F381782

General Info

Members Datasets Scaffolds Average Seq Length
277 183 554 147

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10453139|Ga0157374_104531392
Length 167
Sequence MRPNRHYIQQSLELAMSVDAQKSMPTVPTHQDVDLILRLYEMRREARMREARRWFATHFKVKTMDELSVTCPPGSEPNASYRMLTSYWEMVASFVTSGVLNQELFFQSNREFLFVWERIRDLAPEYRKAVSSPIEWKNLEQIAAAYIEWWNQRAPGAYEAFVKRVRG

Samples

Sample ID Description Type Environment
1 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
110 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
111 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
112 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
114 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
116 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
117 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
118 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
119 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
120 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
121 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
122 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
132 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
133 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
134 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
135 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
136 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
137 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
144 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
149 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
150 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
151 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
152 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
153 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
154 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
155 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
156 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
161 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
162 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
163 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
164 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
167 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
168 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
181 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
182 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.44
Rhizosphere 96.75
Stem 0
Stem Tuber 0
Unclassified 24.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157374_10453139 3300013296 Bacteria 1284
2 Ga0070683_100363769 3300005329 Bacteria 1378
3 Ga0070683_100460601 3300005329 Bacteria 1213
4 Ga0070683_101358374 3300005329 Unclassified 683
5 Ga0068869_101528138 3300005334 Unclassified 593
6 Ga0068868_100273078 3300005338 Bacteria 1429
7 Ga0068868_100519051 3300005338 Bacteria 1046
8 Ga0070689_100155531 3300005340 Bacteria 1846
9 Ga0070689_100203213 3300005340 Bacteria 1619
10 Ga0070687_100197737 3300005343 Unclassified 1216
11 Ga0070668_100142305 3300005347 Bacteria 1934
12 Ga0070669_100034620 3300005353 Bacteria 3657
13 Ga0070671_100023740 3300005355 Bacteria 5019
14 Ga0070674_100012293 3300005356 Bacteria 5254
15 Ga0070667_100007674 3300005367 Bacteria 8948
16 Ga0070667_100759083 3300005367 Bacteria 899
17 Ga0070709_10047720 3300005434 Bacteria 2669
18 Ga0070714_100003267 3300005435 Bacteria 12069
