F380845

General Info

Members Datasets Scaffolds Average Seq Length
276 166 271 254

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10181017|rootL2_101810174
Length 292
Sequence MLSSVKNRMFKCATQGTVFMKTSSWKQKLIYCLHKNMSLTPNLKLLLIEAGDISRFTGRFFQQWFKPRYEIAEFIRQCFVIGYKSFPLVGLTAFILGLVLTMQLRPSMVDYGVESQIPAIVGIAIVREVGPVIIALIFAGKIGSSIGAELGSMKVTEQIDAMEVSGTNPFKYLVVTRVLAATLMLPVLVMLGDAISLYGSYLGVNIHSTTSFNLFWSQVFDNLSFADVLPAYIKSYFFGFAVGIIGCYKGYNSSKGTEGVGRSANSAVVISSVMIFVIDLLAVQVTDVLGFN

Samples

Sample ID Description Type Environment
1 2738541283 Pedobacter sp. OK701 Isolate Unclassified
2 2738543023 Pedobacter sp. OK628 Isolate Unclassified
3 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
4 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
5 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
6 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
76 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
77 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
111 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
112 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
113 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
114 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
115 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
125 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
126 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
127 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
132 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
135 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
136 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
137 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
138 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
141 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
163 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
164 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
165 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
166 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.19
Metatranscriptomes 0
Isolates 1.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.35
Nodule 0
Rhizoplane 0.36
Rhizosphere 85.87
Stem 0
Stem Tuber 0
Unclassified 9.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1005098 3300001904 Bacteria 2224
2 JGI24739J22299_10026646 3300001989 Bacteria 2026
3 JGI24735J21928_10000012 3300002067 Bacteria 208921
4 JGI25154J39366_1005588 3300002738 Bacteria 1976
5 JGI25157J39369_1008982 3300002741 Bacteria 1364
6 rootH1_10014902 3300003316 Bacteria 16616
7 rootH1_10057825 3300003316 Bacteria 6270
8 rootH1_10095269 3300003316 Bacteria 8902
9 rootH2_10000256 3300003320 Bacteria 54479
10 rootH2_10004072 3300003320 Bacteria 38215
11 rootH2_10072708 3300003320 Bacteria 30934
12 rootL2_10013153 3300003322 Bacteria 31542
13 rootL2_10181017 3300003322 Bacteria 3623
14 rootL2_10213473 3300003322 Bacteria 1546
15 rootL2_10228406 3300003322 Bacteria 1950
16 rootL2_10316265 3300003322 Bacteria 1703
17 rootH1_10011789 3300003323 Bacteria 124621
18 rootH1_10017667 3300003323 Bacteria 9900
19 rootH1_10122433 3300003323 Bacteria 9359
20 rootH1_10326300 3300003323 Bacteria 2189
21 Ga0055531_10000033 3300003794 Bacteria 152935
22 Ga0065714_10004122 3300005288 Bacteria 18747
23 Ga0065714_10064615 3300005288 Bacteria 28651
24 Ga0065714_10082539 3300005288 Bacteria 2301
25 Ga0065704_10122952 3300005289 Bacteria 1741
26 Ga0070658_10099094 3300005327 Bacteria 2408
27 Ga0068869_100013604 3300005334 Bacteria 5416
28 Ga0068869_100175458 3300005334 Unclassified 1677
29 Ga0070666_10000583 3300005335 Bacteria 22014
30 Ga0068868_100103170 3300005338 Bacteria 2310
31 Ga0070660_100054052 3300005339 Bacteria 3099
32 Ga0070661_100161969 3300005344 Bacteria 1695
33 Ga0070668_100133527 3300005347 Bacteria 1994
34 Ga0070669_100493926 3300005353 Bacteria 1014
35 Ga0070688_100191089 3300005365 Bacteria 1426
36 Ga0070659_100000352 3300005366 Bacteria 35096
37 Ga0070659_100008383 3300005366 Bacteria 7550
38 Ga0070659_100012460 3300005366 Bacteria 6304
39 Ga0070667_100015504 3300005367 Bacteria 6300
40 Ga0070714_100265279 3300005435 Bacteria 1591
41 Ga0070713_100675192 3300005436 Bacteria 985
42 Ga0070685_10274412 3300005466 Bacteria 1126
