F380999

General Info

Members Datasets Scaffolds Average Seq Length
276 142 275 508

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_100002401|Ga0068852_10000240113
Length 526
Sequence VINTKTIYKNRIMKKYSYFFACLLIVFTANAQSNTIIISKAKLKDKIMGGWAGQTIGVTFGGPYEFRFQGTFIGDYQPLLWYDGYLKHELINNPGLYDDLYMDLTFVDVFKKYGLDAPVDSFANAFAHAGYMLWHANQAARYNLLNGIKAPQSGYWKNNPHADCIDYQIESDFAGLMCPAMPNTASAISDKIGHIMNYGDGWYGGVYVGAMYSQAFISGDINFIVNEALKTIPQQSEFYKCIHDVIGWHQKYPDWKSTWFEVQKKYANDVGCPEGVFTPFDIDAKVNAAYVTIGLLYGGGDFTKSLEIATRCGQDADCNPSTVGGVLGAVLGYDKIPAYWKMGLKEAESIDFKYTTMSLNDVYETGFKHALQNIERNGGSVNGDNIVIKKQQPAVVKFEKSFDGIYPVQKISPTVSDKKDDVSFDFDGTGFALRGETAKWGNNSSFVYNTELYIDGKLIEKPQLPVSYTTRRYELCWNYDLPKGKHHAELKILNSDANENFNAGDVIIYSDKPVDGIKVNMKNEKK

Samples

Sample ID Description Type Environment
1 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
2 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
3 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
136 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
142 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0
Isolates 0.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.81
Nodule 0
Rhizoplane 1.09
Rhizosphere 96.01
Stem 0
Stem Tuber 0
Unclassified 1.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25160J50197_1000630 3300003354 Bacteria 19712
2 Ga0055531_10000061 3300003794 Bacteria 120535
3 Ga0070676_10001437 3300005328 Bacteria 12029
4 Ga0070676_10032105 3300005328 Bacteria 3006
5 Ga0070683_100026515 3300005329 Bacteria 5220
6 Ga0070683_100054348 3300005329 Bacteria 3713
7 Ga0070670_100043213 3300005331 Bacteria 3874
8 Ga0070670_100049175 3300005331 Bacteria 3626
9 Ga0068869_100073350 3300005334 Bacteria 2537
10 Ga0068869_100097861 3300005334 Unclassified 2216
11 Ga0070666_10000101 3300005335 Bacteria 58900
12 Ga0070666_10018457 3300005335 Bacteria 4487
13 Ga0070666_10138039 3300005335 Bacteria 1697
14 Ga0070680_100057351 3300005336 Bacteria 3184
15 Ga0070682_100000897 3300005337 Bacteria 17380
16 Ga0070682_100033195 3300005337 Bacteria 3134
17 Ga0068868_100005797 3300005338 Bacteria 8701
18 Ga0068868_100015653 3300005338 Bacteria 5617
19 Ga0070660_100021368 3300005339 Bacteria 4772
20 Ga0070689_100016676 3300005340 Bacteria 5377
21 Ga0070689_100022086 3300005340 Bacteria 4748
22 Ga0070689_100135732 3300005340 Bacteria 1975
23 Ga0070691_10004749 3300005341 Bacteria 6182
24 Ga0070661_100034485 3300005344 Bacteria 3669
25 Ga0070668_100002955 3300005347 Bacteria 12564
26 Ga0070668_100065746 3300005347 Bacteria 2813
27 Ga0070669_100001419 3300005353 Bacteria 17324
28 Ga0070669_100010884 3300005353 Bacteria 6458
29 Ga0070669_100132656 3300005353 Bacteria 1913
30 Ga0070675_100185208 3300005354 Bacteria 1802
31 Ga0070671_100079509 3300005355 Bacteria 2741
32 Ga0070674_100013231 3300005356 Bacteria 5094
33 Ga0070674_100065895 3300005356 Bacteria 2543
34 Ga0070673_100013380 3300005364 Bacteria 5673
35 Ga0070673_100083194 3300005364 Bacteria 2600
36 Ga0070673_100094946 3300005364 Bacteria 2445
37 Ga0070659_100006647 3300005366 Bacteria 8356
38 Ga0070667_100021719 3300005367 Bacteria 5326
39 Ga0070667_100029051 3300005367 Bacteria 4605
40 Ga0070667_100037568 3300005367 Bacteria 4060
41 Ga0070678_100019010 3300005456 Bacteria 4466
42 Ga0070662_100021868 3300005457 Bacteria 4371
43 Ga0070662_100054620 3300005457 Bacteria 2895
44 Ga0068867_100137942 3300005459 Bacteria 1903
45 Ga0070685_10002595 3300005466 Bacteria 9253
46 Ga0070685_10045589 3300005466 Bacteria 2515
47 Ga0070685_10059015 3300005466 Bacteria 2239
48 Ga0070698_100007300 3300005471 Bacteria 11966
49 Ga0070698_100017546 3300005471 Bacteria 7543
50 Ga0070698_100023102 3300005471 Bacteria 6503
51 Ga0070679_100000798 3300005530 Bacteria 27347
52 Ga0070679_100092106 3300005530 Bacteria 3019
53 Ga0070684_100046084 3300005535 Bacteria 3777
54 Ga0070684_100088671 3300005535 Bacteria 2749
55 Ga0068853_100010181 3300005539 Bacteria 7599
56 Ga0068853_100060492 3300005539 Bacteria 3273
57 Ga0068853_100093967 3300005539 Bacteria 2641
58 Ga0070672_100005270 3300005543 Bacteria 8554
59 Ga0070672_100025059 3300005543 Bacteria 4418