19 Ga0070713_100004867 3300005436 Bacteria 9106
20 Ga0070711_100057159 3300005439 Unclassified 2700
21 Ga0070711_100182833 3300005439 Bacteria 1606
22 Ga0070708_100147526 3300005445 Bacteria 2186
23 Ga0070663_100026665 3300005455 Bacteria 3916
24 Ga0070678_100377394 3300005456 Unclassified 1226
25 Ga0070681_10262453 3300005458 Bacteria 1639
26 Ga0070681_10549457 3300005458 Bacteria 1069
27 Ga0070681_10598270 3300005458 Bacteria 1017
28 Ga0070681_11045595 3300005458 Unclassified 737
29 Ga0070706_100193164 3300005467 Bacteria 1902
30 Ga0070698_101734701 3300005471 Unclassified 577
31 Ga0070679_100212469 3300005530 Bacteria 1898
32 Ga0070679_100988797 3300005530 Bacteria 785
33 Ga0070684_100027023 3300005535 Bacteria 4839
34 Ga0070684_100342772 3300005535 Bacteria 1374
35 Ga0070684_100848777 3300005535 Unclassified 855
36 Ga0070672_100028369 3300005543 Bacteria 4186
37 Ga0070686_100053248 3300005544 Bacteria 2583
38 Ga0070696_100355900 3300005546 Bacteria 1135
39 Ga0070696_101844300 3300005546 Unclassified 523
40 Ga0070693_100310011 3300005547 Bacteria 1067
41 Ga0070704_100660234 3300005549 Bacteria 924
42 Ga0070664_100394856 3300005564 Bacteria 1264
43 Ga0070702_100384602 3300005615 Unclassified 999
44 Ga0068852_101312941 3300005616 Unclassified 745
45 Ga0068859_100133457 3300005617 Bacteria 2555
46 Ga0068861_100254655 3300005719 Bacteria 1500
47 Ga0068861_100392954 3300005719 Bacteria 1229
48 Ga0068858_100091044 3300005842 Bacteria 2839
49 Ga0068858_100673918 3300005842 Bacteria 1005
50 Ga0068860_100208407 3300005843 Bacteria 1896
51 Ga0068862_100020885 3300005844 Bacteria 5470
52 Ga0068862_100533718 3300005844 Bacteria 1118
53 Ga0081455_10064365 3300005937 Bacteria 3070
54 Ga0081455_10066417 3300005937 Bacteria 3012
55 Ga0070717_10011357 3300006028 Bacteria 6761
56 Ga0075432_10436420 3300006058 Unclassified 572
57 Ga0070715_10209790 3300006163 Bacteria 995
58 Ga0070716_100119294 3300006173 Unclassified 1649
59 Ga0097621_100000864 3300006237 Bacteria 21281
60 Ga0097621_100049169 3300006237 Bacteria 3425
61 Ga0097621_100061136 3300006237 Bacteria 3089
62 Ga0068871_100000670 3300006358 Bacteria 23450
63 Ga0068871_100066351 3300006358 Bacteria 2958
64 Ga0068871_100449325 3300006358 Bacteria 1155
65 Ga0068871_100808106 3300006358 Bacteria 865
66 Ga0075428_100482665 3300006844 Bacteria 1326
67 Ga0075433_10042119 3300006852 Bacteria 3960
68 Ga0075433_11352326 3300006852 Bacteria 617
69 Ga0075434_100286719 3300006871 Unclassified 1666
70 Ga0075434_100680039 3300006871 Bacteria 1047
71 Ga0075434_100962950 3300006871 Bacteria 868
72 Ga0075429_100373256 3300006880 Bacteria 1249
73 Ga0075429_101215908 3300006880 Bacteria 658
74 Ga0068865_100893762 3300006881 Unclassified 772
75 Ga0068865_101056452 3300006881 Unclassified 713
76 Ga0075436_100745069 3300006914 Unclassified 727
77 Ga0075436_101327439 3300006914 Unclassified 544
78 Ga0097620_100133454 3300006931 Bacteria 2555
79 Ga0097620_100813525 3300006931 Bacteria 1021
80 Ga0075435_100329279 3300007076 Unclassified 1308
81 Ga0075435_101190714 3300007076 Bacteria 667
82 Ga0111539_10021424 3300009094 Bacteria 7956
83 Ga0111539_10038924 3300009094 Bacteria 5734
84 Ga0111539_10326294 3300009094 Bacteria 1787
85 Ga0105247_10290894 3300009101 Bacteria 1130
86 Ga0114129_10019206 3300009147 Bacteria 9738
87 Ga0114129_10198336 3300009147 Bacteria 2720
88 Ga0114129_12192313 3300009147 Unclassified 665
