F380845
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 276 | 166 | 271 | 254 |
Family's Representative Sequence
| Representative Sequence | 3300003322|rootL2_10181017|rootL2_101810174 |
| Length | 292 |
| Sequence | MLSSVKNRMFKCATQGTVFMKTSSWKQKLIYCLHKNMSLTPNLKLLLIEAGDISRFTGRFFQQWFKPRYEIAEFIRQCFVIGYKSFPLVGLTAFILGLVLTMQLRPSMVDYGVESQIPAIVGIAIVREVGPVIIALIFAGKIGSSIGAELGSMKVTEQIDAMEVSGTNPFKYLVVTRVLAATLMLPVLVMLGDAISLYGSYLGVNIHSTTSFNLFWSQVFDNLSFADVLPAYIKSYFFGFAVGIIGCYKGYNSSKGTEGVGRSANSAVVISSVMIFVIDLLAVQVTDVLGFN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 2 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 3 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 4 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 5 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 6 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 10 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 11 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 47 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 48 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 49 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 71 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 74 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 76 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 77 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 111 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 112 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 113 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 114 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 115 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 116 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 117 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 118 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 119 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 120 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 121 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 122 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 123 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 124 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 125 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 126 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 127 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 128 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 129 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 130 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 131 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 143 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 155 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 159 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 160 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 163 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 164 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 165 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 166 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.19 |
| Metatranscriptomes | 0 |
| Isolates | 1.81 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.35 |
| Nodule | 0 |
| Rhizoplane | 0.36 |
| Rhizosphere | 85.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1005098 | 3300001904 | Bacteria | 2224 |