60 Ga0070672_100107728 3300005543 Bacteria 2268
61 Ga0070686_100041622 3300005544 Bacteria 2873
62 Ga0070693_100002207 3300005547 Bacteria 8939
63 Ga0070665_100043048 3300005548 Bacteria 4539
64 Ga0070665_100051104 3300005548 Bacteria 4146
65 Ga0068855_100015336 3300005563 Bacteria 9227
66 Ga0070664_100044712 3300005564 Bacteria 3739
67 Ga0070664_100097371 3300005564 Bacteria 2554
68 Ga0070664_100220482 3300005564 Unclassified 1697
69 Ga0068857_100022666 3300005577 Bacteria 5524
70 Ga0068857_100135462 3300005577 Bacteria 2224
71 Ga0068857_100149026 3300005577 Bacteria 2119
72 Ga0068856_100002777 3300005614 Bacteria 17927
73 Ga0070702_100044102 3300005615 Bacteria 2516
74 Ga0068852_100002401 3300005616 Bacteria 12906
75 Ga0068852_100013241 3300005616 Bacteria 6306
76 Ga0068859_100000007 3300005617 Bacteria 390070
77 Ga0068859_100017401 3300005617 Bacteria 7223
78 Ga0068859_100021842 3300005617 Bacteria 6419
79 Ga0068859_100113229 3300005617 Bacteria 2776
80 Ga0068864_100003219 3300005618 Bacteria 13488
81 Ga0068864_100014308 3300005618 Bacteria 6591
82 Ga0068864_100040445 3300005618 Unclassified 3989
83 Ga0068864_100069927 3300005618 Bacteria 3053
84 Ga0068866_10009030 3300005718 Bacteria 4223
85 Ga0068861_100139270 3300005719 Bacteria 1979
86 Ga0068863_100000546 3300005841 Bacteria 38297
87 Ga0068863_100014150 3300005841 Bacteria 7686
88 Ga0068863_100198712 3300005841 Unclassified 1928
89 Ga0068858_100004081 3300005842 Bacteria 14387
90 Ga0068858_100008377 3300005842 Bacteria 9946
91 Ga0068860_100000818 3300005843 Bacteria 34832
92 Ga0068860_100003442 3300005843 Bacteria 16284
93 Ga0068860_100008360 3300005843 Bacteria 10305
94 Ga0068860_100024030 3300005843 Bacteria 5891
95 Ga0068860_100024747 3300005843 Bacteria 5799
96 Ga0068862_100004156 3300005844 Bacteria 12266
97 Ga0081539_10000223 3300005985 Bacteria 133106
98 Ga0097621_100000307 3300006237 Bacteria 33085
99 Ga0097621_100159247 3300006237 Bacteria 1940
100 Ga0068871_100000545 3300006358 Bacteria 25706
101 Ga0068871_100042950 3300006358 Bacteria 3631
102 Ga0068871_100048335 3300006358 Bacteria 3434
103 Ga0075431_100049098 3300006847 Bacteria 4352
104 Ga0068865_100010479 3300006881 Bacteria 5771
105 Ga0097620_100000007 3300006931 Bacteria 390070
106 Ga0097620_100017401 3300006931 Bacteria 7223
107 Ga0097620_100021842 3300006931 Bacteria 6419
108 Ga0097620_100113229 3300006931 Bacteria 2776
109 Ga0105240_10001840 3300009093 Bacteria 35540
110 Ga0105240_10011455 3300009093 Bacteria 12347
111 Ga0111539_10007515 3300009094 Bacteria 13941
112 Ga0105247_10006328 3300009101 Bacteria 7334
113 Ga0114129_10047428 3300009147 Bacteria 6036
114 Ga0114129_10057210 3300009147 Bacteria 5459
115 Ga0105241_10001016 3300009174 Bacteria 21353
116 Ga0105241_10215266 3300009174 Bacteria 1612
117 Ga0105242_10021712 3300009176 Bacteria 5043
118 Ga0105242_10062990 3300009176 Bacteria 3053
119 Ga0105248_10022088 3300009177 Bacteria 7051
120 Ga0105248_10340750 3300009177 Bacteria 1688
121 Ga0105237_10035361 3300009545 Bacteria 5055
122 Ga0105237_10048438 3300009545 Bacteria 4272
123 Ga0105249_10002465 3300009553 Bacteria 16041
124 Ga0105249_10002959 3300009553 Bacteria 14658
125 Ga0105249_10004036 3300009553 Bacteria 12665
126 Ga0105249_10015710 3300009553 Bacteria 6704
127 Ga0105249_10132031 3300009553 Bacteria 2385
128 Ga0105239_10026153 3300010375 Bacteria 6424
129 Ga0105239_10127735 3300010375 Unclassified 2826
130 Ga0105246_10018910 3300011119 Bacteria 4394
131 Ga0157373_10007580 3300013100 Bacteria 8066
132 Ga0157371_10035080 3300013102 Bacteria 3596
133 Ga0157371_10061496 3300013102 Bacteria 2663
134 Ga0157370_10004224 3300013104 Bacteria 16616
135 Ga0157370_10102639 3300013104 Bacteria 2677
136 Ga0157369_10066604 3300013105 Bacteria 3874
137 Ga0157369_10163289 3300013105 Bacteria 2350
138 Ga0157374_10015184 3300013296 Bacteria 6753
139 Ga0157374_10026914 3300013296 Bacteria 5179
140 Ga0157378_10009646 3300013297 Bacteria 8405
141 Ga0157378_10009880 3300013297 Bacteria 8315
142 Ga0157378_10031845 3300013297 Unclassified 4657
143 Ga0157378_10049419 3300013297 Bacteria 3742
144 Ga0163162_10000225 3300013306 Bacteria 51751