89 Ga0105243_11083192 3300009148 Bacteria 809
90 Ga0105241_11292184 3300009174 Bacteria 694
91 Ga0105242_10048830 3300009176 Bacteria 3441
92 Ga0105242_10207976 3300009176 Bacteria 1742
93 Ga0105248_10009361 3300009177 Bacteria 10783
94 Ga0105248_10304602 3300009177 Unclassified 1794
95 Ga0105248_10323935 3300009177 Bacteria 1736
96 Ga0105248_10361073 3300009177 Bacteria 1635
97 Ga0105248_11358731 3300009177 Unclassified 804
98 Ga0105249_10201589 3300009553 Bacteria 1947
99 Ga0105246_10141792 3300011119 Bacteria 1808
100 Ga0157369_11811256 3300013105 Unclassified 620
101 Ga0157378_10011260 3300013297 Bacteria 7825
102 Ga0157378_10038207 3300013297 Bacteria 4254
103 Ga0157378_10394272 3300013297 Bacteria 1362
104 Ga0163162_10014787 3300013306 Bacteria 7623
105 Ga0163162_11070995 3300013306 Bacteria 913
106 Ga0157372_11747674 3300013307 Unclassified 715
107 Ga0157375_10269891 3300013308 Bacteria 1863
108 Ga0157375_10647581 3300013308 Bacteria 1213
109 Ga0157375_11969786 3300013308 Unclassified 694
110 Ga0163163_10612929 3300014325 Bacteria 1152
111 Ga0157380_10351714 3300014326 Unclassified 1379
112 Ga0157380_10943294 3300014326 Bacteria 892
113 Ga0157379_10016258 3300014968 Bacteria 6548
114 Ga0157379_10098971 3300014968 Bacteria 2618
115 Ga0157376_10048927 3300014969 Bacteria 3500
116 Ga0157376_10118525 3300014969 Bacteria 2342
117 Ga0157376_10138003 3300014969 Bacteria 2184
118 Ga0157376_10402640 3300014969 Bacteria 1324
119 Ga0163161_10130767 3300017792 Unclassified 1893
120 Ga0213875_10005490 3300021388 Bacteria 6797
121 Ga0207692_10650029 3300025898 Unclassified 681
122 Ga0207688_10015980 3300025901 Unclassified 4069
123 Ga0207688_10174615 3300025901 Bacteria 1279
124 Ga0207680_10815502 3300025903 Bacteria 669
125 Ga0207685_10019652 3300025905 Bacteria 2230
126 Ga0207699_10078869 3300025906 Bacteria 2035
127 Ga0207707_10066386 3300025912 Bacteria 3142
128 Ga0207707_10497966 3300025912 Unclassified 1039
129 Ga0207707_10605583 3300025912 Unclassified 927
130 Ga0207663_10020521 3300025916 Bacteria 3743
131 Ga0207663_10550605 3300025916 Bacteria 902
132 Ga0207652_10473980 3300025921 Bacteria 1128
133 Ga0207652_11676070 3300025921 Unclassified 540
134 Ga0207681_10019718 3300025923 Bacteria 4266
135 Ga0207659_11134236 3300025926 Bacteria 672
136 Ga0207700_10093840 3300025928 Bacteria 2376
137 Ga0207664_10008150 3300025929 Bacteria 7293
138 Ga0207644_10015249 3300025931 Bacteria 5156
139 Ga0207644_11612361 3300025931 Unclassified 544
140 Ga0207706_10474479 3300025933 Bacteria 1081
141 Ga0207706_10670988 3300025933 Bacteria 887
142 Ga0207686_10105226 3300025934 Bacteria 1892
143 Ga0207670_10089392 3300025936 Bacteria 2174
144 Ga0207669_10002089 3300025937 Bacteria 8465
145 Ga0207665_10167796 3300025939 Unclassified 1583
146 Ga0207691_10007328 3300025940 Bacteria 10640
147 Ga0207711_10019525 3300025941 Bacteria 5641
148 Ga0207689_10267795 3300025942 Bacteria 1414
149 Ga0207661_10184838 3300025944 Bacteria 1823
150 Ga0207661_10306477 3300025944 Bacteria 1425
151 Ga0207661_11737514 3300025944 Unclassified 569
152 Ga0207679_10386772 3300025945 Bacteria 1228
153 Ga0207651_10026908 3300025960 Bacteria 3603
154 Ga0207668_10056497 3300025972 Bacteria 2734
155 Ga0207668_10401307 3300025972 Bacteria 1159
156 Ga0207658_10023056 3300025986 Bacteria 4340
157 Ga0207677_10479201 3300026023 Bacteria 1072
158 Ga0207677_10481544 3300026023 Bacteria 1069
