F381633

General Info

Members Datasets Scaffolds Average Seq Length
277 179 554 152

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100065900|Ga0070663_1000659002
Length 169
Sequence MPSTVAMLDLHRNLHPENGSVEVAPSETDELGPVDYIVVEFPPGVSNFTGEMAAELDKLVSARTIRVLDLIVLTKGEDGEIDALEIEDTGVGDLRTAEAELAGLLAEEDVVNLAAAMKPGTTAGVLVWENIWAAPFASAARRAGGQLIADGRIPIQAILASIEADEEGA

Samples

Sample ID Description Type Environment
1 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
2 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
96 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
103 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
109 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
110 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
111 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
112 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
113 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
114 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
115 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
116 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
117 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
118 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
119 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
120 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
121 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
122 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
123 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
124 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
125 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
126 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
127 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
128 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
129 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
130 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
131 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
132 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
133 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
134 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
135 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
138 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
139 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
162 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
163 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
164 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
165 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
166 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
171 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
172 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
173 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
174 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
177 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
178 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
179 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.19
Metatranscriptomes 1.08
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.44
Nodule 0
Rhizoplane 17.69
Rhizosphere 80.14
Stem 0
Stem Tuber 0
Unclassified 14.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070663_100065900 3300005455 Bacteria 2623
2 Ga0058860_12092947 3300004801 Unclassified 868
3 Ga0070683_100021992 3300005329 Bacteria 5694
4 Ga0070683_100679517 3300005329 Bacteria 986
5 Ga0070683_100868817 3300005329 Unclassified 865
6 Ga0070661_100837944 3300005344 Bacteria 756
7 Ga0070675_100079283 3300005354 Bacteria 2736
8 Ga0070671_100013472 3300005355 Bacteria 6593
9 Ga0070714_100569829 3300005435 Unclassified 1085
10 Ga0070714_101664353 3300005435 Bacteria 623
11 Ga0070713_100080347 3300005436 Bacteria 2780
12 Ga0070711_100322600 3300005439 Unclassified 1234
13 Ga0070700_100143267 3300005441 Bacteria 1627
14 Ga0070700_100892748 3300005441 Bacteria 723
15 Ga0070678_100629014 3300005456 Bacteria 961
16 Ga0070681_10449166 3300005458 Bacteria 1201
17 Ga0068867_101175323 3300005459 Bacteria 703
18 Ga0070684_100085175 3300005535 Bacteria 2803
19 Ga0070684_100119117 3300005535 Bacteria 2374
20 Ga0070684_100430877 3300005535 Unclassified 1218
21 Ga0068853_100199359 3300005539 Bacteria 1821
22 Ga0070686_100446047 3300005544 Bacteria 994
23 Ga0070696_100304890 3300005546 Bacteria 1221
24 Ga0070665_100074619 3300005548 Bacteria 3398
25 Ga0070665_100154411 3300005548 Bacteria 2297
26 Ga0070704_100839437 3300005549 Bacteria 823
27 Ga0068855_100058764 3300005563 Bacteria 4501
28 Ga0068857_100408654 3300005577 Bacteria 1264
29 Ga0068854_100003318 3300005578 Bacteria 10031
30 Ga0068856_100056175 3300005614 Bacteria 3884
31 Ga0070702_100035306 3300005615 Bacteria 2761
32 Ga0070702_100149391 3300005615 Bacteria 1498
33 Ga0068852_100011709 3300005616 Bacteria 6619
34 Ga0068864_101268070 3300005618 Bacteria 737
35 Ga0070717_10538688 3300006028 Unclassified 1057
36 Ga0070717_10581549 3300006028 Unclassified 1015
37 Ga0075432_10089510 3300006058 Bacteria 1125
38 Ga0070715_10009796 3300006163 Bacteria 3391
39 Ga0070716_100158884 3300006173 Bacteria 1462
40 Ga0070712_100207718 3300006175 Unclassified 1542
41 Ga0070712_100351899 3300006175 Unclassified 1206
42 Ga0075433_10082593 3300006852 Bacteria 2834
43 Ga0075434_100046896 3300006871 Bacteria 4288
44 Ga0075436_100022300 3300006914 Bacteria 4349
45 Ga0105240_10100346 3300009093 Bacteria 3522
46 Ga0111539_10014924 3300009094 Bacteria 9682
47 Ga0111539_12490779 3300009094 Bacteria 600
48 Ga0105245_10014619 3300009098 Bacteria 6835
49 Ga0105245_10031747 3300009098 Bacteria 4676
50 Ga0105245_10288589 3300009098 Bacteria 1606
51 Ga0105245_10998015 3300009098 Bacteria 881
52 Ga0105247_10246806 3300009101 Bacteria 1219
53 Ga0105243_10145849 3300009148 Bacteria 2025
54 Ga0105241_10004203 3300009174 Bacteria 10638
55 Ga0105241_10342573 3300009174 Bacteria 1295
56 Ga0105242_10178888 3300009176 Bacteria 1870
57 Ga0105242_10192928 3300009176 Bacteria 1805
58 Ga0105248_10656717 3300009177 Bacteria 1183
59 Ga0105237_10748005 3300009545 Bacteria 984
60 Ga0105237_12578658 3300009545 Bacteria 519
61 Ga0105238_10110786 3300009551 Bacteria 2725