145 Ga0163162_10000226 3300013306 Bacteria 51615
146 Ga0163162_10002251 3300013306 Bacteria 18116
147 Ga0163162_10011349 3300013306 Bacteria 8687
148 Ga0163162_10016729 3300013306 Bacteria 7168
149 Ga0163162_10038715 3300013306 Bacteria 4759
150 Ga0163162_10098431 3300013306 Bacteria 3014
151 Ga0157372_10029554 3300013307 Bacteria 5986
152 Ga0157372_10109299 3300013307 Bacteria 3166
153 Ga0157375_10000215 3300013308 Bacteria 53926
154 Ga0157375_10002714 3300013308 Bacteria 15301
155 Ga0157375_10237957 3300013308 Bacteria 1980
156 Ga0163163_10000079 3300014325 Bacteria 106874
157 Ga0163163_10039463 3300014325 Bacteria 4607
158 Ga0163163_10047603 3300014325 Bacteria 4215
159 Ga0157380_10004982 3300014326 Bacteria 9250
160 Ga0157380_10005409 3300014326 Bacteria 8922
161 Ga0157380_10009627 3300014326 Bacteria 6929
162 Ga0157379_10003320 3300014968 Bacteria 13626
163 Ga0157379_10014699 3300014968 Bacteria 6866
164 Ga0157376_10000137 3300014969 Bacteria 49673
165 Ga0157376_10004745 3300014969 Bacteria 9460
166 Ga0157376_10015155 3300014969 Bacteria 5813
167 Ga0157376_10081961 3300014969 Bacteria 2771
168 Ga0157376_10178277 3300014969 Bacteria 1940
169 Ga0163161_10004337 3300017792 Bacteria 9886
170 Ga0163161_10008568 3300017792 Bacteria 7075
171 Ga0163161_10017967 3300017792 Unclassified 4957
172 Ga0163161_10049652 3300017792 Unclassified 3033
173 Ga0207426_1000019 3300025302 Bacteria 558579
174 Ga0209257_1000006 3300025304 Bacteria 1570111
175 Ga0207697_10048706 3300025315 Bacteria 1749
176 Ga0207656_10017760 3300025321 Bacteria 2791
177 Ga0207710_10024322 3300025900 Bacteria 2607
178 Ga0207680_10000015 3300025903 Bacteria 138253
179 Ga0207680_10119220 3300025903 Bacteria 1723
180 Ga0207645_10000524 3300025907 Bacteria 31862
181 Ga0207645_10025135 3300025907 Bacteria 3856
182 Ga0207645_10026342 3300025907 Bacteria 3758
183 Ga0207643_10004945 3300025908 Bacteria 7132
184 Ga0207643_10004947 3300025908 Bacteria 7130
185 Ga0207705_10021931 3300025909 Bacteria 4556
186 Ga0207654_10000885 3300025911 Bacteria 16601
187 Ga0207654_10010888 3300025911 Bacteria 4630
188 Ga0207695_10017060 3300025913 Bacteria 8467
189 Ga0207671_10006126 3300025914 Bacteria 10811
190 Ga0207671_10032954 3300025914 Bacteria 3856
191 Ga0207660_10002326 3300025917 Bacteria 12506
192 Ga0207657_10002466 3300025919 Bacteria 20011
193 Ga0207652_10000622 3300025921 Bacteria 35142
194 Ga0207652_10000765 3300025921 Bacteria 30774
195 Ga0207650_10024322 3300025925 Bacteria 4304
196 Ga0207659_10094742 3300025926 Bacteria 2238
197 Ga0207690_10032063 3300025932 Bacteria 3368
198 Ga0207706_10011288 3300025933 Bacteria 8141
199 Ga0207706_10016891 3300025933 Bacteria 6584
200 Ga0207706_10030701 3300025933 Bacteria 4792
201 Ga0207686_10030614 3300025934 Bacteria 3188
202 Ga0207670_10011801 3300025936 Bacteria 5084
203 Ga0207670_10011804 3300025936 Bacteria 5083
204 Ga0207670_10087367 3300025936 Bacteria 2196
205 Ga0207691_10008193 3300025940 Bacteria 10038
206 Ga0207691_10038617 3300025940 Bacteria 4418
207 Ga0207691_10053750 3300025940 Bacteria 3676
208 Ga0207711_10204325 3300025941 Bacteria 1803
209 Ga0207689_10002154 3300025942 Bacteria 18530
210 Ga0207689_10006138 3300025942 Bacteria 10633
211 Ga0207689_10009585 3300025942 Bacteria 8351
212 Ga0207689_10031458 3300025942 Bacteria 4417
213 Ga0207689_10057983 3300025942 Bacteria 3185
214 Ga0207667_10164852 3300025949 Bacteria 2278
215 Ga0207651_10044342 3300025960 Bacteria 2976
216 Ga0207651_10088770 3300025960 Bacteria 2255
217 Ga0207712_10000871 3300025961 Bacteria 21972
218 Ga0207712_10005569 3300025961 Bacteria 7947
219 Ga0207712_10112699 3300025961 Bacteria 2043
220 Ga0207677_10016693 3300026023 Bacteria 4357
221 Ga0207677_10035567 3300026023 Bacteria 3237
222 Ga0207703_10006519 3300026035 Bacteria 9314
223 Ga0207703_10006633 3300026035 Bacteria 9235
224 Ga0207703_10065802 3300026035 Bacteria 2980
225 Ga0207639_10074646 3300026041 Bacteria 2663
226 Ga0207641_10000056 3300026088 Bacteria 170719
227 Ga0207641_10000539 3300026088 Bacteria 42499
228 Ga0207641_10018131 3300026088 Bacteria 5768