| 2 | JGI24739J22299_10026646 | 3300001989 | Bacteria | 2026 |
| 3 | JGI24735J21928_10000012 | 3300002067 | Bacteria | 208921 |
| 4 | JGI25154J39366_1005588 | 3300002738 | Bacteria | 1976 |
| 5 | JGI25157J39369_1008982 | 3300002741 | Bacteria | 1364 |
| 6 | rootH1_10014902 | 3300003316 | Bacteria | 16616 |
| 7 | rootH1_10057825 | 3300003316 | Bacteria | 6270 |
| 8 | rootH1_10095269 | 3300003316 | Bacteria | 8902 |
| 9 | rootH2_10000256 | 3300003320 | Bacteria | 54479 |
| 10 | rootH2_10004072 | 3300003320 | Bacteria | 38215 |
| 11 | rootH2_10072708 | 3300003320 | Bacteria | 30934 |
| 12 | rootL2_10013153 | 3300003322 | Bacteria | 31542 |
| 13 | rootL2_10181017 | 3300003322 | Bacteria | 3623 |
| 14 | rootL2_10213473 | 3300003322 | Bacteria | 1546 |
| 15 | rootL2_10228406 | 3300003322 | Bacteria | 1950 |
| 16 | rootL2_10316265 | 3300003322 | Bacteria | 1703 |
| 17 | rootH1_10011789 | 3300003323 | Bacteria | 124621 |
| 18 | rootH1_10017667 | 3300003323 | Bacteria | 9900 |
| 19 | rootH1_10122433 | 3300003323 | Bacteria | 9359 |
| 20 | rootH1_10326300 | 3300003323 | Bacteria | 2189 |
| 21 | Ga0055531_10000033 | 3300003794 | Bacteria | 152935 |
| 22 | Ga0065714_10004122 | 3300005288 | Bacteria | 18747 |
| 23 | Ga0065714_10064615 | 3300005288 | Bacteria | 28651 |
| 24 | Ga0065714_10082539 | 3300005288 | Bacteria | 2301 |
| 25 | Ga0065704_10122952 | 3300005289 | Bacteria | 1741 |
| 26 | Ga0070658_10099094 | 3300005327 | Bacteria | 2408 |
| 27 | Ga0068869_100013604 | 3300005334 | Bacteria | 5416 |
| 28 | Ga0068869_100175458 | 3300005334 | Unclassified | 1677 |
| 29 | Ga0070666_10000583 | 3300005335 | Bacteria | 22014 |
| 30 | Ga0068868_100103170 | 3300005338 | Bacteria | 2310 |
| 31 | Ga0070660_100054052 | 3300005339 | Bacteria | 3099 |
| 32 | Ga0070661_100161969 | 3300005344 | Bacteria | 1695 |
| 33 | Ga0070668_100133527 | 3300005347 | Bacteria | 1994 |
| 34 | Ga0070669_100493926 | 3300005353 | Bacteria | 1014 |
| 35 | Ga0070688_100191089 | 3300005365 | Bacteria | 1426 |
| 36 | Ga0070659_100000352 | 3300005366 | Bacteria | 35096 |
| 37 | Ga0070659_100008383 | 3300005366 | Bacteria | 7550 |
| 38 | Ga0070659_100012460 | 3300005366 | Bacteria | 6304 |
| 39 | Ga0070667_100015504 | 3300005367 | Bacteria | 6300 |
| 40 | Ga0070714_100265279 | 3300005435 | Bacteria | 1591 |
| 41 | Ga0070713_100675192 | 3300005436 | Bacteria | 985 |
| 42 | Ga0070685_10274412 | 3300005466 | Bacteria | 1126 |
| 43 | Ga0070684_100066427 | 3300005535 | Bacteria | 3166 |
| 44 | Ga0068853_100023268 | 3300005539 | Bacteria | 5184 |
| 45 | Ga0068853_100088493 | 3300005539 | Bacteria | 2719 |
| 46 | Ga0070665_100008074 | 3300005548 | Bacteria | 10656 |
| 47 | Ga0068855_100011309 | 3300005563 | Bacteria | 10777 |
| 48 | Ga0068855_100051774 | 3300005563 | Bacteria | 4836 |
| 49 | Ga0068855_100600461 | 3300005563 | Bacteria | 1187 |
| 50 | Ga0068857_100003869 | 3300005577 | Bacteria | 12606 |
| 51 | Ga0068857_100425637 | 3300005577 | Unclassified | 1238 |
| 52 | Ga0068857_101014156 | 3300005577 | Bacteria | 799 |
| 53 | Ga0068854_100291852 | 3300005578 | Unclassified | 1316 |
| 54 | Ga0068856_100000224 | 3300005614 | Bacteria | 61427 |
| 55 | Ga0068856_100018106 | 3300005614 | Bacteria | 6830 |
| 56 | Ga0068856_100027680 | 3300005614 | Bacteria | 5531 |
| 57 | Ga0068856_100040589 | 3300005614 | Bacteria | 4572 |
