F381267

General Info

Members Datasets Scaffolds Average Seq Length
276 196 262 204

Family's Representative Sequence

Representative Sequence 3300041451|Ga0451791_0284721|Ga0451791_0284721_512_1204
Length 230
Sequence MTTNRRHHHLASPIASAESGTGEGASTTEGSSAEGRRNIGVLLFPNVEELDAVGPWEVLSYWCRNFPQDGWSVFCLSKDGEPVTAAKGLVIGAHHSMASAPPLEVLLHPGGAGTRPLLRDPEHLAWVRAQREVVPLMTSVCTGSLVYAAAGLLTNRPATTYWSSFGELLALDPTVQTREDERFVDDGDLITSAGVSAGIDMALHLVIRLAGPERARQIRRGIQYDPEPPI

Samples

Sample ID Description Type Environment
1 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
2 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
3 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
4 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
5 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
6 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
7 2867428634 Streptomyces sp. RP5T Isolate Unclassified
8 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
9 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
87 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
88 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
89 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
91 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
92 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
93 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
94 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
97 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
98 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
99 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
100 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
101 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
102 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
103 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
104 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
108 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
115 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
116 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
119 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
120 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
121 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
122 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
123 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
124 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
125 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
126 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
127 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
128 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
129 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
130 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
131 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
132 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
133 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
152 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
153 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
154 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
155 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
156 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
169 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
183 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
184 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
185 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
186 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
187 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
188 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
190 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
191 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
192 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
193 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
194 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
195 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
196 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.57
Metatranscriptomes 0.36
Isolates 5.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.43
Nodule 0.72
Rhizoplane 11.23
Rhizosphere 76.45
Stem 0
Stem Tuber 0
Unclassified 6.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0007423J48922_100546 3300003285 Bacteria 2361
2 JGI25407J50210_10001294 3300003373 Bacteria 5616
3 Ga0070683_100912435 3300005329 Bacteria 843