43 Ga0070684_100066427 3300005535 Bacteria 3166
44 Ga0068853_100023268 3300005539 Bacteria 5184
45 Ga0068853_100088493 3300005539 Bacteria 2719
46 Ga0070665_100008074 3300005548 Bacteria 10656
47 Ga0068855_100011309 3300005563 Bacteria 10777
48 Ga0068855_100051774 3300005563 Bacteria 4836
49 Ga0068855_100600461 3300005563 Bacteria 1187
50 Ga0068857_100003869 3300005577 Bacteria 12606
51 Ga0068857_100425637 3300005577 Unclassified 1238
52 Ga0068857_101014156 3300005577 Bacteria 799
53 Ga0068854_100291852 3300005578 Unclassified 1316
54 Ga0068856_100000224 3300005614 Bacteria 61427
55 Ga0068856_100018106 3300005614 Bacteria 6830
56 Ga0068856_100027680 3300005614 Bacteria 5531
57 Ga0068856_100040589 3300005614 Bacteria 4572
58 Ga0068856_100210565 3300005614 Bacteria 1959
59 Ga0068856_100225580 3300005614 Bacteria 1889
60 Ga0068852_100014321 3300005616 Bacteria 6100
61 Ga0068852_100053026 3300005616 Bacteria 3489
62 Ga0068852_100185026 3300005616 Bacteria 1961
63 Ga0068859_100000041 3300005617 Bacteria 162415
64 Ga0068859_100447874 3300005617 Unclassified 1387
65 Ga0068864_100031625 3300005618 Bacteria 4492
66 Ga0068851_10045196 3300005834 Bacteria 2225
67 Ga0068863_100003110 3300005841 Bacteria 16378
68 Ga0068858_100190829 3300005842 Bacteria 1936
69 Ga0068860_100012286 3300005843 Bacteria 8438
70 Ga0075366_10076148 3300006195 Bacteria 2002
71 Ga0075428_100016242 3300006844 Bacteria 8228
72 Ga0075430_100503921 3300006846 Bacteria 999
73 Ga0097620_100000041 3300006931 Bacteria 162415
74 Ga0097620_100447924 3300006931 Unclassified 1387
75 Ga0105240_10000010 3300009093 Bacteria 537830
76 Ga0105240_10000054 3300009093 Bacteria 225529
77 Ga0105240_10000098 3300009093 Bacteria 178435
78 Ga0105240_10155002 3300009093 Bacteria 2725
79 Ga0105240_10155381 3300009093 Bacteria 2722
80 Ga0111539_10025888 3300009094 Bacteria 7181
81 Ga0105245_10082249 3300009098 Bacteria 2946
82 Ga0114129_10012202 3300009147 Bacteria 12227
83 Ga0105241_10000706 3300009174 Bacteria 25262
84 Ga0105241_10075684 3300009174 Bacteria 2623
85 Ga0105241_10082644 3300009174 Bacteria 2518
86 Ga0105241_10426122 3300009174 Bacteria 1169
87 Ga0105237_10000317 3300009545 Bacteria 67573
88 Ga0105237_10002453 3300009545 Bacteria 23025
89 Ga0105237_10003076 3300009545 Bacteria 20107
90 Ga0105237_10003435 3300009545 Bacteria 18798
91 Ga0105237_10006429 3300009545 Bacteria 13035
92 Ga0105237_10007625 3300009545 Bacteria 11828
93 Ga0105237_10008496 3300009545 Bacteria 11110
94 Ga0105237_10021652 3300009545 Bacteria 6608
95 Ga0105237_10022692 3300009545 Bacteria 6439
96 Ga0105237_10039730 3300009545 Bacteria 4749
97 Ga0105237_10063939 3300009545 Bacteria 3676
98 Ga0105238_10040134 3300009551 Bacteria 4744
99 Ga0105238_10202063 3300009551 Bacteria 1963
100 Ga0105238_10505574 3300009551 Bacteria 1210
101 Ga0105249_10003956 3300009553 Bacteria 12788
102 Ga0105239_10000193 3300010375 Bacteria 88304
103 Ga0105239_10004519 3300010375 Bacteria 16588
104 Ga0105239_10006489 3300010375 Bacteria 13565
105 Ga0105239_10100522 3300010375 Bacteria 3199
106 Ga0105246_10014723 3300011119 Bacteria 4924
107 Ga0157373_10023825 3300013100 Bacteria 4436
108 Ga0157371_10007181 3300013102 Bacteria 9048
109 Ga0157371_10039196 3300013102 Bacteria 3388
110 Ga0157371_10042893 3300013102 Bacteria 3224
111 Ga0157371_10414904 3300013102 Bacteria 986
112 Ga0157370_10005029 3300013104 Bacteria 14933
113 Ga0157370_10165250 3300013104 Bacteria 2058
114 Ga0157369_10018816 3300013105 Bacteria 7742
115 Ga0157369_10130085 3300013105 Bacteria 2668
116 Ga0157374_10136302 3300013296 Bacteria 2380
117 Ga0157378_10067809 3300013297 Bacteria 3198
118 Ga0157378_10961924 3300013297 Bacteria 887
119 Ga0163162_10000409 3300013306 Bacteria 39406
120 Ga0157372_10000350 3300013307 Bacteria 50482
121 Ga0157372_10017833 3300013307 Bacteria 7624
122 Ga0157372_10029273 3300013307 Bacteria 6012
123 Ga0157372_10052084 3300013307 Bacteria 4557
124 Ga0157372_10132981 3300013307 Bacteria 2864
125 Ga0157372_10180426 3300013307 Bacteria 2444
126 Ga0157372_10270111 3300013307 Bacteria 1976
127 Ga0157375_10065647 3300013308 Bacteria 3618
128 Ga0157380_10002328 3300014326 Bacteria 12761