62 Ga0105238_10145405 3300009551 Bacteria 2347
63 Ga0105249_10153994 3300009553 Bacteria 2216
64 Ga0105239_10277375 3300010375 Bacteria 1887
65 Ga0105239_10709796 3300010375 Bacteria 1150
66 Ga0105246_10245461 3300011119 Unclassified 1418
67 Ga0157313_1026561 3300012503 Bacteria 630
68 Ga0157369_10217553 3300013105 Bacteria 2000
69 Ga0157369_10410701 3300013105 Bacteria 1404
70 Ga0157374_10021487 3300013296 Bacteria 5744
71 Ga0157374_10444967 3300013296 Unclassified 1297
72 Ga0157372_10201666 3300013307 Bacteria 2305
73 Ga0157372_11456565 3300013307 Unclassified 789
74 Ga0157372_11525097 3300013307 Bacteria 770
75 Ga0157375_10050978 3300013308 Bacteria 4062
76 Ga0157375_10587009 3300013308 Bacteria 1274
77 Ga0157375_12122981 3300013308 Unclassified 669
78 Ga0163163_10104569 3300014325 Bacteria 2857
79 Ga0163163_10612997 3300014325 Bacteria 1152
80 Ga0157380_11861807 3300014326 Bacteria 662
81 Ga0157376_10103572 3300014969 Bacteria 2492
82 Ga0163161_10635658 3300017792 Bacteria 883
83 Ga0206350_10841953 3300020080 Unclassified 548
84 Ga0207692_10208741 3300025898 Unclassified 1152
85 Ga0207647_10021104 3300025904 Bacteria 4353
86 Ga0207699_10322452 3300025906 Unclassified 1084
87 Ga0207643_10196495 3300025908 Bacteria 1227
88 Ga0207695_10059026 3300025913 Bacteria 3981
89 Ga0207671_10000365 3300025914 Bacteria 64530
90 Ga0207693_10339038 3300025915 Bacteria 1176
91 Ga0207693_10458282 3300025915 Unclassified 996
92 Ga0207663_10451658 3300025916 Unclassified 991
93 Ga0207694_10014103 3300025924 Bacteria 6025
94 Ga0207650_10923248 3300025925 Unclassified 741
95 Ga0207659_10106033 3300025926 Bacteria 2127
96 Ga0207687_10021959 3300025927 Bacteria 4244
97 Ga0207687_10418595 3300025927 Bacteria 1105
98 Ga0207687_10562400 3300025927 Bacteria 958
99 Ga0207687_11006944 3300025927 Bacteria 714
100 Ga0207700_10061838 3300025928 Bacteria 2841
101 Ga0207664_10222046 3300025929 Bacteria 1639
102 Ga0207644_10055515 3300025931 Bacteria 2855
103 Ga0207706_10430195 3300025933 Bacteria 1143
104 Ga0207686_10124733 3300025934 Bacteria 1758
105 Ga0207686_10615825 3300025934 Unclassified 856
106 Ga0207686_10768332 3300025934 Bacteria 770
107 Ga0207665_10101602 3300025939 Bacteria 2008
108 Ga0207689_10194817 3300025942 Bacteria 1672
109 Ga0207689_11600540 3300025942 Bacteria 542
110 Ga0207661_10025513 3300025944 Bacteria 4494
111 Ga0207661_10560559 3300025944 Bacteria 1047
112 Ga0207661_10782638 3300025944 Unclassified 878
113 Ga0207679_10804610 3300025945 Bacteria 857
114 Ga0207667_10231887 3300025949 Bacteria 1890
115 Ga0207712_10134152 3300025961 Bacteria 1891
116 Ga0207640_10023682 3300025981 Bacteria 3693
117 Ga0207639_10321773 3300026041 Bacteria 1373
118 Ga0207678_10050078 3300026067 Bacteria 3609
119 Ga0207708_10297948 3300026075 Bacteria 1311
120 Ga0207702_10060683 3300026078 Bacteria 3224
121 Ga0207702_10228682 3300026078 Bacteria 1737
122 Ga0207676_10377774 3300026095 Unclassified 1318
123 Ga0207674_10531604 3300026116 Bacteria 1136
124 Ga0207674_10772456 3300026116 Unclassified 927
125 Ga0207675_100302773 3300026118 Bacteria 1557