229 Ga0207648_10004009 3300026089 Bacteria 15280
230 Ga0207648_10073864 3300026089 Bacteria 2972
231 Ga0207648_10143330 3300026089 Bacteria 2107
232 Ga0207676_10012358 3300026095 Bacteria 6116
233 Ga0207676_10022249 3300026095 Bacteria 4660
234 Ga0207676_10089858 3300026095 Bacteria 2519
235 Ga0207674_10008842 3300026116 Bacteria 11586
236 Ga0207675_100003606 3300026118 Bacteria 15086
237 Ga0207683_10017015 3300026121 Bacteria 6188
238 Ga0207683_10091793 3300026121 Bacteria 2706
239 Ga0207698_10006870 3300026142 Bacteria 7120
240 Ga0207698_10044610 3300026142 Bacteria 3333
241 Ga0207428_10131261 3300027907 Bacteria 1916
242 Ga0268266_10061317 3300028379 Bacteria 3244
243 Ga0268266_10117892 3300028379 Bacteria 2359
244 Ga0268265_10039305 3300028380 Bacteria 3487
245 Ga0268265_10057974 3300028380 Bacteria 2954
246 Ga0268264_10001194 3300028381 Bacteria 25099
247 Ga0268264_10007266 3300028381 Bacteria 9270
248 Ga0268264_10011359 3300028381 Bacteria 7356
249 Ga0268264_10015082 3300028381 Bacteria 6338
250 Ga0268264_10072475 3300028381 Bacteria 2921
251 Ga0307515_10000078 3300028794 Bacteria 227988
252 Ga0307515_10000408 3300028794 Bacteria 103931
253 Ga0466967_0300761 3300045976 Unclassified 1544
254 Ga0495628_0034401 3300046516 Bacteria 4076
255 Ga0495630_0024056 3300046517 Bacteria 4504
256 Ga0495644_0018583 3300046523 Bacteria 2656
257 Ga0495652_0085604 3300046529 Bacteria 2590
258 Ga0495634_0018474 3300046642 Bacteria 4964
259 Ga0496100_0024813 3300048903 Bacteria 3662
260 Ga0496101_0019032 3300048904 Bacteria 4679
261 Ga0496114_0037998 3300048917 Bacteria 3983
262 Ga0501034_0038322 3300049571 Bacteria 4854
263 Ga0501038_0014433 3300049574 Bacteria 7200
264 Ga0501038_0018187 3300049574 Bacteria 6346
265 Ga0501043_0007430 3300049579 Bacteria 8699
266 Ga0501043_0029998 3300049579 Bacteria 4272
267 Ga0501069_0021347 3300049585 Bacteria 3512
268 Ga0501073_0085412 3300049589 Bacteria 2196
269 Ga0501080_0125346 3300049742 Bacteria 2379
270 Ga0501083_0028129 3300049744 Bacteria 3876
271 Ga0501035_0016056 3300049822 Bacteria 6909
272 Ga0501044_0018753 3300049823 Bacteria 7410
273 nmdc:mga06r32_117432_c1 3300050510 Unclassified 2622
274 nmdc:mga06r32_89422_c1 3300050510 Bacteria 3007
275 Ga0500588_0003351 3300053146 Bacteria 3373

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005564 Ga0070664_100220482 Ga0070664_1002204821 469
2 3300005340 Ga0070689_100022086 Ga0070689_1000220862 470
3 3300005347 Ga0070668_100065746 Ga0070668_1000657462 470
4 3300005353 Ga0070669_100001419 Ga0070669_10000141915 470
5 3300005364 Ga0070673_100083194 Ga0070673_1000831941 470
6 3300005459 Ga0068867_100137942 Ga0068867_1001379421 470
7 3300005577 Ga0068857_100135462 Ga0068857_1001354621 470
8 3300005617 Ga0068859_100113229 Ga0068859_1001132293 470
9 3300005844 Ga0068862_100004156 Ga0068862_1000041568 470
10 3300006931 Ga0097620_100113229 Ga0097620_1001132293 470
11 3300025936 Ga0207670_10087367 Ga0207670_100873672 470
12 3300026116 Ga0207674_10008842 Ga0207674_1000884211 470
13 3300026118 Ga0207675_100003606 Ga0207675_10000360610 470
14 3300027907 Ga0207428_10131261 Ga0207428_101312612 470
15 3300028380 Ga0268265_10057974 Ga0268265_100579742 470
16 3300005985 Ga0081539_10000223 Ga0081539_1000022360 477
17 3300006237 Ga0097621_100159247 Ga0097621_1001592472 477
18 3300006358 Ga0068871_100042950 Ga0068871_1000429502 477
19 3300005335 Ga0070666_10138039 Ga0070666_101380391 479
20 3300005338 Ga0068868_100015653 Ga0068868_1000156531 479
21 3300005618 Ga0068864_100014308 Ga0068864_1000143081 479
22 3300025903 Ga0207680_10119220 Ga0207680_101192202 479
23 3300025909 Ga0207705_10021931 Ga0207705_100219314 479
24 3300003794 Ga0055531_10000061 Ga0055531_10000061100 481
25 3300025304 Ga0209257_1000006 Ga0209257_1000006154 481
26 3300005334 Ga0068869_100073350 Ga0068869_1000733501 482
27 3300005471 Ga0070698_100017546 Ga0070698_1000175465 482
28 3300005719 Ga0068861_100139270 Ga0068861_1001392702 482
29 3300013297 Ga0157378_10031845 Ga0157378_100318455 482
30 3300014969 Ga0157376_10178277 Ga0157376_101782771 482
31 3300025942 Ga0207689_10009585 Ga0207689_1000958511 482