4 Ga0068869_100055109 3300005334 Bacteria 2897
5 Ga0070682_100974242 3300005337 Bacteria 702
6 Ga0070691_10101257 3300005341 Bacteria 1431
7 Ga0070667_100024796 3300005367 Bacteria 4983
8 Ga0070709_10008241 3300005434 Bacteria 5724
9 Ga0070709_10015058 3300005434 Bacteria 4392
10 Ga0070714_100019643 3300005435 Bacteria 5509
11 Ga0070713_100010449 3300005436 Bacteria 6704
12 Ga0070713_100238207 3300005436 Bacteria 1656
13 Ga0070710_10021299 3300005437 Bacteria 3376
14 Ga0070710_10061217 3300005437 Bacteria 2143
15 Ga0070694_100092899 3300005444 Bacteria 2120
16 Ga0070707_100018802 3300005468 Bacteria 6505
17 Ga0070684_100111575 3300005535 Bacteria 2452
18 Ga0070686_100133136 3300005544 Bacteria 1722
19 Ga0070665_100725598 3300005548 Bacteria 1007
20 Ga0068855_100120413 3300005563 Bacteria 3004
21 Ga0070664_100144420 3300005564 Bacteria 2097
22 Ga0068856_100008868 3300005614 Bacteria 9788
23 Ga0068856_100078104 3300005614 Bacteria 3281
24 Ga0068856_100279701 3300005614 Bacteria 1685
25 Ga0068856_100833381 3300005614 Bacteria 942
26 Ga0068863_100673747 3300005841 Bacteria 1027
27 Ga0068858_100013462 3300005842 Bacteria 7718
28 Ga0068862_100444224 3300005844 Bacteria 1221
29 Ga0081538_10000936 3300005981 Bacteria 31509
30 Ga0081540_1131094 3300005983 Bacteria 1023
31 Ga0070717_10178031 3300006028 Bacteria 1852
32 Ga0070717_10331503 3300006028 Bacteria 1357
33 Ga0075365_10029021 3300006038 Bacteria 3531
34 Ga0075365_10041716 3300006038 Bacteria 2999
35 Ga0075365_10268408 3300006038 Bacteria 1200
36 Ga0075364_10033249 3300006051 Bacteria 3319
37 Ga0075364_10214907 3300006051 Bacteria 1304
38 Ga0070715_10043765 3300006163 Bacteria 1890
39 Ga0070712_100009845 3300006175 Bacteria 6026
40 Ga0070712_100646576 3300006175 Bacteria 898
41 Ga0075367_10007780 3300006178 Bacteria 5513
42 Ga0075370_10049278 3300006353 Bacteria 2387
43 Ga0075434_100310605 3300006871 Bacteria 1597
44 Ga0068865_100436187 3300006881 Bacteria 1080
45 Ga0105240_11362166 3300009093 Unclassified 747
46 Ga0105245_10061665 3300009098 Bacteria 3381
47 Ga0105245_10367588 3300009098 Bacteria 1429
48 Ga0105245_11073026 3300009098 Bacteria 851
49 Ga0105247_10012290 3300009101 Bacteria 5143
50 Ga0105243_10056691 3300009148 Bacteria 3117
51 Ga0105241_10248027 3300009174 Bacteria 1508
52 Ga0105238_10537252 3300009551 Bacteria 1173
53 Ga0105249_10058614 3300009553 Bacteria 3529
54 Ga0105249_10136318 3300009553 Bacteria 2349
55 Ga0105249_10237874 3300009553 Bacteria 1799
56 Ga0157369_10028498 3300013105 Bacteria 6181
57 Ga0157369_10105753 3300013105 Bacteria 2996
58 Ga0157374_10006672 3300013296 Bacteria 9807
59 Ga0163162_10442172 3300013306 Bacteria 1432
60 Ga0163162_11031548 3300013306 Bacteria 930
61 Ga0157372_10737406 3300013307 Bacteria 1146
62 Ga0157372_10868270 3300013307 Bacteria 1047
63 Ga0157375_10041820 3300013308 Bacteria 4429
64 Ga0163163_10014640 3300014325 Bacteria 7213
65 Ga0163163_10478271 3300014325 Bacteria 1307
66 Ga0157379_10001630 3300014968 Bacteria 18522
67 Ga0207692_10017299 3300025898 Bacteria 3213
68 Ga0207692_10038615 3300025898 Bacteria 2343
69 Ga0207710_10192062 3300025900 Bacteria 1006
70 Ga0207688_10348574 3300025901 Bacteria 912
71 Ga0207647_10029047 3300025904 Bacteria 3583
72 Ga0207693_10045388 3300025915 Bacteria 3453
73 Ga0207693_10073096 3300025915 Bacteria 2684
74 Ga0207693_10163216 3300025915 Bacteria 1753
75 Ga0207663_10120241 3300025916 Bacteria 1797
76 Ga0207660_10248442 3300025917 Bacteria 1404
77 Ga0207646_10097616 3300025922 Bacteria 2632
78 Ga0207694_10549477 3300025924 Bacteria 969
79 Ga0207687_10062969 3300025927 Bacteria 2625
80 Ga0207700_10017863 3300025928 Bacteria 4748
81 Ga0207700_10026886 3300025928 Bacteria 4020
82 Ga0207700_10029820 3300025928 Bacteria 3854
83 Ga0207700_10048553 3300025928 Bacteria 3153
84 Ga0207700_10233418 3300025928 Bacteria 1565
85 Ga0207664_10028921 3300025929 Bacteria 4217
86 Ga0207664_10030254 3300025929 Bacteria 4134
87 Ga0207664_10627951 3300025929 Bacteria 965
88 Ga0207709_10318683 3300025935 Bacteria 1163
89 Ga0207665_10002389 3300025939 Bacteria 12683
90 Ga0207689_10067610 3300025942 Bacteria 2937
91 Ga0207667_10662482 3300025949 Bacteria 1048
92 Ga0207712_10189516 3300025961 Bacteria 1622
93 Ga0207640_10108186 3300025981 Bacteria 1964
94 Ga0207703_10035886 3300026035 Bacteria 3942
95 Ga0207678_10575704 3300026067 Bacteria 986
96 Ga0207702_10010280 3300026078 Bacteria 7839
97 Ga0207702_10030771 3300026078 Bacteria 4471