159 Ga0207703_10068026 3300026035 Bacteria 2933
160 Ga0207703_10150437 3300026035 Bacteria 2029
161 Ga0207676_10549035 3300026095 Unclassified 1104
162 Ga0207674_10472941 3300026116 Bacteria 1211
163 Ga0207675_100162648 3300026118 Bacteria 2130
164 Ga0207675_100219455 3300026118 Bacteria 1832
165 Ga0209970_1023638 3300027614 Bacteria 1047
166 Ga0207428_10011959 3300027907 Bacteria 7639
167 Ga0207428_10492293 3300027907 Bacteria 891
168 Ga0268265_10004933 3300028380 Bacteria 9178
169 Ga0265316_10435291 3300031344 Bacteria 942
170 Ga0307408_100186277 3300031548 Bacteria 1669
171 Ga0265314_10063034 3300031711 Bacteria 2516
172 Ga0373934_0250812 3300035086 Unclassified 732
173 Ga0373940_0036040 3300035088 Bacteria 1342
174 Ga0373951_0151583 3300035091 Bacteria 650
175 Ga0373923_0067685 3300035111 Bacteria 1528
176 Ga0373932_0058152 3300035112 Unclassified 1168
177 Ga0373936_0015242 3300035113 Bacteria 2944
178 Ga0373936_0282704 3300035113 Bacteria 746
179 Ga0373936_0315179 3300035113 Unclassified 708
180 Ga0373939_0238379 3300035114 Bacteria 703
181 Ga0373941_0056997 3300035115 Bacteria 1260
182 Ga0373945_0037809 3300035116 Bacteria 1734
183 Ga0373956_0042975 3300035119 Bacteria 2011
184 Ga0373943_0013909 3300035170 Bacteria 3638
185 Ga0373943_0023226 3300035170 Unclassified 2882
186 Ga0373946_0002996 3300035171 Bacteria 5983
187 Ga0373946_0157486 3300035171 Bacteria 1064
188 Ga0373955_0013966 3300035172 Bacteria 3898
189 Ga0373955_0107275 3300035172 Bacteria 1611
190 Ga0373955_0529071 3300035172 Unclassified 721
191 Ga0373924_0033078 3300035410 Bacteria 2085
192 Ga0373924_0393541 3300035410 Unclassified 619
193 Ga0373931_0366875 3300035691 Bacteria 905
194 Ga0373935_0089684 3300035692 Bacteria 2011
195 Ga0373935_0633092 3300035692 Bacteria 784
196 Ga0373927_0067714 3300035695 Unclassified 2310
197 Ga0373927_0196265 3300035695 Unclassified 1324
198 Ga0373947_0000132 3300035725 Bacteria 38535
199 Ga0373947_0009621 3300035725 Bacteria 5548
200 Ga0373947_0077401 3300035725 Bacteria 2051
201 Ga0373937_0005484 3300036401 Bacteria 10870
202 Ga0373937_0660036 3300036401 Bacteria 991
203 Ga0373937_1276476 3300036401 Unclassified 682
204 Ga0373925_0000494 3300037068 Bacteria 39696
205 Ga0373925_0002531 3300037068 Bacteria 14558
206 Ga0436364_0511680 3300037853 Unclassified 1877
207 Ga0436364_1473467 3300037853 Bacteria 9806
208 Ga0436365_1036418 3300039437 Unclassified 828
209 Ga0436365_1757953 3300039437 Bacteria 6550
210 Ga0450894_000597 3300042131 Bacteria 6084
211 Ga0450895_004857 3300042132 Unclassified 1072
212 Ga0450896_003604 3300042133 Bacteria 2065
213 Ga0450910_007124 3300042147 Bacteria 1555
214 Ga0450908_009616 3300042184 Bacteria 1793
215 Ga0450908_016223 3300042184 Bacteria 1330
216 Ga0450916_001655 3300042530 Bacteria 2251
217 Ga0453683_0184954 3300044673 Unclassified 1322
218 Ga0451576_0285388 3300045051 Unclassified 1726
219 Ga0451576_0522696 3300045051 Bacteria 1247
220 Ga0451576_1143819 3300045051 Unclassified 814
221 Ga0495629_0258650 3300046459 Bacteria 1197
222 Ga0495651_0735613 3300046462 Unclassified 613
223 Ga0495580_0429102 3300046472 Unclassified 888
224 Ga0495580_0481554 3300046472 Unclassified 830
225 Ga0495580_0739586 3300046472 Unclassified 641
226 Ga0495582_0107954 3300046473 Bacteria 1563
227 Ga0495639_0075528 3300046475 Bacteria 1562
228 Ga0495608_0014302 3300046511 Bacteria 5506
229 Ga0495628_0346173 3300046516 Bacteria 1093