126 Ga0207683_10154373 3300026121 Bacteria 2073
127 Ga0207683_10647722 3300026121 Bacteria 979
128 Ga0207683_10829104 3300026121 Bacteria 858
129 Ga0207683_11184191 3300026121 Bacteria 708
130 Ga0207698_10176089 3300026142 Bacteria 1889
131 Ga0207698_10758529 3300026142 Bacteria 970
132 Ga0207698_11386325 3300026142 Bacteria 718
133 Ga0207428_10046795 3300027907 Bacteria 3477
134 Ga0268266_10127558 3300028379 Bacteria 2272
135 Ga0268266_10717600 3300028379 Bacteria 964
136 Ga0268265_11387802 3300028380 Bacteria 704
137 Ga0307408_100422998 3300031548 Bacteria 1149
138 Ga0316576_10114254 3300031727 Bacteria 2025
139 Ga0307413_10914767 3300031824 Bacteria 746
140 Ga0307412_10371560 3300031911 Bacteria 1155
141 Ga0307409_100294260 3300031995 Bacteria 1507
142 Ga0307409_100572546 3300031995 Bacteria 1112
143 Ga0307416_100085324 3300032002 Bacteria 2687
144 Ga0307414_10277276 3300032004 Bacteria 1407
145 Ga0307415_100247439 3300032126 Bacteria 1446
146 Ga0307415_101205972 3300032126 Bacteria 713
147 Ga0307507_10190130 3300033179 Unclassified 1445
148 Ga0316588_1002697 3300033528 Bacteria 3126
149 Ga0373953_0170570 3300035117 Bacteria 937
150 Ga0373955_0459433 3300035172 Bacteria 776
151 Ga0450918_059999 3300042531 Bacteria 702
152 Ga0451576_0228457 3300045051 Bacteria 1943
153 Ga0495603_0007538 3300046455 Bacteria 6543
154 Ga0495629_0031574 3300046459 Bacteria 3750
155 Ga0495629_0077813 3300046459 Bacteria 2315
156 Ga0495629_0957892 3300046459 Bacteria 559
157 Ga0495641_0043320 3300046461 Bacteria 2082
158 Ga0495651_0030536 3300046462 Bacteria 4202
159 Ga0495651_0037122 3300046462 Unclassified 3794
160 Ga0495653_0370424 3300046463 Bacteria 917
161 Ga0495582_0082319 3300046473 Bacteria 1788
162 Ga0495582_0690708 3300046473 Bacteria 590
163 Ga0495662_0079563 3300046476 Bacteria 1593
164 Ga0495608_0133782 3300046511 Bacteria 1586
165 Ga0495608_0553970 3300046511 Bacteria 693
166 Ga0495628_0050231 3300046516 Bacteria 3299
167 Ga0495628_0400059 3300046516 Unclassified 1003
168 Ga0495652_0017781 3300046529 Bacteria 6344
169 Ga0495652_0135143 3300046529 Bacteria 1947
170 Ga0495652_0354895 3300046529 Bacteria 1049
171 Ga0495586_0552689 3300046535 Bacteria 665
172 Ga0495587_0149734 3300046536 Bacteria 1330
173 Ga0495645_0149674 3300046543 Bacteria 1622
174 Ga0495667_0264577 3300046559 Bacteria 1093
175 Ga0495656_0112679 3300046615 Bacteria 1275
176 Ga0495656_0148074 3300046615 Bacteria 1131
177 Ga0495634_0026486 3300046642 Bacteria 4045
178 Ga0495635_0208594 3300046663 Bacteria 1324
179 Ga0495657_0072693 3300046675 Unclassified 2242
180 Ga0495599_0056867 3300046678 Bacteria 2448
181 Ga0495646_0509811 3300046680 Unclassified 617
182 Ga0495613_0019652 3300046689 Bacteria 5034
183 Ga0495613_0100725 3300046689 Bacteria 2086
184 Ga0495613_0381844 3300046689 Bacteria 963
185 Ga0495670_0208339 3300046691 Bacteria 1036
186 Ga0495600_0110393 3300046809 Bacteria 1791
187 Ga0495600_0155482 3300046809 Bacteria 1479
188 Ga0495581_0020055 3300047315 Bacteria 3881
189 Ga0495581_0312323 3300047315 Bacteria 919
190 Ga0495604_0013711 3300047317 Bacteria 6462