98 Ga0207702_10592231 3300026078 Bacteria 1087
99 Ga0207641_10049696 3300026088 Bacteria 3545
100 Ga0207676_10274987 3300026095 Bacteria 1527
101 Ga0207674_10023813 3300026116 Bacteria 6552
102 Ga0207675_100207087 3300026118 Bacteria 1885
103 Ga0207683_10092306 3300026121 Bacteria 2698
104 Ga0207683_10139266 3300026121 Bacteria 2186
105 Ga0268266_10577856 3300028379 Bacteria 1078
106 Ga0268264_10093029 3300028381 Bacteria 2604
107 Ga0316579_10000912 3300031691 Bacteria 10251
108 Ga0307410_10805929 3300031852 Bacteria 799
109 Ga0307406_10384434 3300031901 Bacteria 1108
110 Ga0373934_0057743 3300035086 Bacteria 1544
111 Ga0373944_0020824 3300035089 Bacteria 1893
112 Ga0373923_0091912 3300035111 Bacteria 1328
113 Ga0373956_0327442 3300035119 Bacteria 730
114 Ga0373957_0059819 3300035120 Bacteria 1474
115 Ga0373946_0097119 3300035171 Bacteria 1314
116 Ga0373931_0056052 3300035691 Bacteria 2111
117 Ga0373947_0664681 3300035725 Bacteria 710
118 Ga0373937_0313721 3300036401 Bacteria 1483
119 Ga0373925_0028033 3300037068 Bacteria 4124
120 Ga0451789_0274061 3300041443 Bacteria 2347
121 Ga0451791_0284721 3300041451 Bacteria 1665
122 Ga0451793_1244021 3300041452 Bacteria 3852
123 Ga0451797_0912392 3300041453 Bacteria 2947
124 Ga0451843_0367136 3300041509 Bacteria 1241
125 Ga0451853_0072390 3300041512 Bacteria 3656
126 Ga0451853_0679540 3300041512 Bacteria 2251
127 Ga0451853_3492110 3300041512 Bacteria 1317
128 Ga0439431_0076668 3300041997 Bacteria 897
129 Ga0439455_0056651 3300042012 Bacteria 1033
130 Ga0466961_0009732 3300044693 Bacteria 6119
131 Ga0466963_0000821 3300044694 Bacteria 15534
132 Ga0466964_0046047 3300044706 Bacteria 1777
133 Ga0466971_0169799 3300044719 Bacteria 1023
134 Ga0466971_0222913 3300044719 Bacteria 894
135 Ga0466957_0322139 3300044842 Bacteria 1043
136 Ga0466958_0041205 3300045836 Bacteria 2777
137 Ga0466958_0224393 3300045836 Bacteria 1199
138 Ga0466967_0004407 3300045976 Bacteria 9484
139 Ga0466967_0352012 3300045976 Bacteria 1426
140 Ga0466967_0790558 3300045976 Bacteria 942
141 Ga0495592_0016737 3300046454 Bacteria 5565
142 Ga0495629_0260263 3300046459 Bacteria 1193
143 Ga0495651_0004126 3300046462 Bacteria 11125
144 Ga0495653_0067181 3300046463 Bacteria 2693
145 Ga0495608_0014645 3300046511 Bacteria 5441
146 Ga0495628_0170293 3300046516 Bacteria 1651
147 Ga0495652_0062318 3300046529 Bacteria 3144
148 Ga0495587_0025202 3300046536 Bacteria 3635
149 Ga0495645_0042480 3300046543 Bacteria 3314
150 Ga0495667_0011283 3300046559 Bacteria 6046
151 Ga0495667_0480078 3300046559 Bacteria 779
152 Ga0495635_0018156 3300046663 Bacteria 4911
153 Ga0495657_0033279 3300046675 Bacteria 3590
154 Ga0495657_0076872 3300046675 Bacteria 2167
155 Ga0495599_0001784 3300046678 Bacteria 12479
156 Ga0495623_0089125 3300046679 Bacteria 1897
157 Ga0495646_0009926 3300046680 Bacteria 6050
158 Ga0495647_0068074 3300046681 Bacteria 1420
159 Ga0495613_0060025 3300046689 Bacteria 2786
160 Ga0495624_0123973 3300046690 Bacteria 1586
161 Ga0495600_0031795 3300046809 Bacteria 3421
162 Ga0495581_0459831 3300047315 Bacteria 741
163 Ga0495604_0050374 3300047317 Bacteria 3234
164 Ga0495674_0115620 3300047319 Bacteria 2270
165 Ga0495680_0023113 3300047322 Bacteria 5172
166 Ga0495684_0007371 3300047471 Bacteria 8527
167 Ga0495602_0020264 3300048088 Bacteria 6576
168 Ga0496100_0093414 3300048903 Bacteria 2058
169 Ga0496100_0183191 3300048903 Bacteria 1516
170 Ga0496101_0032002 3300048904 Bacteria 3700
171 Ga0496104_0013185 3300048907 Bacteria 7451
172 Ga0496104_0085451 3300048907 Bacteria 3011
173 Ga0496105_0028927 3300048908 Bacteria 4534
174 Ga0496105_0442705 3300048908 Bacteria 1026
175 Ga0496106_0309120 3300048909 Bacteria 1268
176 Ga0496107_0116354 3300048910 Bacteria 1968
177 Ga0496107_0263237 3300048910 Bacteria 1283
178 Ga0496107_0508437 3300048910 Bacteria 893
179 Ga0496108_0046523 3300048911 Bacteria 3625
180 Ga0496108_0341096 3300048911 Bacteria 1307
181 Ga0496109_0006623 3300048912 Bacteria 9754
182 Ga0496109_0039868 3300048912 Bacteria 4252
183 Ga0496109_0160518 3300048912 Bacteria 2106
184 Ga0496110_0024229 3300048913 Bacteria 5169
185 Ga0496110_0166704 3300048913 Bacteria 1998
186 Ga0496110_0967838 3300048913 Bacteria 758
187 Ga0496111_0024497 3300048914 Bacteria 4250
188 Ga0496112_0322513 3300048915 Bacteria 1489
189 Ga0496113_0052037 3300048916 Bacteria 3057
190 Ga0496113_0263011 3300048916 Bacteria 1378
