||
| 432 | Ga0496124_0387367 | |||
| 433 | Ga0496125_0002725 | |||
| 434 | Ga0496125_0081596 | |||
| 435 | Ga0496126_0000639 | |||
| 436 | Ga0496126_0005293 | |||
| 437 | Ga0496126_0011140 | |||
| 438 | Ga0496126_0187102 | |||
| 439 | Ga0501031_0005991 | |||
| 440 | Ga0501032_0012060 | |||
| 441 | Ga0501032_0014286 | |||
| 442 | Ga0501032_0016473 | |||
| 443 | Ga0501033_0004678 | |||
| 444 | Ga0501033_0010787 | |||
| 445 | Ga0501033_0011928 | |||
| 446 | Ga0501033_0034689 | |||
| 447 | Ga0501033_0086767 | |||
| 448 | Ga0501034_0007613 | |||
| 449 | Ga0501034_0015626 | |||
| 450 | Ga0501034_0141375 | |||
| 451 | Ga0501034_0162506 | |||
| 452 | Ga0501034_0216615 | |||
| 453 | Ga0501034_0340656 | |||
| 454 | Ga0501036_0013730 | |||
| 455 | Ga0501036_0015287 | |||
| 456 | Ga0501036_0057463 | |||
| 457 | Ga0501036_0235623 | |||
| 458 | Ga0501037_0007759 | |||
| 459 | Ga0501037_0009584 | |||
| 460 | Ga0501037_0020512 | |||
| 461 | Ga0501038_0005743 | |||
| 462 | Ga0501038_0027091 | |||
| 463 | Ga0501038_0028876 | |||
| 464 | Ga0501038_0064798 | |||
| 465 | Ga0501039_0006255 | |||
| 466 | Ga0501042_0000296 | |||
| 467 | Ga0501042_0102390 | |||
| 468 | Ga0501043_0003890 | |||
| 469 | Ga0501043_0077650 | |||
| 470 | Ga0501043_0087232 | |||
| 471 | Ga0501043_0111903 | |||
| 472 | Ga0501043_0192522 | |||
| 473 | Ga0501046_0010930 | |||
| 474 | Ga0501046_0022327 | |||
| 475 | Ga0501046_0048917 | |||
| 476 | Ga0501047_0006203 | |||
| 477 | Ga0501047_0011483 | |||
| 478 | Ga0501047_0043744 | |||
| 479 | Ga0501047_0045313 | |||
| 480 | Ga0501047_0192692 | |||
| 481 | Ga0501047_0365367 | |||
| 482 | Ga0501048_0001986 | |||
| 483 | Ga0501048_0045365 | |||
| 484 | Ga0501068_0069580 | |||
| 485 | Ga0501070_0001029 | |||
| 486 | Ga0501070_0047651 | |||
| 487 | Ga0501070_0091564 | |||
| 488 | Ga0501070_0253733 | |||
| 489 | Ga0501073_0035323 | |||
| 490 | Ga0501073_0049168 | |||
| 491 | Ga0501080_0087144 | |||
| 492 | Ga0501080_0493964 | |||
| 493 | Ga0501083_0000059 | |||
| 494 | Ga0501083_0079617 | |||
| 495 | Ga0501035_0004345 | |||
| 496 | Ga0501035_0008147 | |||
| 497 | Ga0501035_0055451 | |||
| 498 | Ga0501035_0067066 | |||
| 499 | Ga0501035_0081973 | |||
| 500 | Ga0501035_0111448 | |||
| 501 | Ga0501035_0146874 | |||
| 502 | Ga0501044_0014298 | |||
| 503 | Ga0501044_0023486 | |||
| 504 | Ga0501044_0028791 | |||
| 505 | Ga0501044_0031275 | |||
| 506 | Ga0501044_0036240 | |||
| 507 | Ga0501044_0115636 | |||
| 508 | Ga0501044_0354757 | |||
| 509 | Ga0501045_0020289 | |||
| 510 | Ga0500635_0000148 | |||
| 511 | Ga0495655_0001528 | |||
| 512 | Ga0500616_0000027 | |||
| 513 | 2537900828 | |||
| 514 | 2588107700 | |||
| 515 | 2643876320 | |||
| 516 | 2644113670 | |||
| 517 | 2644182522 | |||
| 518 | 2644197233 | |||
| 519 | 2644383375 | |||
| 520 | 2747953516 | |||
| 521 | 2753303566 | |||
| 522 | 2758225049 | |||