32 3300049579 Ga0501043_0029998 Ga0501043_0029998_151_1737 483
33 3300005353 Ga0070669_100132656 Ga0070669_1001326562 484
34 3300005843 Ga0068860_100008360 Ga0068860_1000083609 484
35 3300025940 Ga0207691_10053750 Ga0207691_100537502 484
36 3300025960 Ga0207651_10088770 Ga0207651_100887701 484
37 3300028381 Ga0268264_10007266 Ga0268264_100072664 484
38 3300049571 Ga0501034_0038322 Ga0501034_0038322_474_2054 484
39 3300049574 Ga0501038_0018187 Ga0501038_0018187_4132_5712 484
40 3300049579 Ga0501043_0007430 Ga0501043_0007430_2192_3772 484
41 3300049822 Ga0501035_0016056 Ga0501035_0016056_4048_5628 484
42 3300049823 Ga0501044_0018753 Ga0501044_0018753_3131_4711 484
43 3300049585 Ga0501069_0021347 Ga0501069_0021347_1253_2767 487
44 3300005466 Ga0070685_10045589 Ga0070685_100455892 489
45 3300013308 Ga0157375_10237957 Ga0157375_102379572 489
46 3300028794 Ga0307515_10000078 Ga0307515_1000007888 489
47 3300005356 Ga0070674_100065895 Ga0070674_1000658952 491
48 3300005544 Ga0070686_100041622 Ga0070686_1000416222 491
49 3300005615 Ga0070702_100044102 Ga0070702_1000441023 491
50 3300025907 Ga0207645_10026342 Ga0207645_100263422 491
51 3300026121 Ga0207683_10091793 Ga0207683_100917931 491
52 3300005618 Ga0068864_100003219 Ga0068864_1000032198 492
53 3300026095 Ga0207676_10012358 Ga0207676_100123584 492
54 3300005355 Ga0070671_100079509 Ga0070671_1000795092 493
55 3300005364 Ga0070673_100094946 Ga0070673_1000949462 493
56 3300005466 Ga0070685_10059015 Ga0070685_100590152 493
57 3300013105 Ga0157369_10163289 Ga0157369_101632892 493
58 3300013297 Ga0157378_10009646 Ga0157378_100096465 493
59 3300026095 Ga0207676_10089858 Ga0207676_100898582 493
60 3300005329 Ga0070683_100054348 Ga0070683_1000543483 495
61 3300005335 Ga0070666_10000101 Ga0070666_1000010141 495
62 3300005337 Ga0070682_100033195 Ga0070682_1000331952 495
63 3300005339 Ga0070660_100021368 Ga0070660_1000213687 495
64 3300005344 Ga0070661_100034485 Ga0070661_1000344852 495
65 3300005366 Ga0070659_100006647 Ga0070659_10000664711 495
66 3300005530 Ga0070679_100092106 Ga0070679_1000921062 495
67 3300005535 Ga0070684_100046084 Ga0070684_1000460842 495
68 3300005543 Ga0070672_100107728 Ga0070672_1001077282 495
69 3300005563 Ga0068855_100015336 Ga0068855_1000153366 495
70 3300005577 Ga0068857_100149026 Ga0068857_1001490262 495
71 3300005614 Ga0068856_100002777 Ga0068856_1000027779 495
72 3300005616 Ga0068852_100013241 Ga0068852_1000132418 495
73 3300005617 Ga0068859_100000007 Ga0068859_100000007122 495
74 3300005842 Ga0068858_100004081 Ga0068858_1000040815 495
75 3300005843 Ga0068860_100000818 Ga0068860_1000008184 495
76 3300006358 Ga0068871_100048335 Ga0068871_1000483352 495
77 3300006931 Ga0097620_100000007 Ga0097620_100000007123 495
78 3300013100 Ga0157373_10007580 Ga0157373_100075802 495
79 3300013102 Ga0157371_10061496 Ga0157371_100614963 495
80 3300013104 Ga0157370_10102639 Ga0157370_101026393 495
81 3300013105 Ga0157369_10066604 Ga0157369_100666044 495
82 3300013296 Ga0157374_10026914 Ga0157374_100269144 495
83 3300013297 Ga0157378_10009880 Ga0157378_100098808 495
84 3300013307 Ga0157372_10029554 Ga0157372_100295542 495
85 3300025321 Ga0207656_10017760 Ga0207656_100177601 495
86 3300025900 Ga0207710_10024322 Ga0207710_100243222 495
87 3300025903 Ga0207680_10000015 Ga0207680_10000015115 495
88 3300025911 Ga0207654_10010888 Ga0207654_100108881 495
89 3300025914 Ga0207671_10006126 Ga0207671_100061268 495
90 3300025919 Ga0207657_10002466 Ga0207657_100024669 495
91 3300025926 Ga0207659_10094742 Ga0207659_100947421 495
92 3300025932 Ga0207690_10032063 Ga0207690_100320631 495
93 3300025933 Ga0207706_10011288 Ga0207706_100112882 495
94 3300025942 Ga0207689_10002154 Ga0207689_1000215411 495
95 3300025949 Ga0207667_10164852 Ga0207667_101648523 495
96 3300026035 Ga0207703_10006519 Ga0207703_100065197 495
97 3300026088 Ga0207641_10000056 Ga0207641_10000056114 495
98 3300026095 Ga0207676_10022249 Ga0207676_100222494 495
99 3300026142 Ga0207698_10044610 Ga0207698_100446101 495
100 3300028381 Ga0268264_10011359 Ga0268264_100113593 495
101 3300045976 Ga0466967_0300761 Ga0466967_0300761_32_1519 495