191 Ga0496114_0098369 3300048917 Bacteria 2494
192 Ga0496114_0699735 3300048917 Bacteria 889
193 Ga0496115_0046918 3300048918 Bacteria 3454
194 Ga0496117_0400640 3300048920 Bacteria 692
195 Ga0496122_0000430 3300048925 Bacteria 88467
196 Ga0496122_0003238 3300048925 Bacteria 21623
197 Ga0496123_0000634 3300048926 Bacteria 58737
198 Ga0496124_0001172 3300048927 Bacteria 41005
199 Ga0496125_0000094 3300048928 Bacteria 208341
200 Ga0496125_0053457 3300048928 Bacteria 3310
201 Ga0496126_0141170 3300048929 Bacteria 2073
202 Ga0501031_0005136 3300049568 Bacteria 8528
203 Ga0501031_0005156 3300049568 Bacteria 8515
204 Ga0501034_0412663 3300049571 Bacteria 1272
205 Ga0501034_0511723 3300049571 Bacteria 1113
206 Ga0501036_0011227 3300049572 Bacteria 7411
207 Ga0501036_0249618 3300049572 Bacteria 1487
208 Ga0501037_0093375 3300049573 Unclassified 2176
209 Ga0501037_0154231 3300049573 Bacteria 1640
210 Ga0501038_0201479 3300049574 Bacteria 1597
211 Ga0501039_0030110 3300049575 Bacteria 4183
212 Ga0501039_0083001 3300049575 Bacteria 2495
213 Ga0501040_0010996 3300049576 Bacteria 5918
214 Ga0501041_0036518 3300049577 Bacteria 2976
215 Ga0501042_0003370 3300049578 Bacteria 10023
216 Ga0501043_0087042 3300049579 Bacteria 2455
217 Ga0501043_0272536 3300049579 Bacteria 1299
218 Ga0501048_0049407 3300049582 Bacteria 2997
219 Ga0501048_0062728 3300049582 Bacteria 2630
220 Ga0501068_0022372 3300049584 Bacteria 3697
221 Ga0501069_0027305 3300049585 Bacteria 3128
222 Ga0501069_0141582 3300049585 Bacteria 1380
223 Ga0501070_0007454 3300049586 Bacteria 9295
224 Ga0501070_0009284 3300049586 Bacteria 8319
225 Ga0501070_0019966 3300049586 Bacteria 5617
226 Ga0501070_0143411 3300049586 Bacteria 1972
227 Ga0501071_0027018 3300049587 Bacteria 4035
228 Ga0501072_0003832 3300049588 Bacteria 11360
229 Ga0501073_0434926 3300049589 Bacteria 907
230 Ga0501073_0555731 3300049589 Bacteria 793
231 Ga0501074_0008846 3300049590 Bacteria 7298
232 Ga0501074_0020237 3300049590 Bacteria 4835
233 Ga0501074_0075999 3300049590 Bacteria 2411
234 Ga0501077_0112081 3300049593 Bacteria 1729
235 Ga0501079_0013828 3300049741 Bacteria 6155
236 Ga0501079_0085761 3300049741 Bacteria 2437
237 Ga0501079_0265695 3300049741 Bacteria 1341
238 Ga0501080_0014089 3300049742 Bacteria 7359
239 Ga0501080_0119903 3300049742 Bacteria 2438
240 Ga0501080_0133818 3300049742 Bacteria 2295
241 Ga0501081_0063434 3300049743 Bacteria 2564
242 Ga0501081_0119855 3300049743 Bacteria 1873
243 Ga0501035_0023356 3300049822 Bacteria 5672
244 Ga0501035_0183974 3300049822 Bacteria 1799
245 Ga0501044_0009930 3300049823 Bacteria 10340
246 Ga0501045_0049172 3300049824 Bacteria 3074
247 nmdc:mga00v17_93206_c1 3300050491 Bacteria 1894
248 nmdc:mga0yw44_187968_c1 3300050492 Bacteria 1361
249 nmdc:mga0yw44_279408_c1 3300050492 Bacteria 1116
250 nmdc:mga0yw44_296632_c1 3300050492 Bacteria 1082
251 nmdc:mga0yw44_78733_c1 3300050492 Bacteria 2061
252 nmdc:mga0yw44_86348_c1 3300050492 Bacteria 1976
253 nmdc:mga0yw44_87844_c1 3300050492 Bacteria 1960
254 nmdc:mga06z11_22618_c1 3300050494 Bacteria 2939
255 nmdc:mga08x19_116008_c1 3300050514 Bacteria 1790
256 Ga0495595_0054822 3300053084 Bacteria 1854
257 Ga0495619_0503918 3300053085 Bacteria 832
258 Ga0501084_0005024 3300054114 Bacteria 10820
259 Ga0501084_0024657 3300054114 Bacteria 5019
260 Ga0501082_0024696 3300060353 Bacteria 5180
261 Ga0501082_0225969 3300060353 Bacteria 1629
262 Ga0530510_0012459 3300061734 Bacteria 5973

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047315 Ga0495581_0459831 Ga0495581_0459831_184_726 156
2 3300048903 Ga0496100_0093414 Ga0496100_0093414_1442_1960 171
3 3300048912 Ga0496109_0160518 Ga0496109_0160518_1572_2090 171
4 3300048920 Ga0496117_0400640 Ga0496117_0400640_16_534 172
5 3300005564 Ga0070664_100144420 Ga0070664_1001444202 173
6 3300005614 Ga0068856_100279701 Ga0068856_1002797012 173
7 3300006163 Ga0070715_10043765 Ga0070715_100437652 173
8 3300006871 Ga0075434_100310605 Ga0075434_1003106052 173
9 3300025915 Ga0207693_10045388 Ga0207693_100453883 173
10 3300026078 Ga0207702_10592231 Ga0207702_105922312 173
11 3300026088 Ga0207641_10049696 Ga0207641_100496963 173
12 3300026116 Ga0207674_10023813 Ga0207674_100238137 173
13 3300046459 Ga0495629_0260263 Ga0495629_0260263_25_618 173
14 3300046559 Ga0495667_0480078 Ga0495667_0480078_123_716 173
15 3300048903 Ga0496100_0183191 Ga0496100_0183191_906_1499 173
16 3300050514 nmdc:mga08x19_116008_c1 nmdc:mga08x19_116008_c1_215_862 173