129 Ga0157380_10254304 3300014326 Bacteria 1592
130 Ga0182008_10000004 3300014497 Bacteria 436804
131 Ga0182008_10000974 3300014497 Bacteria 19881
132 Ga0157379_10047919 3300014968 Bacteria 3814
133 Ga0157379_10227368 3300014968 Bacteria 1691
134 Ga0157376_10158117 3300014969 Bacteria 2051
135 Ga0182006_1007967 3300015261 Bacteria 4817
136 Ga0163161_10010850 3300017792 Bacteria 6316
137 Ga0209646_1001027 3300025246 Bacteria 8447
138 Ga0209026_1000484 3300025250 Bacteria 29488
139 Ga0209455_1009236 3300025272 Bacteria 2605
140 Ga0209050_1001952 3300025298 Bacteria 19511
141 Ga0209257_1000023 3300025304 Bacteria 753019
142 Ga0207656_10042792 3300025321 Bacteria 1929
143 Ga0207647_10000011 3300025904 Bacteria 156667
144 Ga0207647_10002070 3300025904 Bacteria 15333
145 Ga0207654_10001382 3300025911 Bacteria 12858
146 Ga0207654_10191447 3300025911 Bacteria 1341
147 Ga0207695_10000019 3300025913 Bacteria 732137
148 Ga0207695_10000043 3300025913 Bacteria 444585
149 Ga0207695_10009762 3300025913 Bacteria 11808
150 Ga0207695_10011786 3300025913 Bacteria 10554
151 Ga0207671_10000248 3300025914 Bacteria 80829
152 Ga0207671_10000468 3300025914 Bacteria 55019
153 Ga0207671_10003737 3300025914 Bacteria 14998
154 Ga0207671_10005727 3300025914 Bacteria 11328
155 Ga0207671_10015952 3300025914 Bacteria 5857
156 Ga0207671_10036331 3300025914 Bacteria 3653
157 Ga0207671_10226931 3300025914 Bacteria 1464
158 Ga0207657_10061201 3300025919 Bacteria 3229
159 Ga0207657_10159791 3300025919 Bacteria 1831
160 Ga0207649_10124394 3300025920 Bacteria 1743
161 Ga0207694_10014569 3300025924 Bacteria 5928
162 Ga0207664_10059218 3300025929 Bacteria 3049
163 Ga0207690_10001264 3300025932 Bacteria 16001
164 Ga0207690_10058225 3300025932 Bacteria 2613
165 Ga0207669_10258106 3300025937 Bacteria 1302
166 Ga0207691_10067924 3300025940 Bacteria 3221
167 Ga0207689_10000684 3300025942 Bacteria 32357
168 Ga0207667_10009293 3300025949 Bacteria 11596
169 Ga0207667_10127675 3300025949 Bacteria 2619
170 Ga0207651_10064468 3300025960 Bacteria 2565
171 Ga0207712_10002569 3300025961 Bacteria 11670
172 Ga0207668_10056206 3300025972 Bacteria 2740
173 Ga0207640_10338083 3300025981 Unclassified 1205
174 Ga0207658_10088231 3300025986 Bacteria 2397
175 Ga0207677_10076679 3300026023 Bacteria 2381
176 Ga0207703_10011021 3300026035 Bacteria 7044
177 Ga0207639_10076970 3300026041 Bacteria 2628
178 Ga0207639_10126984 3300026041 Bacteria 2105
179 Ga0207639_10135821 3300026041 Bacteria 2042
180 Ga0207702_10000223 3300026078 Bacteria 66194
181 Ga0207702_10012756 3300026078 Bacteria 6992
182 Ga0207702_10069092 3300026078 Bacteria 3036
183 Ga0207702_10290504 3300026078 Bacteria 1549
184 Ga0207641_10000369 3300026088 Bacteria 53464
185 Ga0207648_10401073 3300026089 Bacteria 1243
186 Ga0207674_10007074 3300026116 Bacteria 13108
187 Ga0207674_10436423 3300026116 Unclassified 1266
188 Ga0207698_10045823 3300026142 Bacteria 3297
189 Ga0207698_10089325 3300026142 Bacteria 2516
190 Ga0207698_10606499 3300026142 Bacteria 1080
191 Ga0268266_10003330 3300028379 Bacteria 16098
192 Ga0268265_10096047 3300028380 Bacteria 2381
193 Ga0268264_10017331 3300028381 Bacteria 5902
194 Ga0307517_10002012 3300028786 Bacteria 33092
195 Ga0307515_10279437 3300028794 Bacteria 1379
196 Ga0265324_10019579 3300029957 Bacteria 2436
197 Ga0265339_10090164 3300031249 Unclassified 1608
198 Ga0265327_10000090 3300031251 Bacteria 197158
199 Ga0307509_10129376 3300031507 Bacteria 2484
200 Ga0307509_10254744 3300031507 Unclassified 1535
201 Ga0307405_10060938 3300031731 Bacteria 2383
202 Ga0307410_10001845 3300031852 Bacteria 9869
203 Ga0307406_10000075 3300031901 Bacteria 54768
204 Ga0307407_10006316 3300031903 Bacteria 5248
205 Ga0307407_10194918 3300031903 Bacteria 1353
206 Ga0307412_10053613 3300031911 Bacteria 2674
207 Ga0307412_10371801 3300031911 Bacteria 1154
208 Ga0307415_100197193 3300032126 Bacteria 1594
209 Ga0307510_10234147 3300033180 Bacteria 1337
210 Ga0373937_0042142 3300036401 Bacteria 4165
211 Ga0439439_0004463 3300041406 Bacteria 3157
212 Ga0439457_002836 3300042014 Bacteria 4841
213 Ga0451577_0000763 3300042876 Bacteria 49014
214 Ga0466972_0000063 3300044658 Bacteria 105889