102 iso_pu_bacteria 2884791551 2884795240 495
103 3300009174 Ga0105241_10215266 Ga0105241_102152661 496
104 3300009093 Ga0105240_10011455 Ga0105240_100114553 498
105 3300025913 Ga0207695_10017060 Ga0207695_100170603 498
106 3300005331 Ga0070670_100049175 Ga0070670_1000491754 499
107 3300005354 Ga0070675_100185208 Ga0070675_1001852081 499
108 3300014326 Ga0157380_10005409 Ga0157380_100054093 499
109 3300025925 Ga0207650_10024322 Ga0207650_100243223 499
110 3300046523 Ga0495644_0018583 Ga0495644_0018583_1086_2612 500
111 3300009094 Ga0111539_10007515 Ga0111539_100075152 501
112 3300009553 Ga0105249_10132031 Ga0105249_101320311 501
113 3300014326 Ga0157380_10004982 Ga0157380_100049822 501
114 3300049574 Ga0501038_0014433 Ga0501038_0014433_1762_3276 501
115 3300005328 Ga0070676_10032105 Ga0070676_100321052 502
116 3300005335 Ga0070666_10018457 Ga0070666_100184571 502
117 3300005336 Ga0070680_100057351 Ga0070680_1000573513 502
118 3300005347 Ga0070668_100002955 Ga0070668_1000029558 502
119 3300005367 Ga0070667_100029051 Ga0070667_1000290513 502
120 3300005367 Ga0070667_100037568 Ga0070667_1000375682 502
121 3300005457 Ga0070662_100021868 Ga0070662_1000218682 502
122 3300005457 Ga0070662_100054620 Ga0070662_1000546202 502
123 3300005471 Ga0070698_100023102 Ga0070698_1000231025 502
124 3300005535 Ga0070684_100088671 Ga0070684_1000886713 502
125 3300005539 Ga0068853_100060492 Ga0068853_1000604921 502
126 3300005543 Ga0070672_100005270 Ga0070672_1000052701 502
127 3300005548 Ga0070665_100051104 Ga0070665_1000511043 502
128 3300005564 Ga0070664_100097371 Ga0070664_1000973712 502
129 3300005577 Ga0068857_100022666 Ga0068857_1000226661 502
130 3300005616 Ga0068852_100002401 Ga0068852_10000240113 502
131 3300005841 Ga0068863_100014150 Ga0068863_1000141506 502
132 3300005842 Ga0068858_100008377 Ga0068858_1000083773 502
133 3300009553 Ga0105249_10015710 Ga0105249_100157104 502
134 3300013102 Ga0157371_10035080 Ga0157371_100350803 502
135 3300013296 Ga0157374_10015184 Ga0157374_100151842 502
136 3300013306 Ga0163162_10038715 Ga0163162_100387153 502
137 3300013306 Ga0163162_10098431 Ga0163162_100984313 502
138 3300013307 Ga0157372_10109299 Ga0157372_101092993 502
139 3300013308 Ga0157375_10002714 Ga0157375_100027143 502
140 3300014325 Ga0163163_10047603 Ga0163163_100476033 502
141 3300014968 Ga0157379_10003320 Ga0157379_100033208 502
142 3300014969 Ga0157376_10004745 Ga0157376_100047453 502
143 3300017792 Ga0163161_10004337 Ga0163161_100043373 502
144 3300025315 Ga0207697_10048706 Ga0207697_100487061 502
145 3300025907 Ga0207645_10025135 Ga0207645_100251352 502
146 3300025921 Ga0207652_10000765 Ga0207652_100007652 502
147 3300025933 Ga0207706_10016891 Ga0207706_100168916 502
148 3300025933 Ga0207706_10030701 Ga0207706_100307012 502
149 3300025936 Ga0207670_10011804 Ga0207670_100118043 502
150 3300025940 Ga0207691_10008193 Ga0207691_100081932 502
151 3300025942 Ga0207689_10006138 Ga0207689_100061387 502
152 3300025960 Ga0207651_10044342 Ga0207651_100443423 502
153 3300025961 Ga0207712_10112699 Ga0207712_101126992 502
154 3300026023 Ga0207677_10035567 Ga0207677_100355673 502
155 3300026035 Ga0207703_10006633 Ga0207703_100066336 502
156 3300026035 Ga0207703_10065802 Ga0207703_100658021 502
157 3300026088 Ga0207641_10018131 Ga0207641_100181314 502
158 3300026089 Ga0207648_10004009 Ga0207648_100040099 502
159 3300026089 Ga0207648_10073864 Ga0207648_100738642 502
160 3300026142 Ga0207698_10006870 Ga0207698_100068701 502
161 3300028379 Ga0268266_10061317 Ga0268266_100613173 502
162 3300028379 Ga0268266_10117892 Ga0268266_101178922 502
163 3300046516 Ga0495628_0034401 Ga0495628_0034401_1867_3420 502
164 3300046517 Ga0495630_0024056 Ga0495630_0024056_2717_4270 502
165 3300046529 Ga0495652_0085604 Ga0495652_0085604_239_1792 502
166 3300046642 Ga0495634_0018474 Ga0495634_0018474_1741_3294 502
167 3300005328 Ga0070676_10001437 Ga0070676_100014372 503
168 3300005329 Ga0070683_100026515 Ga0070683_1000265152 503
169 3300005331 Ga0070670_100043213 Ga0070670_1000432131 503
170 3300005334 Ga0068869_100097861 Ga0068869_1000978611 503
171 3300005338 Ga0068868_100005797 Ga0068868_1000057975 503