| 58 | Ga0068856_100210565 | 3300005614 | Bacteria | 1959 |
| 59 | Ga0068856_100225580 | 3300005614 | Bacteria | 1889 |
| 60 | Ga0068852_100014321 | 3300005616 | Bacteria | 6100 |
| 61 | Ga0068852_100053026 | 3300005616 | Bacteria | 3489 |
| 62 | Ga0068852_100185026 | 3300005616 | Bacteria | 1961 |
| 63 | Ga0068859_100000041 | 3300005617 | Bacteria | 162415 |
| 64 | Ga0068859_100447874 | 3300005617 | Unclassified | 1387 |
| 65 | Ga0068864_100031625 | 3300005618 | Bacteria | 4492 |
| 66 | Ga0068851_10045196 | 3300005834 | Bacteria | 2225 |
| 67 | Ga0068863_100003110 | 3300005841 | Bacteria | 16378 |
| 68 | Ga0068858_100190829 | 3300005842 | Bacteria | 1936 |
| 69 | Ga0068860_100012286 | 3300005843 | Bacteria | 8438 |
| 70 | Ga0075366_10076148 | 3300006195 | Bacteria | 2002 |
| 71 | Ga0075428_100016242 | 3300006844 | Bacteria | 8228 |
| 72 | Ga0075430_100503921 | 3300006846 | Bacteria | 999 |
| 73 | Ga0097620_100000041 | 3300006931 | Bacteria | 162415 |
| 74 | Ga0097620_100447924 | 3300006931 | Unclassified | 1387 |
| 75 | Ga0105240_10000010 | 3300009093 | Bacteria | 537830 |
| 76 | Ga0105240_10000054 | 3300009093 | Bacteria | 225529 |
| 77 | Ga0105240_10000098 | 3300009093 | Bacteria | 178435 |
| 78 | Ga0105240_10155002 | 3300009093 | Bacteria | 2725 |
| 79 | Ga0105240_10155381 | 3300009093 | Bacteria | 2722 |
| 80 | Ga0111539_10025888 | 3300009094 | Bacteria | 7181 |
| 81 | Ga0105245_10082249 | 3300009098 | Bacteria | 2946 |
| 82 | Ga0114129_10012202 | 3300009147 | Bacteria | 12227 |
| 83 | Ga0105241_10000706 | 3300009174 | Bacteria | 25262 |
| 84 | Ga0105241_10075684 | 3300009174 | Bacteria | 2623 |
| 85 | Ga0105241_10082644 | 3300009174 | Bacteria | 2518 |
| 86 | Ga0105241_10426122 | 3300009174 | Bacteria | 1169 |
| 87 | Ga0105237_10000317 | 3300009545 | Bacteria | 67573 |
| 88 | Ga0105237_10002453 | 3300009545 | Bacteria | 23025 |
| 89 | Ga0105237_10003076 | 3300009545 | Bacteria | 20107 |
| 90 | Ga0105237_10003435 | 3300009545 | Bacteria | 18798 |
| 91 | Ga0105237_10006429 | 3300009545 | Bacteria | 13035 |
| 92 | Ga0105237_10007625 | 3300009545 | Bacteria | 11828 |
| 93 | Ga0105237_10008496 | 3300009545 | Bacteria | 11110 |
| 94 | Ga0105237_10021652 | 3300009545 | Bacteria | 6608 |
| 95 | Ga0105237_10022692 | 3300009545 | Bacteria | 6439 |
| 96 | Ga0105237_10039730 | 3300009545 | Bacteria | 4749 |
| 97 | Ga0105237_10063939 | 3300009545 | Bacteria | 3676 |
| 98 | Ga0105238_10040134 | 3300009551 | Bacteria | 4744 |
| 99 | Ga0105238_10202063 | 3300009551 | Bacteria | 1963 |
| 100 | Ga0105238_10505574 | 3300009551 | Bacteria | 1210 |
| 101 | Ga0105249_10003956 | 3300009553 | Bacteria | 12788 |
| 102 | Ga0105239_10000193 | 3300010375 | Bacteria | 88304 |
| 103 | Ga0105239_10004519 | 3300010375 | Bacteria | 16588 |
| 104 | Ga0105239_10006489 | 3300010375 | Bacteria | 13565 |
| 105 | Ga0105239_10100522 | 3300010375 | Bacteria | 3199 |
| 106 | Ga0105246_10014723 | 3300011119 | Bacteria | 4924 |
| 107 | Ga0157373_10023825 | 3300013100 | Bacteria | 4436 |
| 108 | Ga0157371_10007181 | 3300013102 | Bacteria | 9048 |
| 109 | Ga0157371_10039196 | 3300013102 | Bacteria | 3388 |
| 110 | Ga0157371_10042893 | 3300013102 | Bacteria | 3224 |
| 111 | Ga0157371_10414904 | 3300013102 | Bacteria | 986 |
| 112 | Ga0157370_10005029 | 3300013104 | Bacteria | 14933 |