| 523 | 2774379089 | |||
| 524 | 2810365935 | |||
| 525 | 2857480069 | |||
| 526 | 2857633333 | |||
| 527 | 2857729831 | |||
| 528 | 2862993506 | |||
| 529 | 2870803224 | |||
| 530 | 2870805269 | |||
| 531 | 2884766257 | |||
| 532 | 2895660500 | |||
| 533 | 2904432520 | |||
| 534 | 2904501696 | |||
| 535 | 2904510554 | |||
| 536 | 2905928288 | |||
| 537 | 2908676250 | |||
| 538 | 2908678228 | |||
| 539 | 2909077135 | |||
| 540 | 2919041891 | |||
| 541 | 2919043326 | |||
| 542 | 2919070537 | |||
| 543 | 2928105607 | |||
| 544 | 2928123081 | |||
| 545 | 2928500873 | |||
| 546 | 2939662845 | |||
| 547 | 2946003748 | |||
| 548 | 2964328568 | |||
| 549 | 2974295104 | |||
| 550 | 2974325094 | |||
| 551 | 2977238918 | |||
| 552 | 2977265311 | |||
| 553 | 2984543298 | |||
| 554 | 2984551847 | |||
| 555 | 8016255390 | |||
| 556 | 8057347508 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3os7-assembly4.cif.gz_D | crystal structure of a galactose mutarotase-like protein (ca_c0697) from clostridium acetobutylicum at 1.80 a resolution | 0.8832 | 38 | 326 |
| 3mwx-assembly2.cif.gz_B | crystal structure of a putative galactose mutarotase (bsu18360) from bacillus subtilis at 1.45 a resolution | 0.8734 | 38 | 326 |
| 1lur-assembly2.cif.gz_B | crystal structure of the galm/aldose epimerase homologue from c. elegans, northeast structural genomics target wr66 | 0.8669 | 37 | 326 |
| 3nre-assembly4.cif.gz_D | crystal structure of a putative aldose 1-epimerase (b2544) from escherichia coli k12 at 1.59 a resolution | 0.8617 | 37 | 326 |
| 1so0-assembly4.cif.gz_D | crystal structure of human galactose mutarotase complexed with galactose | 0.8527 | 35 | 326 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P32139_19_304_2.70.98.10 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.9289 | 37 | 323 | 2.70.98.10 |
| af_P32139_19_304_2.70.98.10 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.9226 | 37 | 323 | 2.70.98.10 |
| 3os7B00 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.8776 | 38 | 326 | 2.70.98.10 |
| af_Q33AZ5_28_362_2.70.98.10 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.8602 | 34 | 326 | 2.70.98.10 |
| af_Q9VRU1_15_363_2.70.98.10 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.8568 | 37 | 326 | 2.70.98.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S5IYL1-F1-model_v4 | Aldose epimerase | 0.9842 | 35 | 326 |
GO:0004034
GO:0006006 GO:0030246 GO:0033499 |
| AF-A0A177K5Q4-F1-model_v4 | Galactose mutarotase | 0.9834 | 30 | 326 |
GO:0004034
GO:0006006 GO:0030246 GO:0033499 |
| AF-A0A7K1FS54-F1-model_v4 | Aldose epimerase | 0.9813 | 33 | 325 |
GO:0005975
GO:0016853 GO:0030246 |
| AF-A0A7W8ZF07-F1-model_v4 | deleted | 0.9812 | 54 | 326 |
|
| AF-A0A6J6C7G5-F1-model_v4 | Unannotated protein | 0.9778 | 57 | 326 |
GO:0004034
GO:0006006 GO:0030246 GO:0033499 |