230 Ga0495630_0006758 3300046517 Bacteria 8172
231 Ga0495652_0204844 3300046529 Bacteria 1494
232 Ga0495665_0331967 3300046531 Unclassified 776
233 Ga0495640_0303941 3300046533 Unclassified 990
234 Ga0495586_0222777 3300046535 Bacteria 1072
235 Ga0495587_0126479 3300046536 Bacteria 1462
236 Ga0495656_0529502 3300046615 Unclassified 627
237 Ga0495659_0017177 3300046664 Unclassified 2394
238 Ga0495599_0313008 3300046678 Bacteria 946
239 Ga0495646_0507968 3300046680 Unclassified 618
240 Ga0495647_0113516 3300046681 Bacteria 1133
241 Ga0495647_0137682 3300046681 Bacteria 1039
242 Ga0495658_0300453 3300046683 Bacteria 1015
243 Ga0495669_0002698 3300046684 Bacteria 7275
244 Ga0495669_0091967 3300046684 Bacteria 1401
245 Ga0495669_0328949 3300046684 Unclassified 738
246 Ga0495613_0000509 3300046689 Bacteria 32621
247 Ga0495624_0301040 3300046690 Bacteria 967
248 Ga0495600_0014874 3300046809 Bacteria 4910
249 Ga0495581_0223674 3300047315 Bacteria 1101
250 Ga0495604_0008674 3300047317 Bacteria 8033
251 Ga0495674_0056774 3300047319 Bacteria 3428
252 Ga0495676_0842456 3300047321 Unclassified 589
253 Ga0495680_0452481 3300047322 Unclassified 878
254 Ga0495675_0152357 3300047444 Bacteria 1428
255 Ga0495684_0000235 3300047471 Bacteria 43518
256 Ga0496102_0621112 3300048905 Bacteria 1004
257 Ga0496105_1009769 3300048908 Unclassified 622
258 Ga0496106_0194239 3300048909 Bacteria 1614
259 Ga0496115_0381539 3300048918 Bacteria 1146
260 Ga0501073_0454198 3300049589 Unclassified 886
261 nmdc:mga05p37_1292195_c1 3300050507 Unclassified 745
262 nmdc:mga05p37_39504_c1 3300050507 Bacteria 5794
263 nmdc:mga09592_719293_c1 3300050508 Unclassified 849
264 nmdc:mga08y16_24308_c1 3300050511 Bacteria 6396
265 nmdc:mga08y16_331544_c1 3300050511 Bacteria 1565
266 nmdc:mga08y16_7156_c1 3300050511 Bacteria 11711
267 nmdc:mga0n895_24955_c1 3300050512 Bacteria 5642
268 nmdc:mga0n895_269789_c1 3300050512 Bacteria 1726
269 nmdc:mga0n895_500565_c1 3300050512 Bacteria 1224
270 nmdc:mga0rr50_101667_c1 3300050513 Unclassified 2260
271 nmdc:mga0a205_168404_c1 3300050515 Bacteria 2086
272 nmdc:mga0a205_19748_c1 3300050515 Bacteria 6358
273 Ga0495601_0013513 3300053077 Bacteria 4911
274 Ga0495601_0426010 3300053077 Bacteria 859
275 Ga0495612_0256011 3300053078 Bacteria 779
276 Ga0495595_0115881 3300053084 Bacteria 1302
277 Ga0495619_0005546 3300053085 Bacteria 8005
278 Ga0157374_10453139
279 Ga0070683_100363769
280 Ga0070683_100460601
281 Ga0070683_101358374
282 Ga0068869_101528138
283 Ga0068868_100273078
284 Ga0068868_100519051
285 Ga0070689_100155531
286 Ga0070689_100203213
287 Ga0070687_100197737
288 Ga0070668_100142305
289 Ga0070669_100034620
290 Ga0070671_100023740
291 Ga0070674_100012293
292 Ga0070667_100007674
293 Ga0070667_100759083
294 Ga0070709_10047720
295 Ga0070714_100003267
296 Ga0070713_100004867
297 Ga0070711_100057159
298 Ga0070711_100182833
299 Ga0070708_100147526
300 Ga0070663_100026665
301 Ga0070678_100377394
302 Ga0070681_10262453
303 Ga0070681_10549457
304 Ga0070681_10598270
305 Ga0070681_11045595
306 Ga0070706_100193164
307 Ga0070698_101734701
308 Ga0070679_100212469
309 Ga0070679_100988797
310 Ga0070684_100027023
311 Ga0070684_100342772
312 Ga0070684_100848777
313 Ga0070672_100028369
314 Ga0070686_100053248
315 Ga0070696_100355900
316 Ga0070696_101844300
317 Ga0070693_100310011
318 Ga0070704_100660234
319 Ga0070664_100394856
320 Ga0070702_100384602
321 Ga0068852_101312941