172 3300005340 Ga0070689_100016676 Ga0070689_1000166765 503
173 3300005340 Ga0070689_100135732 Ga0070689_1001357321 503
174 3300005353 Ga0070669_100010884 Ga0070669_1000108845 503
175 3300005356 Ga0070674_100013231 Ga0070674_1000132312 503
176 3300005364 Ga0070673_100013380 Ga0070673_1000133804 503
177 3300005367 Ga0070667_100021719 Ga0070667_1000217192 503
178 3300005456 Ga0070678_100019010 Ga0070678_1000190104 503
179 3300005466 Ga0070685_10002595 Ga0070685_100025952 503
180 3300005471 Ga0070698_100007300 Ga0070698_1000073002 503
181 3300005543 Ga0070672_100025059 Ga0070672_1000250592 503
182 3300005548 Ga0070665_100043048 Ga0070665_1000430482 503
183 3300005564 Ga0070664_100044712 Ga0070664_1000447123 503
184 3300005617 Ga0068859_100017401 Ga0068859_1000174015 503
185 3300005617 Ga0068859_100021842 Ga0068859_1000218425 503
186 3300005618 Ga0068864_100040445 Ga0068864_1000404453 503
187 3300005618 Ga0068864_100069927 Ga0068864_1000699273 503
188 3300005718 Ga0068866_10009030 Ga0068866_100090303 503
189 3300005841 Ga0068863_100000546 Ga0068863_10000054624 503
190 3300005841 Ga0068863_100198712 Ga0068863_1001987122 503
191 3300005843 Ga0068860_100003442 Ga0068860_1000034428 503
192 3300005843 Ga0068860_100024030 Ga0068860_1000240302 503
193 3300005843 Ga0068860_100024747 Ga0068860_1000247472 503
194 3300006237 Ga0097621_100000307 Ga0097621_1000003073 503
195 3300006358 Ga0068871_100000545 Ga0068871_10000054510 503
196 3300006881 Ga0068865_100010479 Ga0068865_1000104795 503
197 3300006931 Ga0097620_100017401 Ga0097620_1000174015 503
198 3300006931 Ga0097620_100021842 Ga0097620_1000218422 503
199 3300009101 Ga0105247_10006328 Ga0105247_100063284 503
200 3300009147 Ga0114129_10047428 Ga0114129_100474282 503
201 3300009176 Ga0105242_10021712 Ga0105242_100217122 503
202 3300009176 Ga0105242_10062990 Ga0105242_100629902 503
203 3300009177 Ga0105248_10022088 Ga0105248_100220886 503
204 3300009177 Ga0105248_10340750 Ga0105248_103407501 503
205 3300009545 Ga0105237_10035361 Ga0105237_100353613 503
206 3300009545 Ga0105237_10048438 Ga0105237_100484382 503
207 3300009553 Ga0105249_10002465 Ga0105249_100024657 503
208 3300009553 Ga0105249_10002959 Ga0105249_100029592 503
209 3300009553 Ga0105249_10004036 Ga0105249_100040366 503
210 3300010375 Ga0105239_10026153 Ga0105239_100261534 503
211 3300010375 Ga0105239_10127735 Ga0105239_101277352 503
212 3300011119 Ga0105246_10018910 Ga0105246_100189103 503
213 3300013297 Ga0157378_10049419 Ga0157378_100494195 503
214 3300013306 Ga0163162_10000225 Ga0163162_1000022521 503
215 3300013306 Ga0163162_10000226 Ga0163162_1000022646 503
216 3300013306 Ga0163162_10002251 Ga0163162_100022518 503
217 3300013306 Ga0163162_10011349 Ga0163162_100113492 503
218 3300013306 Ga0163162_10016729 Ga0163162_100167294 503
219 3300013308 Ga0157375_10000215 Ga0157375_1000021520 503
220 3300014325 Ga0163163_10000079 Ga0163163_1000007980 503
221 3300014325 Ga0163163_10039463 Ga0163163_100394633 503
222 3300014326 Ga0157380_10009627 Ga0157380_100096271 503
223 3300014968 Ga0157379_10014699 Ga0157379_100146992 503
224 3300014969 Ga0157376_10000137 Ga0157376_1000013721 503
225 3300014969 Ga0157376_10015155 Ga0157376_100151555 503
226 3300014969 Ga0157376_10081961 Ga0157376_100819612 503
227 3300017792 Ga0163161_10008568 Ga0163161_100085685 503
228 3300017792 Ga0163161_10017967 Ga0163161_100179672 503
229 3300017792 Ga0163161_10049652 Ga0163161_100496522 503
230 3300025907 Ga0207645_10000524 Ga0207645_1000052420 503
231 3300025908 Ga0207643_10004945 Ga0207643_100049455 503
232 3300025908 Ga0207643_10004947 Ga0207643_100049475 503
233 3300025914 Ga0207671_10032954 Ga0207671_100329544 503
234 3300025934 Ga0207686_10030614 Ga0207686_100306142 503
235 3300025936 Ga0207670_10011801 Ga0207670_100118011 503
236 3300025940 Ga0207691_10038617 Ga0207691_100386174 503
237 3300025941 Ga0207711_10204325 Ga0207711_102043252 503
238 3300025942 Ga0207689_10031458 Ga0207689_100314583 503
239 3300025942 Ga0207689_10057983 Ga0207689_100579831 503
240 3300025961 Ga0207712_10000871 Ga0207712_1000087111 503