| 113 | Ga0157370_10165250 | 3300013104 | Bacteria | 2058 |
| 114 | Ga0157369_10018816 | 3300013105 | Bacteria | 7742 |
| 115 | Ga0157369_10130085 | 3300013105 | Bacteria | 2668 |
| 116 | Ga0157374_10136302 | 3300013296 | Bacteria | 2380 |
| 117 | Ga0157378_10067809 | 3300013297 | Bacteria | 3198 |
| 118 | Ga0157378_10961924 | 3300013297 | Bacteria | 887 |
| 119 | Ga0163162_10000409 | 3300013306 | Bacteria | 39406 |
| 120 | Ga0157372_10000350 | 3300013307 | Bacteria | 50482 |
| 121 | Ga0157372_10017833 | 3300013307 | Bacteria | 7624 |
| 122 | Ga0157372_10029273 | 3300013307 | Bacteria | 6012 |
| 123 | Ga0157372_10052084 | 3300013307 | Bacteria | 4557 |
| 124 | Ga0157372_10132981 | 3300013307 | Bacteria | 2864 |
| 125 | Ga0157372_10180426 | 3300013307 | Bacteria | 2444 |
| 126 | Ga0157372_10270111 | 3300013307 | Bacteria | 1976 |
| 127 | Ga0157375_10065647 | 3300013308 | Bacteria | 3618 |
| 128 | Ga0157380_10002328 | 3300014326 | Bacteria | 12761 |
| 129 | Ga0157380_10254304 | 3300014326 | Bacteria | 1592 |
| 130 | Ga0182008_10000004 | 3300014497 | Bacteria | 436804 |
| 131 | Ga0182008_10000974 | 3300014497 | Bacteria | 19881 |
| 132 | Ga0157379_10047919 | 3300014968 | Bacteria | 3814 |
| 133 | Ga0157379_10227368 | 3300014968 | Bacteria | 1691 |
| 134 | Ga0157376_10158117 | 3300014969 | Bacteria | 2051 |
| 135 | Ga0182006_1007967 | 3300015261 | Bacteria | 4817 |
| 136 | Ga0163161_10010850 | 3300017792 | Bacteria | 6316 |
| 137 | Ga0209646_1001027 | 3300025246 | Bacteria | 8447 |
| 138 | Ga0209026_1000484 | 3300025250 | Bacteria | 29488 |
| 139 | Ga0209455_1009236 | 3300025272 | Bacteria | 2605 |
| 140 | Ga0209050_1001952 | 3300025298 | Bacteria | 19511 |
| 141 | Ga0209257_1000023 | 3300025304 | Bacteria | 753019 |
| 142 | Ga0207656_10042792 | 3300025321 | Bacteria | 1929 |
| 143 | Ga0207647_10000011 | 3300025904 | Bacteria | 156667 |
| 144 | Ga0207647_10002070 | 3300025904 | Bacteria | 15333 |
| 145 | Ga0207654_10001382 | 3300025911 | Bacteria | 12858 |
| 146 | Ga0207654_10191447 | 3300025911 | Bacteria | 1341 |
| 147 | Ga0207695_10000019 | 3300025913 | Bacteria | 732137 |
| 148 | Ga0207695_10000043 | 3300025913 | Bacteria | 444585 |
| 149 | Ga0207695_10009762 | 3300025913 | Bacteria | 11808 |
| 150 | Ga0207695_10011786 | 3300025913 | Bacteria | 10554 |
| 151 | Ga0207671_10000248 | 3300025914 | Bacteria | 80829 |
| 152 | Ga0207671_10000468 | 3300025914 | Bacteria | 55019 |
| 153 | Ga0207671_10003737 | 3300025914 | Bacteria | 14998 |
| 154 | Ga0207671_10005727 | 3300025914 | Bacteria | 11328 |
| 155 | Ga0207671_10015952 | 3300025914 | Bacteria | 5857 |
| 156 | Ga0207671_10036331 | 3300025914 | Bacteria | 3653 |
| 157 | Ga0207671_10226931 | 3300025914 | Bacteria | 1464 |
| 158 | Ga0207657_10061201 | 3300025919 | Bacteria | 3229 |
| 159 | Ga0207657_10159791 | 3300025919 | Bacteria | 1831 |
| 160 | Ga0207649_10124394 | 3300025920 | Bacteria | 1743 |
| 161 | Ga0207694_10014569 | 3300025924 | Bacteria | 5928 |
| 162 | Ga0207664_10059218 | 3300025929 | Bacteria | 3049 |
| 163 | Ga0207690_10001264 | 3300025932 | Bacteria | 16001 |
| 164 | Ga0207690_10058225 | 3300025932 | Bacteria | 2613 |
| 165 | Ga0207669_10258106 | 3300025937 | Bacteria | 1302 |
| 166 | Ga0207691_10067924 | 3300025940 | Bacteria | 3221 |
| 167 | Ga0207689_10000684 | 3300025942 | Bacteria | 32357 |