17 3300037068 Ga0373925_0028033 Ga0373925_0028033_173_820 181
18 3300005329 Ga0070683_100912435 Ga0070683_1009124352 183
19 3300005341 Ga0070691_10101257 Ga0070691_101012572 183
20 3300005434 Ga0070709_10015058 Ga0070709_100150585 183
21 3300005436 Ga0070713_100238207 Ga0070713_1002382072 183
22 3300005437 Ga0070710_10021299 Ga0070710_100212993 183
23 3300005437 Ga0070710_10061217 Ga0070710_100612173 183
24 3300005444 Ga0070694_100092899 Ga0070694_1000928991 183
25 3300005468 Ga0070707_100018802 Ga0070707_1000188027 183
26 3300005535 Ga0070684_100111575 Ga0070684_1001115753 183
27 3300005548 Ga0070665_100725598 Ga0070665_1007255981 183
28 3300005563 Ga0068855_100120413 Ga0068855_1001204133 183
29 3300005614 Ga0068856_100078104 Ga0068856_1000781043 183
30 3300005614 Ga0068856_100833381 Ga0068856_1008333812 183
31 3300005842 Ga0068858_100013462 Ga0068858_1000134622 183
32 3300005844 Ga0068862_100444224 Ga0068862_1004442242 183
33 3300009098 Ga0105245_10061665 Ga0105245_100616653 183
34 3300009101 Ga0105247_10012290 Ga0105247_100122902 183
35 3300009551 Ga0105238_10537252 Ga0105238_105372522 183
36 3300013105 Ga0157369_10028498 Ga0157369_100284987 183
37 3300013296 Ga0157374_10006672 Ga0157374_100066727 183
38 3300013307 Ga0157372_10868270 Ga0157372_108682702 183
39 3300014325 Ga0163163_10014640 Ga0163163_100146405 183
40 3300014968 Ga0157379_10001630 Ga0157379_1000163013 183
41 3300025898 Ga0207692_10017299 Ga0207692_100172991 183
42 3300025898 Ga0207692_10038615 Ga0207692_100386152 183
43 3300025900 Ga0207710_10192062 Ga0207710_101920622 183
44 3300025915 Ga0207693_10163216 Ga0207693_101632162 183
45 3300025916 Ga0207663_10120241 Ga0207663_101202412 183
46 3300025922 Ga0207646_10097616 Ga0207646_100976162 183
47 3300025924 Ga0207694_10549477 Ga0207694_105494772 183
48 3300025927 Ga0207687_10062969 Ga0207687_100629692 183
49 3300025928 Ga0207700_10029820 Ga0207700_100298207 183
50 3300025928 Ga0207700_10048553 Ga0207700_100485531 183
51 3300025928 Ga0207700_10233418 Ga0207700_102334182 183
52 3300025929 Ga0207664_10028921 Ga0207664_100289213 183
53 3300025929 Ga0207664_10627951 Ga0207664_106279512 183
54 3300025939 Ga0207665_10002389 Ga0207665_100023892 183
55 3300025949 Ga0207667_10662482 Ga0207667_106624822 183
56 3300026035 Ga0207703_10035886 Ga0207703_100358863 183
57 3300026078 Ga0207702_10010280 Ga0207702_100102805 183
58 3300026121 Ga0207683_10092306 Ga0207683_100923064 183
59 3300028379 Ga0268266_10577856 Ga0268266_105778562 183
60 3300028381 Ga0268264_10093029 Ga0268264_100930292 183
61 3300035086 Ga0373934_0057743 Ga0373934_0057743_886_1533 183
62 3300035089 Ga0373944_0020824 Ga0373944_0020824_557_1195 183
63 3300035111 Ga0373923_0091912 Ga0373923_0091912_667_1314 183
64 3300035119 Ga0373956_0327442 Ga0373956_0327442_59_706 183
65 3300035120 Ga0373957_0059819 Ga0373957_0059819_468_1115 183
66 3300035171 Ga0373946_0097119 Ga0373946_0097119_472_1119 183
67 3300035691 Ga0373931_0056052 Ga0373931_0056052_718_1365 183
68 3300035725 Ga0373947_0664681 Ga0373947_0664681_39_686 183
69 3300036401 Ga0373937_0313721 Ga0373937_0313721_797_1444 183
70 3300046454 Ga0495592_0016737 Ga0495592_0016737_1045_1692 183
71 3300046462 Ga0495651_0004126 Ga0495651_0004126_3872_4519 183
72 3300046463 Ga0495653_0067181 Ga0495653_0067181_1000_1647 183
73 3300046511 Ga0495608_0014645 Ga0495608_0014645_2881_3528 183
74 3300046516 Ga0495628_0170293 Ga0495628_0170293_337_984 183
75 3300046529 Ga0495652_0062318 Ga0495652_0062318_1678_2325 183
76 3300046536 Ga0495587_0025202 Ga0495587_0025202_2281_2928 183
77 3300046543 Ga0495645_0042480 Ga0495645_0042480_1626_2273 183
78 3300046559 Ga0495667_0011283 Ga0495667_0011283_4461_5108 183
79 3300046663 Ga0495635_0018156 Ga0495635_0018156_3941_4588 183
80 3300046675 Ga0495657_0076872 Ga0495657_0076872_481_1128 183
81 3300046678 Ga0495599_0001784 Ga0495599_0001784_943_1590 183
82 3300046679 Ga0495623_0089125 Ga0495623_0089125_942_1589 183
83 3300046680 Ga0495646_0009926 Ga0495646_0009926_4524_5171 183
84 3300046681 Ga0495647_0068074 Ga0495647_0068074_640_1287 183
85 3300046690 Ga0495624_0123973 Ga0495624_0123973_746_1393 183
86 3300046809 Ga0495600_0031795 Ga0495600_0031795_1044_1691 183
87 3300047317 Ga0495604_0050374 Ga0495604_0050374_432_1079 183
88 3300047319 Ga0495674_0115620 Ga0495674_0115620_1339_1986 183
89 3300047322 Ga0495680_0023113 Ga0495680_0023113_4059_4706 183