241 3300025961 Ga0207712_10005569 Ga0207712_100055692 503
242 3300026023 Ga0207677_10016693 Ga0207677_100166934 503
243 3300026088 Ga0207641_10000539 Ga0207641_1000053925 503
244 3300026089 Ga0207648_10143330 Ga0207648_101433301 503
245 3300026121 Ga0207683_10017015 Ga0207683_100170153 503
246 3300028380 Ga0268265_10039305 Ga0268265_100393052 503
247 3300028381 Ga0268264_10001194 Ga0268264_1000119416 503
248 3300028381 Ga0268264_10015082 Ga0268264_100150826 503
249 3300028381 Ga0268264_10072475 Ga0268264_100724752 503
250 3300048903 Ga0496100_0024813 Ga0496100_0024813_134_1744 503
251 3300048904 Ga0496101_0019032 Ga0496101_0019032_1752_3362 503
252 3300048917 Ga0496114_0037998 Ga0496114_0037998_599_2209 503
253 3300050510 nmdc:mga06r32_117432_c1 nmdc:mga06r32_117432_c1_991_2526 503
254 3300003354 JGI25160J50197_1000630 JGI25160J50197_100063016 504
255 3300005337 Ga0070682_100000897 Ga0070682_1000008974 504
256 3300005341 Ga0070691_10004749 Ga0070691_100047492 504
257 3300005530 Ga0070679_100000798 Ga0070679_1000007988 504
258 3300005539 Ga0068853_100010181 Ga0068853_1000101814 504
259 3300005539 Ga0068853_100093967 Ga0068853_1000939672 504
260 3300005547 Ga0070693_100002207 Ga0070693_1000022074 504
261 3300006847 Ga0075431_100049098 Ga0075431_1000490984 504
262 3300009093 Ga0105240_10001840 Ga0105240_1000184013 504
263 3300009147 Ga0114129_10057210 Ga0114129_100572102 504
264 3300009174 Ga0105241_10001016 Ga0105241_100010168 504
265 3300013104 Ga0157370_10004224 Ga0157370_100042249 504
266 3300025302 Ga0207426_1000019 Ga0207426_1000019475 504
267 3300025911 Ga0207654_10000885 Ga0207654_1000088510 504
268 3300025917 Ga0207660_10002326 Ga0207660_100023267 504
269 3300025921 Ga0207652_10000622 Ga0207652_1000062212 504
270 3300026041 Ga0207639_10074646 Ga0207639_100746462 504
271 3300028794 Ga0307515_10000408 Ga0307515_100004085 504
272 3300049589 Ga0501073_0085412 Ga0501073_0085412_523_2115 504
273 3300049742 Ga0501080_0125346 Ga0501080_0125346_421_2013 504
274 3300049744 Ga0501083_0028129 Ga0501083_0028129_547_2112 504
275 3300050510 nmdc:mga06r32_89422_c1 nmdc:mga06r32_89422_c1_970_2502 504
276 3300053146 Ga0500588_0003351 Ga0500588_0003351_1241_2818 504

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03747

ADP_ribosyl_GH

ADP-ribosylglycohydrolase

49

339

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yzw-assembly1.cif.gz_A adp-ribosylglycohydrolase-related protein complex 0.7908 28 360
2yzw-assembly1.cif.gz_A adp-ribosylglycohydrolase-related protein complex 0.7805 28 360
6drh-assembly2.cif.gz_C adp-ribosyltransferase toxin/immunity pair 0.7542 25 358
2wod-assembly2.cif.gz_B crystal structure of the dinitrogenase reductase-activating glycohydrolase (drag) from rhodospirillum rubrum in complex with adp- ribsoyllysine 0.7413 30 360
3g9d-assembly2.cif.gz_B crystal structure glycohydrolase 0.7233 29 360
ID Description Score Start End Superfamily
2cwcA00 Mainly Alpha;Orthogonal Bundle;ADP-ribosylglycohydrolase fold;ADP-ribosylation/Crystallin J1 0.7915 30 362 1.10.4080.10
2cwcA00 Mainly Alpha;Orthogonal Bundle;ADP-ribosylglycohydrolase fold;ADP-ribosylation/Crystallin J1 0.7787 30 362 1.10.4080.10
af_P76418_2_329_1.10.4080.10 Mainly Alpha;Orthogonal Bundle;ADP-ribosylglycohydrolase fold;ADP-ribosylation/Crystallin J1 0.7294 31 358 1.10.4080.10
af_P76418_2_329_1.10.4080.10 Mainly Alpha;Orthogonal Bundle;ADP-ribosylglycohydrolase fold;ADP-ribosylation/Crystallin J1 0.7233 31 358 1.10.4080.10
3g9dB00 Mainly Alpha;Orthogonal Bundle;ADP-ribosylglycohydrolase fold;ADP-ribosylation/Crystallin J1 0.7233 29 360 1.10.4080.10
ID Description Score Start End GO Terms
AF-A0A524NQI9-F1-model_v4 ADP-ribosylglycohydrolase family protein 0.9871 22 501 GO:0016787
AF-E5V775-F1-model_v4 deleted 0.9869 25 500
AF-A0A3M1XPT9-F1-model_v4 ADP-ribosylglycohydrolase family protein 0.9865 18 390 GO:0016787
AF-A0A519VRR1-F1-model_v4 ADP-ribosylglycohydrolase family protein 0.9864 28 316 GO:0016787
AF-A0A1Y4AME3-F1-model_v4 ADP-ribosylglycohydrolase 0.9862 20 500

Feature Viewer

pLDDT pTM Quality
91.88 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map