191 Ga0495680_0044634 3300047322 Plasmid 3504
192 Ga0495680_0218831 3300047322 Bacteria 1360
193 Ga0495680_0898339 3300047322 Bacteria 572
194 Ga0495675_0349443 3300047444 Bacteria 870
195 Ga0495684_0136799 3300047471 Unclassified 1838
196 Ga0495602_0372651 3300048088 Bacteria 1025
197 Ga0495614_0474354 3300048089 Bacteria 594
198 Ga0496100_0021844 3300048903 Bacteria 3862
199 Ga0496100_0035123 3300048903 Bacteria 3151
200 Ga0496100_0111556 3300048903 Bacteria 1901
201 Ga0496100_0144869 3300048903 Unclassified 1688
202 Ga0496101_0122602 3300048904 Bacteria 1966
203 Ga0496101_0352038 3300048904 Unclassified 1157
204 Ga0496101_0478222 3300048904 Bacteria 983
205 Ga0496101_0548537 3300048904 Bacteria 914
206 Ga0496102_0042485 3300048905 Bacteria 4119
207 Ga0496102_0117294 3300048905 Bacteria 2484
208 Ga0496102_1099075 3300048905 Bacteria 715
209 Ga0496103_0064763 3300048906 Bacteria 2279
210 Ga0496103_0211023 3300048906 Unclassified 1249
211 Ga0496103_0228517 3300048906 Unclassified 1197
212 Ga0496104_0181732 3300048907 Unclassified 2013
213 Ga0496104_0401423 3300048907 Bacteria 1283
214 Ga0496104_0456315 3300048907 Bacteria 1190
215 Ga0496104_0541265 3300048907 Bacteria 1075
216 Ga0496104_0673225 3300048907 Bacteria 943
217 Ga0496105_0000521 3300048908 Bacteria 25380
218 Ga0496106_0005500 3300048909 Bacteria 9367
219 Ga0496106_0020644 3300048909 Bacteria 4891
220 Ga0496106_0170466 3300048909 Bacteria 1725
221 Ga0496106_0484007 3300048909 Bacteria 994
222 Ga0496107_0018308 3300048910 Bacteria 4931
223 Ga0496107_0073201 3300048910 Bacteria 2492
224 Ga0496108_0005035 3300048911 Bacteria 10678
225 Ga0496108_0359708 3300048911 Unclassified 1270
226 Ga0496108_1430027 3300048911 Bacteria 577
227 Ga0496109_0001835 3300048912 Bacteria 17620
228 Ga0496109_1224480 3300048912 Bacteria 687
229 Ga0496109_1420831 3300048912 Unclassified 629
230 Ga0496110_0004132 3300048913 Bacteria 11219
231 Ga0496110_0021925 3300048913 Bacteria 5417
232 Ga0496110_0096927 3300048913 Unclassified 2643
233 Ga0496111_0000038 3300048914 Bacteria 52166
234 Ga0496111_0068186 3300048914 Bacteria 2585
235 Ga0496111_0938474 3300048914 Bacteria 622
236 Ga0496112_0003808 3300048915 Bacteria 12609
237 Ga0496112_0128848 3300048915 Bacteria 2501
238 Ga0496112_0168660 3300048915 Bacteria 2155
239 Ga0496113_0000219 3300048916 Bacteria 26779
240 Ga0496114_0017385 3300048917 Bacteria 5804
241 Ga0496114_0041285 3300048917 Bacteria 3822
242 Ga0496114_0070644 3300048917 Bacteria 2933
243 Ga0496114_0322755 3300048917 Bacteria 1364
244 Ga0496114_0658419 3300048917 Bacteria 921
245 Ga0496115_0043400 3300048918 Bacteria 3586
246 Ga0496115_0324135 3300048918 Unclassified 1259
247 Ga0501031_0075680 3300049568 Bacteria 2192
248 Ga0501032_0244728 3300049569 Bacteria 1165
249 Ga0501038_0633931 3300049574 Bacteria 806
250 Ga0501040_0040095 3300049576 Bacteria 3186
251 Ga0501046_0077710 3300049580 Bacteria 2569
252 Ga0501071_0185404 3300049587 Bacteria 1560
253 Ga0501072_0068707 3300049588 Bacteria 2797
254 Ga0501076_0074778 3300049592 Bacteria 2715
255 Ga0501077_0081486 3300049593 Bacteria 2050