90 3300047471 Ga0495684_0007371 Ga0495684_0007371_3198_3845 183
91 3300048088 Ga0495602_0020264 Ga0495602_0020264_5902_6549 183
92 3300048907 Ga0496104_0013185 Ga0496104_0013185_925_1572 183
93 3300048908 Ga0496105_0028927 Ga0496105_0028927_116_763 183
94 3300048912 Ga0496109_0039868 Ga0496109_0039868_379_1026 183
95 3300048913 Ga0496110_0024229 Ga0496110_0024229_541_1188 183
96 3300048914 Ga0496111_0024497 Ga0496111_0024497_75_722 183
97 3300048915 Ga0496112_0322513 Ga0496112_0322513_211_858 183
98 3300048916 Ga0496113_0263011 Ga0496113_0263011_422_1069 183
99 3300053084 Ga0495595_0054822 Ga0495595_0054822_1106_1753 183
100 3300053085 Ga0495619_0503918 Ga0495619_0503918_158_805 183
101 3300009174 Ga0105241_10248027 Ga0105241_102480272 186
102 3300048927 Ga0496124_0001172 Ga0496124_0001172_23333_23896 187
103 3300049571 Ga0501034_0511723 Ga0501034_0511723_203_772 188
104 3300049585 Ga0501069_0027305 Ga0501069_0027305_1440_2009 188
105 3300049586 Ga0501070_0019966 Ga0501070_0019966_961_1530 188
106 3300049742 Ga0501080_0119903 Ga0501080_0119903_902_1471 188
107 3300049573 Ga0501037_0093375 Ga0501037_0093375_1250_1822 189
108 3300049586 Ga0501070_0009284 Ga0501070_0009284_6830_7402 189
109 3300049823 Ga0501044_0009930 Ga0501044_0009930_8279_8851 189
110 3300006051 Ga0075364_10214907 Ga0075364_102149072 190
111 iso_pu_bacteria 2687453743 2689990644 190
112 3300048925 Ga0496122_0003238 Ga0496122_0003238_7676_8251 191
113 iso_pu_bacteria 2837268691 2837272125 191
114 iso_pu_bacteria 2953998280 2954000214 191
115 3300006353 Ga0075370_10049278 Ga0075370_100492782 192
116 3300013105 Ga0157369_10105753 Ga0157369_101057533 193
117 3300046675 Ga0495657_0033279 Ga0495657_0033279_766_1350 193
118 3300048925 Ga0496122_0000430 Ga0496122_0000430_19806_20387 193
119 3300048926 Ga0496123_0000634 Ga0496123_0000634_17501_18082 193
120 3300049579 Ga0501043_0272536 Ga0501043_0272536_40_624 193
121 3300054114 Ga0501084_0005024 Ga0501084_0005024_5399_5983 193
122 3300005434 Ga0070709_10008241 Ga0070709_100082413 194
123 3300005435 Ga0070714_100019643 Ga0070714_1000196435 194
124 3300005436 Ga0070713_100010449 Ga0070713_1000104497 194
125 3300005614 Ga0068856_100008868 Ga0068856_1000088682 194
126 3300005841 Ga0068863_100673747 Ga0068863_1006737472 194
127 3300005983 Ga0081540_1131094 Ga0081540_11310942 194
128 3300006028 Ga0070717_10331503 Ga0070717_103315032 194
129 3300006175 Ga0070712_100646576 Ga0070712_1006465762 194
130 3300009553 Ga0105249_10136318 Ga0105249_101363183 194
131 3300025915 Ga0207693_10073096 Ga0207693_100730962 194
132 3300025928 Ga0207700_10026886 Ga0207700_100268865 194
133 3300025929 Ga0207664_10030254 Ga0207664_100302542 194
134 3300026078 Ga0207702_10030771 Ga0207702_100307717 194
135 3300031691 Ga0316579_10000912 Ga0316579_100009123 194
136 3300042012 Ga0439455_0056651 Ga0439455_0056651_237_824 194
137 3300044693 Ga0466961_0009732 Ga0466961_0009732_5459_6046 194
138 3300044694 Ga0466963_0000821 Ga0466963_0000821_4397_4984 194
139 3300044719 Ga0466971_0169799 Ga0466971_0169799_339_926 194
140 3300045836 Ga0466958_0041205 Ga0466958_0041205_866_1453 194
141 3300045976 Ga0466967_0004407 Ga0466967_0004407_8023_8610 194
142 3300048929 Ga0496126_0141170 Ga0496126_0141170_915_1505 194
143 iso_pu_bacteria 2795385472 2795797277 194
144 3300031901 Ga0307406_10384434 Ga0307406_103844342 195
145 3300045976 Ga0466967_0352012 Ga0466967_0352012_279_869 195
146 3300048917 Ga0496114_0699735 Ga0496114_0699735_266_856 195
147 3300049571 Ga0501034_0412663 Ga0501034_0412663_187_777 195
148 3300049586 Ga0501070_0007454 Ga0501070_0007454_1545_2135 195
149 3300049586 Ga0501070_0143411 Ga0501070_0143411_423_1013 195
150 3300049590 Ga0501074_0020237 Ga0501074_0020237_2632_3222 195
151 3300049741 Ga0501079_0013828 Ga0501079_0013828_5371_5961 195
152 3300049742 Ga0501080_0014089 Ga0501080_0014089_4802_5392 195
153 iso_pu_bacteria 2791355406 2793978663 195
154 iso_pu_bacteria 2811994880 2812364918 195
155 iso_pu_bacteria 8047893842 8047902921 195
156 iso_pu_bacteria 8048127548 8048135472 195
157 iso_pu_bacteria 8048369669 8048370717 195
158 iso_pu_bacteria 8048379754 8048388705 195
159 3300013308 Ga0157375_10041820 Ga0157375_100418202 196
160 3300014325 Ga0163163_10478271 Ga0163163_104782712 196
161 3300006038 Ga0075365_10268408 Ga0075365_102684082 197
162 3300009098 Ga0105245_11073026 Ga0105245_110730261 197
163 3300044842 Ga0466957_0322139 Ga0466957_0322139_206_802 197