215 Ga0453684_0000626 3300044712 Bacteria 128697
216 Ga0453684_0001992 3300044712 Bacteria 52379
217 Ga0453684_0439768 3300044712 Unclassified 1453
218 Ga0466957_0006772 3300044842 Bacteria 6474
219 Ga0451576_0005368 3300045051 Bacteria 16110
220 Ga0451576_0109183 3300045051 Bacteria 2879
221 Ga0495592_0143899 3300046454 Bacteria 1655
222 Ga0495638_0000015 3300046460 Bacteria 414645
223 Ga0495638_0183570 3300046460 Bacteria 1192
224 Ga0495651_0199990 3300046462 Unclassified 1399
225 Ga0495664_0152628 3300046477 Bacteria 1401
226 Ga0495642_0087861 3300046528 Bacteria 1314
227 Ga0495652_0101826 3300046529 Bacteria 2328
228 Ga0495640_0361679 3300046533 Bacteria 895
229 Ga0495668_0000003 3300046616 Bacteria 695023
230 Ga0495625_0000607 3300046660 Bacteria 52064
231 Ga0495670_0053602 3300046691 Bacteria 2020
232 Ga0495614_0027058 3300048089 Bacteria 2473
233 Ga0496114_0003996 3300048917 Bacteria 11388
234 Ga0501032_0012415 3300049569 Bacteria 6087
235 Ga0501032_0102132 3300049569 Unclassified 1900
236 Ga0501034_0005294 3300049571 Bacteria 14147
237 Ga0501034_0137821 3300049571 Unclassified 2420
238 Ga0501034_0144686 3300049571 Bacteria 2355
239 Ga0501034_0194782 3300049571 Bacteria 1987
240 Ga0501034_0234091 3300049571 Unclassified 1785
241 Ga0501036_0007972 3300049572 Bacteria 8666
242 Ga0501037_0248057 3300049573 Unclassified 1246
243 Ga0501038_0040447 3300049574 Unclassified 4071
244 Ga0501039_0017391 3300049575 Bacteria 5514
245 Ga0501043_0004679 3300049579 Bacteria 11095
246 Ga0501043_0011803 3300049579 Bacteria 6842
247 Ga0501046_0001390 3300049580 Bacteria 23300
248 Ga0501046_0085775 3300049580 Bacteria 2427
249 Ga0501046_0207386 3300049580 Unclassified 1456
250 Ga0501047_0004353 3300049581 Bacteria 13319
251 Ga0501047_0203394 3300049581 Bacteria 1840
252 Ga0501073_0061872 3300049589 Bacteria 2611
253 Ga0501073_0481092 3300049589 Bacteria 858
254 Ga0501074_0002763 3300049590 Bacteria 12278
255 Ga0501074_0014458 3300049590 Bacteria 5742
256 Ga0501202_003189 3300049652 Bacteria 2797
257 Ga0501080_0105598 3300049742 Bacteria 2611
258 Ga0501080_0149605 3300049742 Bacteria 2158
259 Ga0501035_0002292 3300049822 Bacteria 18903
260 Ga0501044_0004343 3300049823 Bacteria 15878
261 Ga0501044_0016187 3300049823 Bacteria 8015
262 nmdc:mga0k408_38946_c1 3300050493 Bacteria 2729
263 nmdc:mga05p37_11886_c1 3300050507 Bacteria 10380
264 nmdc:mga0qj67_369570_c1 3300050509 Bacteria 1158
265 nmdc:mga08y16_38973_c1 3300050511 Bacteria 4987
266 Ga0500644_0027928 3300053088 Bacteria 1760
267 Ga0500658_0082587 3300053134 Bacteria 1377
268 Ga0500573_0122410 3300053140 Bacteria 1447
269 Ga0500622_0002388 3300053156 Bacteria 13600
270 Ga0500622_0011729 3300053156 Bacteria 4763
271 Ga0500636_0032946 3300053177 Bacteria 3068

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005616 Ga0068852_100185026 Ga0068852_1001850263 234
2 3300009174 Ga0105241_10426122 Ga0105241_104261222 234
3 3300026142 Ga0207698_10606499 Ga0207698_106064992 234
4 3300009093 Ga0105240_10000010 Ga0105240_10000010236 235
5 3300009545 Ga0105237_10000317 Ga0105237_1000031739 235
6 3300009551 Ga0105238_10040134 Ga0105238_100401342 235
7 3300010375 Ga0105239_10004519 Ga0105239_100045193 235
8 3300025913 Ga0207695_10000019 Ga0207695_10000019219 235
9 3300025914 Ga0207671_10015952 Ga0207671_100159522 235
10 3300025924 Ga0207694_10014569 Ga0207694_100145692 235
11 3300013307 Ga0157372_10132981 Ga0157372_101329813 236
12 3300031731 Ga0307405_10060938 Ga0307405_100609383 236
13 3300031852 Ga0307410_10001845 Ga0307410_100018456 236
14 3300031901 Ga0307406_10000075 Ga0307406_100000751 236
15 3300031903 Ga0307407_10006316 Ga0307407_100063162 236
16 3300031911 Ga0307412_10371801 Ga0307412_103718011 236
17 3300046462 Ga0495651_0199990 Ga0495651_0199990_266_1036 237
18 3300005288 Ga0065714_10064615 Ga0065714_1006461522 241
19 3300009174 Ga0105241_10082644 Ga0105241_100826443 241
20 3300014497 Ga0182008_10000004 Ga0182008_1000000413 241
21 3300017792 Ga0163161_10010850 Ga0163161_100108501 241
22 3300025272 Ga0209455_1009236 Ga0209455_10092364 241
23 3300005338 Ga0068868_100103170 Ga0068868_1001031703 242
24 3300005347 Ga0070668_100133527 Ga0070668_1001335272 242