256 Ga0501079_0014147 3300049741 Bacteria 6082
257 Ga0501045_0051834 3300049824 Bacteria 2995
258 nmdc:mga0yw44_253601_c1 3300050492 Bacteria 1171
259 nmdc:mga06z11_368309_c1 3300050494 Bacteria 862
260 nmdc:mga08y16_57139_c1 3300050511 Bacteria 4078
261 nmdc:mga0n895_15818_c1 3300050512 Bacteria 6898
262 nmdc:mga0n895_1921516_c1 3300050512 Bacteria 550
263 nmdc:mga0a205_43202_c1 3300050515 Bacteria 4346
264 Ga0495601_0011768 3300053077 Bacteria 5246
265 Ga0495601_0213253 3300053077 Unclassified 1261
266 Ga0495601_0645013 3300053077 Unclassified 678
267 Ga0495612_0087595 3300053078 Bacteria 1314
268 Ga0495619_0424515 3300053085 Bacteria 917
269 Ga0495619_0560229 3300053085 Bacteria 783
270 Ga0495619_0814886 3300053085 Bacteria 631
271 Ga0500566_0071330 3300053094 Bacteria 1949
272 Ga0500573_0188367 3300053140 Unclassified 1104
273 Ga0501084_0292751 3300054114 Bacteria 1375
274 Ga0501082_0619597 3300060353 Bacteria 947
275 Ga0530510_0040132 3300061734 Bacteria 3378
276 2723643756 2721755702 Bacteria 4373124
277 2935413420 2935409751 Bacteria 4179611
278 Ga0070663_100065900
279 Ga0058860_12092947
280 Ga0070683_100021992
281 Ga0070683_100679517
282 Ga0070683_100868817
283 Ga0070661_100837944
284 Ga0070675_100079283
285 Ga0070671_100013472
286 Ga0070714_100569829
287 Ga0070714_101664353
288 Ga0070713_100080347
289 Ga0070711_100322600
290 Ga0070700_100143267
291 Ga0070700_100892748
292 Ga0070678_100629014
293 Ga0070681_10449166
294 Ga0068867_101175323
295 Ga0070684_100085175
296 Ga0070684_100119117
297 Ga0070684_100430877
298 Ga0068853_100199359
299 Ga0070686_100446047
300 Ga0070696_100304890
301 Ga0070665_100074619
302 Ga0070665_100154411
303 Ga0070704_100839437
304 Ga0068855_100058764
305 Ga0068857_100408654
306 Ga0068854_100003318
307 Ga0068856_100056175
308 Ga0070702_100035306
309 Ga0070702_100149391
310 Ga0068852_100011709
311 Ga0068864_101268070
312 Ga0070717_10538688
313 Ga0070717_10581549
314 Ga0075432_10089510
315 Ga0070715_10009796
316 Ga0070716_100158884
317 Ga0070712_100207718
318 Ga0070712_100351899
319 Ga0075433_10082593
320 Ga0075434_100046896
321 Ga0075436_100022300
322 Ga0105240_10100346
323 Ga0111539_10014924
324 Ga0111539_12490779
325 Ga0105245_10014619
326 Ga0105245_10031747
327 Ga0105245_10288589
328 Ga0105245_10998015
329 Ga0105247_10246806
330 Ga0105243_10145849
331 Ga0105241_10004203
332 Ga0105241_10342573
333 Ga0105242_10178888
334 Ga0105242_10192928
335 Ga0105248_10656717
336 Ga0105237_10748005
337 Ga0105237_12578658
338 Ga0105238_10110786
339 Ga0105238_10145405
340 Ga0105249_10153994
341 Ga0105239_10277375
342 Ga0105239_10709796
343 Ga0105246_10245461
344 Ga0157313_1026561
345 Ga0157369_10217553
346 Ga0157369_10410701
347 Ga0157374_10021487
348 Ga0157374_10444967
349 Ga0157372_10201666
350 Ga0157372_11456565
351 Ga0157372_11525097
352 Ga0157375_10050978
353 Ga0157375_10587009
354 Ga0157375_12122981
355 Ga0163163_10104569
356 Ga0163163_10612997
357 Ga0157380_11861807
358 Ga0157376_10103572
359 Ga0163161_10635658
360 Ga0206350_10841953
361 Ga0207692_10208741
362 Ga0207647_10021104
363 Ga0207699_10322452