164 3300045976 Ga0466967_0790558 Ga0466967_0790558_197_793 197
165 3300049584 Ga0501068_0022372 Ga0501068_0022372_2502_3128 197
166 3300050492 nmdc:mga0yw44_187968_c1 nmdc:mga0yw44_187968_c1_435_1046 197
167 3300050492 nmdc:mga0yw44_279408_c1 nmdc:mga0yw44_279408_c1_284_880 197
168 3300050494 nmdc:mga06z11_22618_c1 nmdc:mga06z11_22618_c1_869_1465 197
169 3300003373 JGI25407J50210_10001294 JGI25407J50210_100012946 198
170 3300005981 Ga0081538_10000936 Ga0081538_1000093613 198
171 3300006038 Ga0075365_10029021 Ga0075365_100290213 198
172 3300006881 Ga0068865_100436187 Ga0068865_1004361872 198
173 3300009098 Ga0105245_10367588 Ga0105245_103675883 198
174 3300009148 Ga0105243_10056691 Ga0105243_100566913 198
175 3300009553 Ga0105249_10237874 Ga0105249_102378741 198
176 3300013306 Ga0163162_11031548 Ga0163162_110315481 198
177 3300025901 Ga0207688_10348574 Ga0207688_103485741 198
178 3300025935 Ga0207709_10318683 Ga0207709_103186832 198
179 3300048904 Ga0496101_0032002 Ga0496101_0032002_2462_3073 198
180 3300048907 Ga0496104_0085451 Ga0496104_0085451_2232_2855 198
181 3300048908 Ga0496105_0442705 Ga0496105_0442705_309_932 198
182 3300048909 Ga0496106_0309120 Ga0496106_0309120_411_1034 198
183 3300048910 Ga0496107_0116354 Ga0496107_0116354_215_826 198
184 3300048910 Ga0496107_0508437 Ga0496107_0508437_236_859 198
185 3300048911 Ga0496108_0046523 Ga0496108_0046523_1750_2373 198
186 3300048912 Ga0496109_0006623 Ga0496109_0006623_4697_5320 198
187 3300048913 Ga0496110_0166704 Ga0496110_0166704_514_1137 198
188 3300048917 Ga0496114_0098369 Ga0496114_0098369_1737_2360 198
189 3300048918 Ga0496115_0046918 Ga0496115_0046918_2532_3155 198
190 3300003285 Ga0007423J48922_100546 Ga0007423J48922_1005462 199
191 3300005334 Ga0068869_100055109 Ga0068869_1000551092 199
192 3300005337 Ga0070682_100974242 Ga0070682_1009742421 199
193 3300005367 Ga0070667_100024796 Ga0070667_1000247965 199
194 3300005544 Ga0070686_100133136 Ga0070686_1001331361 199
195 3300006028 Ga0070717_10178031 Ga0070717_101780312 199
196 3300006038 Ga0075365_10041716 Ga0075365_100417162 199
197 3300006051 Ga0075364_10033249 Ga0075364_100332492 199
198 3300006175 Ga0070712_100009845 Ga0070712_1000098452 199
199 3300006178 Ga0075367_10007780 Ga0075367_100077803 199
200 3300009093 Ga0105240_11362166 Ga0105240_113621661 199
201 3300009553 Ga0105249_10058614 Ga0105249_100586142 199
202 3300013306 Ga0163162_10442172 Ga0163162_104421722 199
203 3300013307 Ga0157372_10737406 Ga0157372_107374062 199
204 3300025904 Ga0207647_10029047 Ga0207647_100290474 199
205 3300025917 Ga0207660_10248442 Ga0207660_102484423 199
206 3300025928 Ga0207700_10017863 Ga0207700_100178634 199
207 3300025942 Ga0207689_10067610 Ga0207689_100676102 199
208 3300025961 Ga0207712_10189516 Ga0207712_101895162 199
209 3300025981 Ga0207640_10108186 Ga0207640_101081862 199
210 3300026067 Ga0207678_10575704 Ga0207678_105757041 199
211 3300026095 Ga0207676_10274987 Ga0207676_102749872 199
212 3300026118 Ga0207675_100207087 Ga0207675_1002070872 199
213 3300026121 Ga0207683_10139266 Ga0207683_101392662 199
214 3300031852 Ga0307410_10805929 Ga0307410_108059291 199
215 3300041443 Ga0451789_0274061 Ga0451789_0274061_1579_2193 199
216 3300041451 Ga0451791_0284721 Ga0451791_0284721_512_1204 199
217 3300041452 Ga0451793_1244021 Ga0451793_1244021_3127_3741 199
218 3300041453 Ga0451797_0912392 Ga0451797_0912392_525_1139 199
219 3300041509 Ga0451843_0367136 Ga0451843_0367136_72_686 199
220 3300041512 Ga0451853_0072390 Ga0451853_0072390_248_862 199
221 3300041512 Ga0451853_0679540 Ga0451853_0679540_1035_1676 199
222 3300041512 Ga0451853_3492110 Ga0451853_3492110_107_745 199
223 3300041997 Ga0439431_0076668 Ga0439431_0076668_53_697 199
224 3300044706 Ga0466964_0046047 Ga0466964_0046047_978_1592 199
225 3300044719 Ga0466971_0222913 Ga0466971_0222913_43_657 199
226 3300045836 Ga0466958_0224393 Ga0466958_0224393_429_1043 199
227 3300046689 Ga0495613_0060025 Ga0495613_0060025_703_1305 199
228 3300048910 Ga0496107_0263237 Ga0496107_0263237_494_1105 199
229 3300048911 Ga0496108_0341096 Ga0496108_0341096_378_1004 199
230 3300048913 Ga0496110_0967838 Ga0496110_0967838_89_730 199
231 3300048916 Ga0496113_0052037 Ga0496113_0052037_1868_2491 199
232 3300048928 Ga0496125_0000094 Ga0496125_0000094_7631_8230 199
233 3300048928 Ga0496125_0053457 Ga0496125_0053457_60_659 199
234 3300049568 Ga0501031_0005136 Ga0501031_0005136_2824_3465 199