25 3300025960 Ga0207651_10064468 Ga0207651_100644682 242
26 3300025972 Ga0207668_10056206 Ga0207668_100562062 242
27 3300026023 Ga0207677_10076679 Ga0207677_100766793 242
28 3300026089 Ga0207648_10401073 Ga0207648_104010731 242
29 3300003794 Ga0055531_10000033 Ga0055531_1000003360 243
30 3300005548 Ga0070665_100008074 Ga0070665_1000080746 243
31 3300009545 Ga0105237_10003435 Ga0105237_100034357 243
32 3300009551 Ga0105238_10505574 Ga0105238_105055741 243
33 3300014497 Ga0182008_10000974 Ga0182008_100009748 243
34 3300025304 Ga0209257_1000023 Ga0209257_1000023315 243
35 3300025904 Ga0207647_10002070 Ga0207647_1000207012 243
36 3300025913 Ga0207695_10009762 Ga0207695_100097626 243
37 3300028379 Ga0268266_10003330 Ga0268266_100033305 243
38 3300028794 Ga0307515_10279437 Ga0307515_102794372 243
39 3300003316 rootH1_10057825 rootH1_100578255 245
40 3300031903 Ga0307407_10194918 Ga0307407_101949181 245
41 3300031911 Ga0307412_10053613 Ga0307412_100536131 245
42 3300046529 Ga0495652_0101826 Ga0495652_0101826_761_1531 245
43 3300005344 Ga0070661_100161969 Ga0070661_1001619692 246
44 3300025920 Ga0207649_10124394 Ga0207649_101243942 246
45 3300028380 Ga0268265_10096047 Ga0268265_100960473 246
46 3300005563 Ga0068855_100011309 Ga0068855_1000113096 247
47 3300005577 Ga0068857_100003869 Ga0068857_1000038697 247
48 3300005614 Ga0068856_100040589 Ga0068856_1000405894 247
49 3300009545 Ga0105237_10003076 Ga0105237_1000307614 247
50 3300025949 Ga0207667_10009293 Ga0207667_100092936 247
51 3300026078 Ga0207702_10069092 Ga0207702_100690922 247
52 3300026116 Ga0207674_10007074 Ga0207674_100070746 247
53 3300006844 Ga0075428_100016242 Ga0075428_1000162424 249
54 3300009094 Ga0111539_10025888 Ga0111539_100258884 249
55 3300050511 nmdc:mga08y16_38973_c1 nmdc:mga08y16_38973_c1_161_910 249
56 3300005436 Ga0070713_100675192 Ga0070713_1006751921 250
57 3300003323 rootH1_10011789 rootH1_1001178947 251
58 3300005288 Ga0065714_10082539 Ga0065714_100825393 252
59 3300014326 Ga0157380_10254304 Ga0157380_102543042 252
60 3300014968 Ga0157379_10227368 Ga0157379_102273681 252
61 3300033180 Ga0307510_10234147 Ga0307510_102341472 252
62 3300041406 Ga0439439_0004463 Ga0439439_0004463_2101_2859 252
63 iso_pu_bacteria 2738541283 2738758647 252
64 iso_pu_bacteria 2852623160 2852626109 252
65 iso_pu_bacteria 2884933994 2884935420 252
66 iso_pu_bacteria 2932082852 2932083702 252
67 3300005289 Ga0065704_10122952 Ga0065704_101229522 253
68 iso_pu_bacteria 2738543023 2739300302 253
69 3300013102 Ga0157371_10414904 Ga0157371_104149041 254
70 3300013297 Ga0157378_10067809 Ga0157378_100678094 254
71 3300013307 Ga0157372_10017833 Ga0157372_100178333 254
72 3300013307 Ga0157372_10270111 Ga0157372_102701112 254
73 3300005435 Ga0070714_100265279 Ga0070714_1002652792 255
74 3300025929 Ga0207664_10059218 Ga0207664_100592184 255
75 3300029957 Ga0265324_10019579 Ga0265324_100195792 255
76 3300031249 Ga0265339_10090164 Ga0265339_100901642 255
77 3300001904 JGI24736J21556_1005098 JGI24736J21556_10050982 256
78 3300001989 JGI24739J22299_10026646 JGI24739J22299_100266463 256
79 3300002067 JGI24735J21928_10000012 JGI24735J21928_10000012166 256
80 3300002738 JGI25154J39366_1005588 JGI25154J39366_10055883 256
81 3300002741 JGI25157J39369_1008982 JGI25157J39369_10089822 256
82 3300003316 rootH1_10014902 rootH1_100149028 256
83 3300003316 rootH1_10095269 rootH1_100952695 256
84 3300003320 rootH2_10000256 rootH2_100002565 256
85 3300003320 rootH2_10004072 rootH2_1000407223 256
86 3300003320 rootH2_10072708 rootH2_100727084 256
87 3300003322 rootL2_10013153 rootL2_1001315341 256
88 3300003322 rootL2_10181017 rootL2_101810174 256
89 3300003322 rootL2_10213473 rootL2_102134732 256
90 3300003322 rootL2_10228406 rootL2_102284062 256
91 3300003322 rootL2_10316265 rootL2_103162652 256
92 3300003323 rootH1_10017667 rootH1_100176678 256
93 3300003323 rootH1_10122433 rootH1_101224338 256
94 3300003323 rootH1_10326300 rootH1_103263002 256
95 3300005288 Ga0065714_10004122 Ga0065714_1000412214 256
96 3300005327 Ga0070658_10099094 Ga0070658_100990941 256
97 3300005334 Ga0068869_100013604 Ga0068869_1000136044 256
98 3300005334 Ga0068869_100175458 Ga0068869_1001754582 256
99 3300005335 Ga0070666_10000583 Ga0070666_1000058319 256