322 Ga0068859_100133457
323 Ga0068861_100254655
324 Ga0068861_100392954
325 Ga0068858_100091044
326 Ga0068858_100673918
327 Ga0068860_100208407
328 Ga0068862_100020885
329 Ga0068862_100533718
330 Ga0081455_10064365
331 Ga0081455_10066417
332 Ga0070717_10011357
333 Ga0075432_10436420
334 Ga0070715_10209790
335 Ga0070716_100119294
336 Ga0097621_100000864
337 Ga0097621_100049169
338 Ga0097621_100061136
339 Ga0068871_100000670
340 Ga0068871_100066351
341 Ga0068871_100449325
342 Ga0068871_100808106
343 Ga0075428_100482665
344 Ga0075433_10042119
345 Ga0075433_11352326
346 Ga0075434_100286719
347 Ga0075434_100680039
348 Ga0075434_100962950
349 Ga0075429_100373256
350 Ga0075429_101215908
351 Ga0068865_100893762
352 Ga0068865_101056452
353 Ga0075436_100745069
354 Ga0075436_101327439
355 Ga0097620_100133454
356 Ga0097620_100813525
357 Ga0075435_100329279
358 Ga0075435_101190714
359 Ga0111539_10021424
360 Ga0111539_10038924
361 Ga0111539_10326294
362 Ga0105247_10290894
363 Ga0114129_10019206
364 Ga0114129_10198336
365 Ga0114129_12192313
366 Ga0105243_11083192
367 Ga0105241_11292184
368 Ga0105242_10048830
369 Ga0105242_10207976
370 Ga0105248_10009361
371 Ga0105248_10304602
372 Ga0105248_10323935
373 Ga0105248_10361073
374 Ga0105248_11358731
375 Ga0105249_10201589
376 Ga0105246_10141792
377 Ga0157369_11811256
378 Ga0157378_10011260
379 Ga0157378_10038207
380 Ga0157378_10394272
381 Ga0163162_10014787
382 Ga0163162_11070995
383 Ga0157372_11747674
384 Ga0157375_10269891
385 Ga0157375_10647581
386 Ga0157375_11969786
387 Ga0163163_10612929
388 Ga0157380_10351714
389 Ga0157380_10943294
390 Ga0157379_10016258
391 Ga0157379_10098971
392 Ga0157376_10048927
393 Ga0157376_10118525
394 Ga0157376_10138003
395 Ga0157376_10402640
396 Ga0163161_10130767
397 Ga0213875_10005490
398 Ga0207692_10650029
399 Ga0207688_10015980
400 Ga0207688_10174615
401 Ga0207680_10815502
402 Ga0207685_10019652
403 Ga0207699_10078869
404 Ga0207707_10066386
405 Ga0207707_10497966
406 Ga0207707_10605583
407 Ga0207663_10020521
408 Ga0207663_10550605
409 Ga0207652_10473980
410 Ga0207652_11676070
411 Ga0207681_10019718
412 Ga0207659_11134236
413 Ga0207700_10093840
414 Ga0207664_10008150
415 Ga0207644_10015249
416 Ga0207644_11612361
417 Ga0207706_10474479
418 Ga0207706_10670988
419 Ga0207686_10105226
420 Ga0207670_10089392
421 Ga0207669_10002089
422 Ga0207665_10167796
423 Ga0207691_10007328
424 Ga0207711_10019525
425 Ga0207689_10267795
426 Ga0207661_10184838
427 Ga0207661_10306477
428 Ga0207661_11737514
429 Ga0207679_10386772
430 Ga0207651_10026908
431 Ga0207668_10056497
432 Ga0207668_10401307
433 Ga0207658_10023056
434 Ga0207677_10479201
435 Ga0207677_10481544
436 Ga0207703_10068026
437 Ga0207703_10150437
438 Ga0207676_10549035
439 Ga0207674_10472941
440 Ga0207675_100162648
441 Ga0207675_100219455
442 Ga0209970_1023638
443 Ga0207428_10011959
444 Ga0207428_10492293
445 Ga0268265_10004933
446 Ga0265316_10435291
447 Ga0307408_100186277
448 Ga0265314_10063034
449 Ga0373934_0250812
450 Ga0373940_0036040
451 Ga0373951_0151583
452 Ga0373923_0067685
453 Ga0373932_0058152
454 Ga0373936_0015242
455 Ga0373936_0282704
456 Ga0373936_0315179
457 Ga0373939_0238379
458 Ga0373941_0056997
459 Ga0373945_0037809
460 Ga0373956_0042975
461 Ga0373943_0013909
462 Ga0373943_0023226
463 Ga0373946_0002996
464 Ga0373946_0157486
465 Ga0373955_0013966
466 Ga0373955_0107275
467 Ga0373955_0529071
468 Ga0373924_0033078
469 Ga0373924_0393541