| 168 | Ga0207667_10009293 | 3300025949 | Bacteria | 11596 |
| 169 | Ga0207667_10127675 | 3300025949 | Bacteria | 2619 |
| 170 | Ga0207651_10064468 | 3300025960 | Bacteria | 2565 |
| 171 | Ga0207712_10002569 | 3300025961 | Bacteria | 11670 |
| 172 | Ga0207668_10056206 | 3300025972 | Bacteria | 2740 |
| 173 | Ga0207640_10338083 | 3300025981 | Unclassified | 1205 |
| 174 | Ga0207658_10088231 | 3300025986 | Bacteria | 2397 |
| 175 | Ga0207677_10076679 | 3300026023 | Bacteria | 2381 |
| 176 | Ga0207703_10011021 | 3300026035 | Bacteria | 7044 |
| 177 | Ga0207639_10076970 | 3300026041 | Bacteria | 2628 |
| 178 | Ga0207639_10126984 | 3300026041 | Bacteria | 2105 |
| 179 | Ga0207639_10135821 | 3300026041 | Bacteria | 2042 |
| 180 | Ga0207702_10000223 | 3300026078 | Bacteria | 66194 |
| 181 | Ga0207702_10012756 | 3300026078 | Bacteria | 6992 |
| 182 | Ga0207702_10069092 | 3300026078 | Bacteria | 3036 |
| 183 | Ga0207702_10290504 | 3300026078 | Bacteria | 1549 |
| 184 | Ga0207641_10000369 | 3300026088 | Bacteria | 53464 |
| 185 | Ga0207648_10401073 | 3300026089 | Bacteria | 1243 |
| 186 | Ga0207674_10007074 | 3300026116 | Bacteria | 13108 |
| 187 | Ga0207674_10436423 | 3300026116 | Unclassified | 1266 |
| 188 | Ga0207698_10045823 | 3300026142 | Bacteria | 3297 |
| 189 | Ga0207698_10089325 | 3300026142 | Bacteria | 2516 |
| 190 | Ga0207698_10606499 | 3300026142 | Bacteria | 1080 |
| 191 | Ga0268266_10003330 | 3300028379 | Bacteria | 16098 |
| 192 | Ga0268265_10096047 | 3300028380 | Bacteria | 2381 |
| 193 | Ga0268264_10017331 | 3300028381 | Bacteria | 5902 |
| 194 | Ga0307517_10002012 | 3300028786 | Bacteria | 33092 |
| 195 | Ga0307515_10279437 | 3300028794 | Bacteria | 1379 |
| 196 | Ga0265324_10019579 | 3300029957 | Bacteria | 2436 |
| 197 | Ga0265339_10090164 | 3300031249 | Unclassified | 1608 |
| 198 | Ga0265327_10000090 | 3300031251 | Bacteria | 197158 |
| 199 | Ga0307509_10129376 | 3300031507 | Bacteria | 2484 |
| 200 | Ga0307509_10254744 | 3300031507 | Unclassified | 1535 |
| 201 | Ga0307405_10060938 | 3300031731 | Bacteria | 2383 |
| 202 | Ga0307410_10001845 | 3300031852 | Bacteria | 9869 |
| 203 | Ga0307406_10000075 | 3300031901 | Bacteria | 54768 |
| 204 | Ga0307407_10006316 | 3300031903 | Bacteria | 5248 |
| 205 | Ga0307407_10194918 | 3300031903 | Bacteria | 1353 |
| 206 | Ga0307412_10053613 | 3300031911 | Bacteria | 2674 |
| 207 | Ga0307412_10371801 | 3300031911 | Bacteria | 1154 |
| 208 | Ga0307415_100197193 | 3300032126 | Bacteria | 1594 |
| 209 | Ga0307510_10234147 | 3300033180 | Bacteria | 1337 |
| 210 | Ga0373937_0042142 | 3300036401 | Bacteria | 4165 |
| 211 | Ga0439439_0004463 | 3300041406 | Bacteria | 3157 |
| 212 | Ga0439457_002836 | 3300042014 | Bacteria | 4841 |
| 213 | Ga0451577_0000763 | 3300042876 | Bacteria | 49014 |
| 214 | Ga0466972_0000063 | 3300044658 | Bacteria | 105889 |
| 215 | Ga0453684_0000626 | 3300044712 | Bacteria | 128697 |
| 216 | Ga0453684_0001992 | 3300044712 | Bacteria | 52379 |
| 217 | Ga0453684_0439768 | 3300044712 | Unclassified | 1453 |
| 218 | Ga0466957_0006772 | 3300044842 | Bacteria | 6474 |
| 219 | Ga0451576_0005368 | 3300045051 | Bacteria | 16110 |
| 220 | Ga0451576_0109183 | 3300045051 | Bacteria | 2879 |
| 221 | Ga0495592_0143899 | 3300046454 | Bacteria | 1655 |
| 222 | Ga0495638_0000015 | 3300046460 | Bacteria | 414645 |