100 3300005339 Ga0070660_100054052 Ga0070660_1000540522 256
101 3300005353 Ga0070669_100493926 Ga0070669_1004939261 256
102 3300005365 Ga0070688_100191089 Ga0070688_1001910892 256
103 3300005366 Ga0070659_100000352 Ga0070659_10000035221 256
104 3300005366 Ga0070659_100008383 Ga0070659_1000083832 256
105 3300005366 Ga0070659_100012460 Ga0070659_1000124605 256
106 3300005367 Ga0070667_100015504 Ga0070667_1000155042 256
107 3300005466 Ga0070685_10274412 Ga0070685_102744121 256
108 3300005535 Ga0070684_100066427 Ga0070684_1000664274 256
109 3300005539 Ga0068853_100023268 Ga0068853_1000232684 256
110 3300005539 Ga0068853_100088493 Ga0068853_1000884933 256
111 3300005563 Ga0068855_100051774 Ga0068855_1000517743 256
112 3300005563 Ga0068855_100600461 Ga0068855_1006004612 256
113 3300005577 Ga0068857_100425637 Ga0068857_1004256372 256
114 3300005577 Ga0068857_101014156 Ga0068857_1010141561 256
115 3300005578 Ga0068854_100291852 Ga0068854_1002918521 256
116 3300005614 Ga0068856_100000224 Ga0068856_10000022457 256
117 3300005614 Ga0068856_100018106 Ga0068856_1000181066 256
118 3300005614 Ga0068856_100027680 Ga0068856_1000276802 256
119 3300005614 Ga0068856_100210565 Ga0068856_1002105652 256
120 3300005614 Ga0068856_100225580 Ga0068856_1002255803 256
121 3300005616 Ga0068852_100014321 Ga0068852_1000143215 256
122 3300005616 Ga0068852_100053026 Ga0068852_1000530263 256
123 3300005617 Ga0068859_100000041 Ga0068859_10000004155 256
124 3300005617 Ga0068859_100447874 Ga0068859_1004478742 256
125 3300005618 Ga0068864_100031625 Ga0068864_1000316252 256
126 3300005834 Ga0068851_10045196 Ga0068851_100451962 256
127 3300005841 Ga0068863_100003110 Ga0068863_10000311017 256
128 3300005842 Ga0068858_100190829 Ga0068858_1001908292 256
129 3300005843 Ga0068860_100012286 Ga0068860_1000122866 256
130 3300006195 Ga0075366_10076148 Ga0075366_100761483 256
131 3300006846 Ga0075430_100503921 Ga0075430_1005039211 256
132 3300006931 Ga0097620_100000041 Ga0097620_100000041110 256
133 3300006931 Ga0097620_100447924 Ga0097620_1004479242 256
134 3300009093 Ga0105240_10000054 Ga0105240_10000054132 256
135 3300009093 Ga0105240_10000098 Ga0105240_1000009852 256
136 3300009093 Ga0105240_10155002 Ga0105240_101550023 256
137 3300009093 Ga0105240_10155381 Ga0105240_101553812 256
138 3300009098 Ga0105245_10082249 Ga0105245_100822492 256
139 3300009147 Ga0114129_10012202 Ga0114129_1001220210 256
140 3300009174 Ga0105241_10000706 Ga0105241_100007068 256
141 3300009174 Ga0105241_10075684 Ga0105241_100756843 256
142 3300009545 Ga0105237_10002453 Ga0105237_1000245313 256
143 3300009545 Ga0105237_10006429 Ga0105237_1000642912 256
144 3300009545 Ga0105237_10007625 Ga0105237_1000762511 256
145 3300009545 Ga0105237_10008496 Ga0105237_100084964 256
146 3300009545 Ga0105237_10021652 Ga0105237_100216525 256
147 3300009545 Ga0105237_10022692 Ga0105237_100226922 256
148 3300009545 Ga0105237_10039730 Ga0105237_100397303 256
149 3300009545 Ga0105237_10063939 Ga0105237_100639392 256
150 3300009551 Ga0105238_10202063 Ga0105238_102020633 256
151 3300009553 Ga0105249_10003956 Ga0105249_100039568 256
152 3300010375 Ga0105239_10000193 Ga0105239_100001939 256
153 3300010375 Ga0105239_10006489 Ga0105239_100064893 256
154 3300010375 Ga0105239_10100522 Ga0105239_101005222 256
155 3300011119 Ga0105246_10014723 Ga0105246_100147234 256
156 3300013100 Ga0157373_10023825 Ga0157373_100238252 256
157 3300013102 Ga0157371_10007181 Ga0157371_100071815 256
158 3300013102 Ga0157371_10039196 Ga0157371_100391963 256
159 3300013102 Ga0157371_10042893 Ga0157371_100428933 256
160 3300013104 Ga0157370_10005029 Ga0157370_1000502919 256
161 3300013104 Ga0157370_10165250 Ga0157370_101652501 256
162 3300013105 Ga0157369_10018816 Ga0157369_100188162 256
163 3300013105 Ga0157369_10130085 Ga0157369_101300853 256
164 3300013296 Ga0157374_10136302 Ga0157374_101363022 256
165 3300013297 Ga0157378_10961924 Ga0157378_109619241 256
166 3300013306 Ga0163162_10000409 Ga0163162_1000040918 256
167 3300013307 Ga0157372_10000350 Ga0157372_1000035028 256
168 3300013307 Ga0157372_10029273 Ga0157372_100292737 256
169 3300013307 Ga0157372_10052084 Ga0157372_100520843 256