235 3300049568 Ga0501031_0005156 Ga0501031_0005156_6915_7520 199
236 3300049572 Ga0501036_0011227 Ga0501036_0011227_2116_2757 199
237 3300049572 Ga0501036_0249618 Ga0501036_0249618_803_1405 199
238 3300049573 Ga0501037_0154231 Ga0501037_0154231_603_1244 199
239 3300049574 Ga0501038_0201479 Ga0501038_0201479_280_921 199
240 3300049575 Ga0501039_0030110 Ga0501039_0030110_1152_1793 199
241 3300049575 Ga0501039_0083001 Ga0501039_0083001_675_1316 199
242 3300049576 Ga0501040_0010996 Ga0501040_0010996_4279_4920 199
243 3300049577 Ga0501041_0036518 Ga0501041_0036518_1208_1849 199
244 3300049578 Ga0501042_0003370 Ga0501042_0003370_2827_3468 199
245 3300049579 Ga0501043_0087042 Ga0501043_0087042_1670_2311 199
246 3300049582 Ga0501048_0049407 Ga0501048_0049407_2202_2843 199
247 3300049582 Ga0501048_0062728 Ga0501048_0062728_84_725 199
248 3300049585 Ga0501069_0141582 Ga0501069_0141582_504_1145 199
249 3300049587 Ga0501071_0027018 Ga0501071_0027018_1404_2045 199
250 3300049588 Ga0501072_0003832 Ga0501072_0003832_9721_10362 199
251 3300049589 Ga0501073_0434926 Ga0501073_0434926_222_863 199
252 3300049589 Ga0501073_0555731 Ga0501073_0555731_22_663 199
253 3300049590 Ga0501074_0008846 Ga0501074_0008846_2202_2843 199
254 3300049590 Ga0501074_0075999 Ga0501074_0075999_87_728 199
255 3300049593 Ga0501077_0112081 Ga0501077_0112081_924_1565 199
256 3300049741 Ga0501079_0085761 Ga0501079_0085761_451_1092 199
257 3300049741 Ga0501079_0265695 Ga0501079_0265695_204_845 199
258 3300049742 Ga0501080_0133818 Ga0501080_0133818_1516_2157 199
259 3300049743 Ga0501081_0063434 Ga0501081_0063434_1080_1721 199
260 3300049743 Ga0501081_0119855 Ga0501081_0119855_1146_1787 199
261 3300049822 Ga0501035_0023356 Ga0501035_0023356_1418_2059 199
262 3300049822 Ga0501035_0183974 Ga0501035_0183974_827_1468 199
263 3300049824 Ga0501045_0049172 Ga0501045_0049172_1033_1674 199
264 3300050491 nmdc:mga00v17_93206_c1 nmdc:mga00v17_93206_c1_658_1302 199
265 3300050492 nmdc:mga0yw44_296632_c1 nmdc:mga0yw44_296632_c1_84_722 199
266 3300050492 nmdc:mga0yw44_78733_c1 nmdc:mga0yw44_78733_c1_716_1327 199
267 3300050492 nmdc:mga0yw44_86348_c1 nmdc:mga0yw44_86348_c1_1256_1900 199
268 3300050492 nmdc:mga0yw44_87844_c1 nmdc:mga0yw44_87844_c1_1189_1827 199
269 3300054114 Ga0501084_0024657 Ga0501084_0024657_706_1347 199
270 3300060353 Ga0501082_0024696 Ga0501082_0024696_3526_4167 199
271 3300060353 Ga0501082_0225969 Ga0501082_0225969_139_780 199
272 3300061734 Ga0530510_0012459 Ga0530510_0012459_3639_4280 199
273 iso_pu_bacteria 2643221624 2644136262 199
274 iso_pu_bacteria 2867428634 2867429380 199
275 iso_pu_bacteria 8048406513 8048411590 199
276 iso_pu_bacteria 8054609563 8054611376 199

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

37

208

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3noq-assembly1.cif.gz_A crystal structure of c101s isocyanide hydratase from pseudomonas fluorescens 0.9469 6 199
7la0-assembly1.cif.gz_B pseudomonas fluorescens g150a isocyanide hydratase (g150a-2) at 274k, refmac5-refined 0.9391 7 199
3noo-assembly1.cif.gz_B crystal structure of c101a isocyanide hydratase from pseudomonas fluorescens 0.9369 7 199
3nor-assembly1.cif.gz_A-2 crystal structure of t102s isocyanide hydratase from pseudomonas fluorescens 0.9324 7 199
7lav-assembly1.cif.gz_A pseudomonas fluorescens g150t isocyanide hydratase (g150t-1) at 274k, refmac5-refined 0.9322 7 199
ID Description Score Start End Superfamily
3norA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9323 7 199 3.40.50.880
3mgkA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9088 7 198 3.40.50.880
af_I6Y6S3_1_186_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9083 42 199 3.40.50.880
af_O88767_1_189_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8869 7 194 3.40.50.880
af_O16228_2_184_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8828 4 193 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A2A3FTP8-F1-model_v4 Thiamine biosynthesis protein ThiJ 0.987 7 195 GO:0006355
AF-A0A0B8NRN2-F1-model_v4 Thiamine biosynthesis protein ThiJ 0.982 3 171 GO:0006355
AF-A0A7D6VI31-F1-model_v4 DJ-1/PfpI family protein 0.9785 3 198 GO:0006355
AF-A0A3N4YI67-F1-model_v4 DJ-1/PfpI family protein 0.9719 2 198
AF-A0A2A3FTP8-F1-model_v4 Thiamine biosynthesis protein ThiJ 0.9717 7 195 GO:0006355

Feature Viewer

pLDDT pTM Quality
94.93 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map