364 Ga0207643_10196495
365 Ga0207695_10059026
366 Ga0207671_10000365
367 Ga0207693_10339038
368 Ga0207693_10458282
369 Ga0207663_10451658
370 Ga0207694_10014103
371 Ga0207650_10923248
372 Ga0207659_10106033
373 Ga0207687_10021959
374 Ga0207687_10418595
375 Ga0207687_10562400
376 Ga0207687_11006944
377 Ga0207700_10061838
378 Ga0207664_10222046
379 Ga0207644_10055515
380 Ga0207706_10430195
381 Ga0207686_10124733
382 Ga0207686_10615825
383 Ga0207686_10768332
384 Ga0207665_10101602
385 Ga0207689_10194817
386 Ga0207689_11600540
387 Ga0207661_10025513
388 Ga0207661_10560559
389 Ga0207661_10782638
390 Ga0207679_10804610
391 Ga0207667_10231887
392 Ga0207712_10134152
393 Ga0207640_10023682
394 Ga0207639_10321773
395 Ga0207678_10050078
396 Ga0207708_10297948
397 Ga0207702_10060683
398 Ga0207702_10228682
399 Ga0207676_10377774
400 Ga0207674_10531604
401 Ga0207674_10772456
402 Ga0207675_100302773
403 Ga0207683_10154373
404 Ga0207683_10647722
405 Ga0207683_10829104
406 Ga0207683_11184191
407 Ga0207698_10176089
408 Ga0207698_10758529
409 Ga0207698_11386325
410 Ga0207428_10046795
411 Ga0268266_10127558
412 Ga0268266_10717600
413 Ga0268265_11387802
414 Ga0307408_100422998
415 Ga0316576_10114254
416 Ga0307413_10914767
417 Ga0307412_10371560
418 Ga0307409_100294260
419 Ga0307409_100572546
420 Ga0307416_100085324
421 Ga0307414_10277276
422 Ga0307415_100247439
423 Ga0307415_101205972
424 Ga0307507_10190130
425 Ga0316588_1002697
426 Ga0373953_0170570
427 Ga0373955_0459433
428 Ga0450918_059999
429 Ga0451576_0228457
430 Ga0495603_0007538
431 Ga0495629_0031574
432 Ga0495629_0077813
433 Ga0495629_0957892
434 Ga0495641_0043320
435 Ga0495651_0030536
436 Ga0495651_0037122
437 Ga0495653_0370424
438 Ga0495582_0082319
439 Ga0495582_0690708
440 Ga0495662_0079563
441 Ga0495608_0133782
442 Ga0495608_0553970
443 Ga0495628_0050231
444 Ga0495628_0400059
445 Ga0495652_0017781
446 Ga0495652_0135143
447 Ga0495652_0354895
448 Ga0495586_0552689
449 Ga0495587_0149734
450 Ga0495645_0149674
451 Ga0495667_0264577
452 Ga0495656_0112679
453 Ga0495656_0148074
454 Ga0495634_0026486
455 Ga0495635_0208594
456 Ga0495657_0072693
457 Ga0495599_0056867
458 Ga0495646_0509811
459 Ga0495613_0019652
460 Ga0495613_0100725
461 Ga0495613_0381844
462 Ga0495670_0208339
463 Ga0495600_0110393
464 Ga0495600_0155482
465 Ga0495581_0020055
466 Ga0495581_0312323
467 Ga0495604_0013711
468 Ga0495680_0044634
469 Ga0495680_0218831
470 Ga0495680_0898339
471 Ga0495675_0349443
472 Ga0495684_0136799
473 Ga0495602_0372651
474 Ga0495614_0474354
475 Ga0496100_0021844
476 Ga0496100_0035123
477 Ga0496100_0111556
478 Ga0496100_0144869
479 Ga0496101_0122602
480 Ga0496101_0352038
481 Ga0496101_0478222
482 Ga0496101_0548537
483 Ga0496102_0042485
484 Ga0496102_0117294
485 Ga0496102_1099075
486 Ga0496103_0064763
487 Ga0496103_0211023
488 Ga0496103_0228517
489 Ga0496104_0181732
490 Ga0496104_0401423
491 Ga0496104_0456315
492 Ga0496104_0541265
493 Ga0496104_0673225
494 Ga0496105_0000521
495 Ga0496106_0005500
496 Ga0496106_0020644
497 Ga0496106_0170466
498 Ga0496106_0484007
499 Ga0496107_0018308
500 Ga0496107_0073201