470 Ga0373931_0366875
471 Ga0373935_0089684
472 Ga0373935_0633092
473 Ga0373927_0067714
474 Ga0373927_0196265
475 Ga0373947_0000132
476 Ga0373947_0009621
477 Ga0373947_0077401
478 Ga0373937_0005484
479 Ga0373937_0660036
480 Ga0373937_1276476
481 Ga0373925_0000494
482 Ga0373925_0002531
483 Ga0436364_0511680
484 Ga0436364_1473467
485 Ga0436365_1036418
486 Ga0436365_1757953
487 Ga0450894_000597
488 Ga0450895_004857
489 Ga0450896_003604
490 Ga0450910_007124
491 Ga0450908_009616
492 Ga0450908_016223
493 Ga0450916_001655
494 Ga0453683_0184954
495 Ga0451576_0285388
496 Ga0451576_0522696
497 Ga0451576_1143819
498 Ga0495629_0258650
499 Ga0495651_0735613
500 Ga0495580_0429102
501 Ga0495580_0481554
502 Ga0495580_0739586
503 Ga0495582_0107954
504 Ga0495639_0075528
505 Ga0495608_0014302
506 Ga0495628_0346173
507 Ga0495630_0006758
508 Ga0495652_0204844
509 Ga0495665_0331967
510 Ga0495640_0303941
511 Ga0495586_0222777
512 Ga0495587_0126479
513 Ga0495656_0529502
514 Ga0495659_0017177
515 Ga0495599_0313008
516 Ga0495646_0507968
517 Ga0495647_0113516
518 Ga0495647_0137682
519 Ga0495658_0300453
520 Ga0495669_0002698
521 Ga0495669_0091967
522 Ga0495669_0328949
523 Ga0495613_0000509
524 Ga0495624_0301040
525 Ga0495600_0014874
526 Ga0495581_0223674
527 Ga0495604_0008674
528 Ga0495674_0056774
529 Ga0495676_0842456
530 Ga0495680_0452481
531 Ga0495675_0152357
532 Ga0495684_0000235
533 Ga0496102_0621112
534 Ga0496105_1009769
535 Ga0496106_0194239
536 Ga0496115_0381539
537 Ga0501073_0454198
538 nmdc:mga05p37_1292195_c1
539 nmdc:mga05p37_39504_c1
540 nmdc:mga09592_719293_c1
541 nmdc:mga08y16_24308_c1
542 nmdc:mga08y16_331544_c1
543 nmdc:mga08y16_7156_c1
544 nmdc:mga0n895_24955_c1
545 nmdc:mga0n895_269789_c1
546 nmdc:mga0n895_500565_c1
547 nmdc:mga0rr50_101667_c1
548 nmdc:mga0a205_168404_c1
549 nmdc:mga0a205_19748_c1
550 Ga0495601_0013513
551 Ga0495601_0426010
552 Ga0495612_0256011
553 Ga0495595_0115881
554 Ga0495619_0005546

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF15956

DUF4760

Domain of unknown function (DUF4760)

28

163

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xjp-assembly1.cif.gz_A cryo-em structure of eds1 and sag101 with atp-apdr 0.5274 10 143
7xdd-assembly1.cif.gz_A cryo-em structure of eds1 and pad4 0.5042 6 97
7xjp-assembly1.cif.gz_A cryo-em structure of eds1 and sag101 with atp-apdr 0.4901 10 143
7nco-assembly3.cif.gz_E glutathione-s-transferase glig mutant k127r 0.3676 9 136
7ncn-assembly3.cif.gz_F glutathione-s-transferase glig mutant s83a 0.3671 9 147
ID Description Score Start End Superfamily
af_A0A0R0KCZ2_1_112_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.4534 48 146 1.20.1050.10
af_I1JBT3_87_230_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.4239 5 146 1.20.1050.10
af_A0A0R0KCZ2_1_112_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.4111 48 146 1.20.1050.10
af_I1JBT3_87_230_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.403 5 146 1.20.1050.10
af_A0A1D6GLI4_91_226_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.3808 25 146 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A7C5AXY4-F1-model_v4 Uncharacterized protein 0.9974 7 147
AF-A0A2V8CS65-F1-model_v4 Uncharacterized protein 0.9944 12 146
AF-A0A2V7YJ05-F1-model_v4 Uncharacterized protein 0.9873 7 145
AF-A0A2V7Y318-F1-model_v4 Uncharacterized protein 0.9861 7 146
AF-A0A2V9YYY0-F1-model_v4 Uncharacterized protein 0.9804 5 143

Map