170 3300013307 Ga0157372_10180426 Ga0157372_101804262 256
171 3300013308 Ga0157375_10065647 Ga0157375_100656472 256
172 3300014326 Ga0157380_10002328 Ga0157380_100023288 256
173 3300014968 Ga0157379_10047919 Ga0157379_100479193 256
174 3300014969 Ga0157376_10158117 Ga0157376_101581173 256
175 3300015261 Ga0182006_1007967 Ga0182006_10079673 256
176 3300025246 Ga0209646_1001027 Ga0209646_10010276 256
177 3300025250 Ga0209026_1000484 Ga0209026_10004847 256
178 3300025298 Ga0209050_1001952 Ga0209050_100195221 256
179 3300025321 Ga0207656_10042792 Ga0207656_100427922 256
180 3300025904 Ga0207647_10000011 Ga0207647_1000001175 256
181 3300025911 Ga0207654_10001382 Ga0207654_100013829 256
182 3300025911 Ga0207654_10191447 Ga0207654_101914471 256
183 3300025913 Ga0207695_10000043 Ga0207695_10000043165 256
184 3300025913 Ga0207695_10011786 Ga0207695_100117868 256
185 3300025914 Ga0207671_10000248 Ga0207671_1000024833 256
186 3300025914 Ga0207671_10000468 Ga0207671_1000046813 256
187 3300025914 Ga0207671_10003737 Ga0207671_1000373711 256
188 3300025914 Ga0207671_10005727 Ga0207671_100057274 256
189 3300025914 Ga0207671_10036331 Ga0207671_100363312 256
190 3300025914 Ga0207671_10226931 Ga0207671_102269312 256
191 3300025919 Ga0207657_10061201 Ga0207657_100612013 256
192 3300025919 Ga0207657_10159791 Ga0207657_101597913 256
193 3300025932 Ga0207690_10001264 Ga0207690_1000126411 256
194 3300025932 Ga0207690_10058225 Ga0207690_100582252 256
195 3300025937 Ga0207669_10258106 Ga0207669_102581062 256
196 3300025940 Ga0207691_10067924 Ga0207691_100679243 256
197 3300025942 Ga0207689_10000684 Ga0207689_100006844 256
198 3300025949 Ga0207667_10127675 Ga0207667_101276753 256
199 3300025961 Ga0207712_10002569 Ga0207712_100025698 256
200 3300025981 Ga0207640_10338083 Ga0207640_103380831 256
201 3300025986 Ga0207658_10088231 Ga0207658_100882312 256
202 3300026035 Ga0207703_10011021 Ga0207703_100110218 256
203 3300026041 Ga0207639_10076970 Ga0207639_100769701 256
204 3300026041 Ga0207639_10126984 Ga0207639_101269842 256
205 3300026041 Ga0207639_10135821 Ga0207639_101358213 256
206 3300026078 Ga0207702_10000223 Ga0207702_1000022316 256
207 3300026078 Ga0207702_10012756 Ga0207702_100127562 256
208 3300026078 Ga0207702_10290504 Ga0207702_102905042 256
209 3300026088 Ga0207641_10000369 Ga0207641_1000036950 256
210 3300026116 Ga0207674_10436423 Ga0207674_104364231 256
211 3300026142 Ga0207698_10045823 Ga0207698_100458233 256
212 3300026142 Ga0207698_10089325 Ga0207698_100893252 256
213 3300028381 Ga0268264_10017331 Ga0268264_100173316 256
214 3300028786 Ga0307517_10002012 Ga0307517_100020129 256
215 3300031251 Ga0265327_10000090 Ga0265327_1000009042 256
216 3300031507 Ga0307509_10129376 Ga0307509_101293763 256
217 3300031507 Ga0307509_10254744 Ga0307509_102547442 256
218 3300032126 Ga0307415_100197193 Ga0307415_1001971932 256
219 3300036401 Ga0373937_0042142 Ga0373937_0042142_3189_3959 256
220 3300042014 Ga0439457_002836 Ga0439457_002836_953_1723 256
221 3300042876 Ga0451577_0000763 Ga0451577_0000763_27299_28105 256
222 3300044658 Ga0466972_0000063 Ga0466972_0000063_77040_77810 256
223 3300044712 Ga0453684_0000626 Ga0453684_0000626_1473_2243 256
224 3300044712 Ga0453684_0001992 Ga0453684_0001992_25517_26323 256
225 3300044712 Ga0453684_0439768 Ga0453684_0439768_328_1101 256
226 3300044842 Ga0466957_0006772 Ga0466957_0006772_4490_5260 256
227 3300045051 Ga0451576_0005368 Ga0451576_0005368_5271_6041 256
228 3300045051 Ga0451576_0109183 Ga0451576_0109183_1128_1910 256
229 3300046454 Ga0495592_0143899 Ga0495592_0143899_207_1019 256
230 3300046460 Ga0495638_0000015 Ga0495638_0000015_120138_120914 256
231 3300046460 Ga0495638_0183570 Ga0495638_0183570_237_1007 256
232 3300046477 Ga0495664_0152628 Ga0495664_0152628_553_1365 256
233 3300046528 Ga0495642_0087861 Ga0495642_0087861_182_952 256
234 3300046533 Ga0495640_0361679 Ga0495640_0361679_51_863 256
235 3300046616 Ga0495668_0000003 Ga0495668_0000003_40390_41184 256
236 3300046660 Ga0495625_0000607 Ga0495625_0000607_8460_9254 256
237 3300046691 Ga0495670_0053602 Ga0495670_0053602_580_1350 256
238 3300048089 Ga0495614_0027058 Ga0495614_0027058_1150_1944 256
239 3300048917 Ga0496114_0003996 Ga0496114_0003996_6858_7637 256