501 Ga0496108_0005035
502 Ga0496108_0359708
503 Ga0496108_1430027
504 Ga0496109_0001835
505 Ga0496109_1224480
506 Ga0496109_1420831
507 Ga0496110_0004132
508 Ga0496110_0021925
509 Ga0496110_0096927
510 Ga0496111_0000038
511 Ga0496111_0068186
512 Ga0496111_0938474
513 Ga0496112_0003808
514 Ga0496112_0128848
515 Ga0496112_0168660
516 Ga0496113_0000219
517 Ga0496114_0017385
518 Ga0496114_0041285
519 Ga0496114_0070644
520 Ga0496114_0322755
521 Ga0496114_0658419
522 Ga0496115_0043400
523 Ga0496115_0324135
524 Ga0501031_0075680
525 Ga0501032_0244728
526 Ga0501038_0633931
527 Ga0501040_0040095
528 Ga0501046_0077710
529 Ga0501071_0185404
530 Ga0501072_0068707
531 Ga0501076_0074778
532 Ga0501077_0081486
533 Ga0501079_0014147
534 Ga0501045_0051834
535 nmdc:mga0yw44_253601_c1
536 nmdc:mga06z11_368309_c1
537 nmdc:mga08y16_57139_c1
538 nmdc:mga0n895_15818_c1
539 nmdc:mga0n895_1921516_c1
540 nmdc:mga0a205_43202_c1
541 Ga0495601_0011768
542 Ga0495601_0213253
543 Ga0495601_0645013
544 Ga0495612_0087595
545 Ga0495619_0424515
546 Ga0495619_0560229
547 Ga0495619_0814886
548 Ga0500566_0071330
549 Ga0500573_0188367
550 Ga0501084_0292751
551 Ga0501082_0619597
552 Ga0530510_0040132
553 2723643756
554 2935413420

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19850

DUF6325

Family of unknown function (DUF6325)

30

167

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cve-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein tt1547 from thermus thermophilus hb8 0.5868 12 94
2q3v-assembly1.cif.gz_A ensemble refinement of the protein crystal structure of gene product from arabidopsis thaliana at2g34160 0.5635 13 104
4aw7-assembly1.cif.gz_A bpgh86a: a beta-porphyranase of glycoside hydrolase family 86 from the human gut bacterium bacteroides plebeius 0.5604 42 94
1ru1-assembly1.cif.gz_A crystal structure of a ternary complex of e. coli hppk(v83g/del84-89) with mgampcpp and 6-hydroxymethyl-7,8-dihydropterin at 1.40 angstrom resolution (monoclinic form) 0.5476 11 103
4y3u-assembly1.cif.gz_A the structure of phospholamban bound to the calcium pump serca1a 0.5319 40 65
ID Description Score Start End Superfamily
af_Q9U2B7_29_187_3.50.30.30 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1; 0.7161 42 64 3.50.30.30
af_Q65XS0_164_295_2.60.40.1470 Mainly Beta;Sandwich;Immunoglobulin-like;ApaG domain 0.6329 43 70 2.60.40.1470
af_I1M546_102_346_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.6096 12 94 3.40.50.150
af_I1L3H6_188_273_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.6066 12 108 3.30.70.260
af_E7EYP9_22_134_3.30.379.10 Alpha Beta;2-Layer Sandwich;Chitobiase; domain 2;Chitobiase/beta-hexosaminidase domain 2-like 0.5646 46 77 3.30.379.10
ID Description Score Start End GO Terms
AF-A0A6I3GTN7-F1-model_v4 Uncharacterized protein 0.8494 9 95
AF-A0A2E8PAV7-F1-model_v4 DUF1269 domain-containing family protein 0.7831 9 118
AF-A0A853CBR1-F1-model_v4 DUF1269 domain-containing protein 0.7685 9 126
AF-A0A1H7MI81-F1-model_v4 Uncharacterized protein 0.7673 10 118
AF-A0A0Q4BGF7-F1-model_v4 DUF1269 domain-containing protein 0.7649 10 125

Map