240 3300049569 Ga0501032_0012415 Ga0501032_0012415_4523_5293 256
241 3300049569 Ga0501032_0102132 Ga0501032_0102132_567_1337 256
242 3300049571 Ga0501034_0005294 Ga0501034_0005294_4452_5222 256
243 3300049571 Ga0501034_0137821 Ga0501034_0137821_601_1371 256
244 3300049571 Ga0501034_0144686 Ga0501034_0144686_705_1475 256
245 3300049571 Ga0501034_0194782 Ga0501034_0194782_1051_1821 256
246 3300049571 Ga0501034_0234091 Ga0501034_0234091_147_917 256
247 3300049572 Ga0501036_0007972 Ga0501036_0007972_7167_7937 256
248 3300049573 Ga0501037_0248057 Ga0501037_0248057_257_1027 256
249 3300049574 Ga0501038_0040447 Ga0501038_0040447_1625_2395 256
250 3300049575 Ga0501039_0017391 Ga0501039_0017391_2641_3411 256
251 3300049579 Ga0501043_0004679 Ga0501043_0004679_1998_2768 256
252 3300049579 Ga0501043_0011803 Ga0501043_0011803_3832_4602 256
253 3300049580 Ga0501046_0001390 Ga0501046_0001390_21979_22749 256
254 3300049580 Ga0501046_0085775 Ga0501046_0085775_576_1346 256
255 3300049580 Ga0501046_0207386 Ga0501046_0207386_558_1328 256
256 3300049581 Ga0501047_0004353 Ga0501047_0004353_1100_1870 256
257 3300049581 Ga0501047_0203394 Ga0501047_0203394_356_1126 256
258 3300049589 Ga0501073_0061872 Ga0501073_0061872_1100_1870 256
259 3300049589 Ga0501073_0481092 Ga0501073_0481092_42_812 256
260 3300049590 Ga0501074_0002763 Ga0501074_0002763_681_1451 256
261 3300049590 Ga0501074_0014458 Ga0501074_0014458_4666_5436 256
262 3300049652 Ga0501202_003189 Ga0501202_003189_1048_1818 256
263 3300049742 Ga0501080_0105598 Ga0501080_0105598_1100_1870 256
264 3300049742 Ga0501080_0149605 Ga0501080_0149605_1100_1870 256
265 3300049822 Ga0501035_0002292 Ga0501035_0002292_10192_10962 256
266 3300049823 Ga0501044_0004343 Ga0501044_0004343_6781_7551 256
267 3300049823 Ga0501044_0016187 Ga0501044_0016187_5330_6100 256
268 3300050493 nmdc:mga0k408_38946_c1 nmdc:mga0k408_38946_c1_617_1387 256
269 3300050507 nmdc:mga05p37_11886_c1 nmdc:mga05p37_11886_c1_6794_7564 256
270 3300050509 nmdc:mga0qj67_369570_c1 nmdc:mga0qj67_369570_c1_64_837 256
271 3300053088 Ga0500644_0027928 Ga0500644_0027928_328_1098 256
272 3300053134 Ga0500658_0082587 Ga0500658_0082587_75_845 256
273 3300053140 Ga0500573_0122410 Ga0500573_0122410_427_1197 256
274 3300053156 Ga0500622_0002388 Ga0500622_0002388_1821_2591 256
275 3300053156 Ga0500622_0011729 Ga0500622_0011729_2265_3035 256
276 3300053177 Ga0500636_0032946 Ga0500636_0032946_493_1263 256

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02405

MlaE

Permease MlaE

74

285

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fee-assembly1.cif.gz_I structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) 0.944 8 248
7d08-assembly1.cif.gz_A acinetobacter mlafedb complex in atp-bound vtrans1 conformation 0.9414 8 248
7d06-assembly1.cif.gz_D cryo em structure of the nucleotide free acinetobacter mlafedb complex 0.9404 8 248
7d0a-assembly1.cif.gz_D acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation 0.9343 8 248
6z5u-assembly1.cif.gz_B cryo-em structure of the a. baumannii mlabdef complex bound to appnhp 0.9247 8 249
ID Description Score Start End Superfamily
af_Q4DBB5_96_268_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.4256 44 247 1.10.357.20
af_Q4DBB5_96_268_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.4115 44 247 1.10.357.20
af_F4J158_268_430_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3905 15 192 1.20.1250.20
af_Q9UT92_325_480_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3846 41 193 1.20.1250.20
af_Q96JW4_154_338_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.3822 52 242 1.10.357.20
ID Description Score Start End GO Terms
AF-A0A7Y4QQ90-F1-model_v4 ABC transporter permease 0.9945 8 252 GO:0005548
GO:0043190
AF-A0A519M3I3-F1-model_v4 ABC transporter permease 0.9895 6 251 GO:0005548
GO:0043190
AF-A0A3C1JWC4-F1-model_v4 ABC transporter permease 0.9887 6 253 GO:0005548
GO:0043190
AF-A0A2N2YKC7-F1-model_v4 ABC transporter permease 0.988 8 252 GO:0005548
GO:0043190
AF-A0A3D1KZZ7-F1-model_v4 ABC transporter permease 0.9875 6 252 GO:0005548
GO:0043190

Feature Viewer

pLDDT pTM Quality
86.68 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map