| 223 | Ga0495638_0183570 | 3300046460 | Bacteria | 1192 |
| 224 | Ga0495651_0199990 | 3300046462 | Unclassified | 1399 |
| 225 | Ga0495664_0152628 | 3300046477 | Bacteria | 1401 |
| 226 | Ga0495642_0087861 | 3300046528 | Bacteria | 1314 |
| 227 | Ga0495652_0101826 | 3300046529 | Bacteria | 2328 |
| 228 | Ga0495640_0361679 | 3300046533 | Bacteria | 895 |
| 229 | Ga0495668_0000003 | 3300046616 | Bacteria | 695023 |
| 230 | Ga0495625_0000607 | 3300046660 | Bacteria | 52064 |
| 231 | Ga0495670_0053602 | 3300046691 | Bacteria | 2020 |
| 232 | Ga0495614_0027058 | 3300048089 | Bacteria | 2473 |
| 233 | Ga0496114_0003996 | 3300048917 | Bacteria | 11388 |
| 234 | Ga0501032_0012415 | 3300049569 | Bacteria | 6087 |
| 235 | Ga0501032_0102132 | 3300049569 | Unclassified | 1900 |
| 236 | Ga0501034_0005294 | 3300049571 | Bacteria | 14147 |
| 237 | Ga0501034_0137821 | 3300049571 | Unclassified | 2420 |
| 238 | Ga0501034_0144686 | 3300049571 | Bacteria | 2355 |
| 239 | Ga0501034_0194782 | 3300049571 | Bacteria | 1987 |
| 240 | Ga0501034_0234091 | 3300049571 | Unclassified | 1785 |
| 241 | Ga0501036_0007972 | 3300049572 | Bacteria | 8666 |
| 242 | Ga0501037_0248057 | 3300049573 | Unclassified | 1246 |
| 243 | Ga0501038_0040447 | 3300049574 | Unclassified | 4071 |
| 244 | Ga0501039_0017391 | 3300049575 | Bacteria | 5514 |
| 245 | Ga0501043_0004679 | 3300049579 | Bacteria | 11095 |
| 246 | Ga0501043_0011803 | 3300049579 | Bacteria | 6842 |
| 247 | Ga0501046_0001390 | 3300049580 | Bacteria | 23300 |
| 248 | Ga0501046_0085775 | 3300049580 | Bacteria | 2427 |
| 249 | Ga0501046_0207386 | 3300049580 | Unclassified | 1456 |
| 250 | Ga0501047_0004353 | 3300049581 | Bacteria | 13319 |
| 251 | Ga0501047_0203394 | 3300049581 | Bacteria | 1840 |
| 252 | Ga0501073_0061872 | 3300049589 | Bacteria | 2611 |
| 253 | Ga0501073_0481092 | 3300049589 | Bacteria | 858 |
| 254 | Ga0501074_0002763 | 3300049590 | Bacteria | 12278 |
| 255 | Ga0501074_0014458 | 3300049590 | Bacteria | 5742 |
| 256 | Ga0501202_003189 | 3300049652 | Bacteria | 2797 |
| 257 | Ga0501080_0105598 | 3300049742 | Bacteria | 2611 |
| 258 | Ga0501080_0149605 | 3300049742 | Bacteria | 2158 |
| 259 | Ga0501035_0002292 | 3300049822 | Bacteria | 18903 |
| 260 | Ga0501044_0004343 | 3300049823 | Bacteria | 15878 |
| 261 | Ga0501044_0016187 | 3300049823 | Bacteria | 8015 |
| 262 | nmdc:mga0k408_38946_c1 | 3300050493 | Bacteria | 2729 |
| 263 | nmdc:mga05p37_11886_c1 | 3300050507 | Bacteria | 10380 |
| 264 | nmdc:mga0qj67_369570_c1 | 3300050509 | Bacteria | 1158 |
| 265 | nmdc:mga08y16_38973_c1 | 3300050511 | Bacteria | 4987 |
| 266 | Ga0500644_0027928 | 3300053088 | Bacteria | 1760 |
| 267 | Ga0500658_0082587 | 3300053134 | Bacteria | 1377 |
| 268 | Ga0500573_0122410 | 3300053140 | Bacteria | 1447 |
| 269 | Ga0500622_0002388 | 3300053156 | Bacteria | 13600 |
| 270 | Ga0500622_0011729 | 3300053156 | Bacteria | 4763 |
| 271 | Ga0500636_0032946 | 3300053177 | Bacteria | 3068 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005616 | Ga0068852_100185026 | Ga0068852_1001850263 | 234 |
| 2 | 3300009174 | Ga0105241_10426122 | Ga0105241_104261222 | 234 |
| 3 | 3300026142 | Ga0207698_10606499 | Ga0207698_106064992 | 234 |
| 4 | 3300009093 | Ga0105240_10000010 | Ga0105240_10000010236 | 235 |
| 5 | 3300009545 | Ga0105237_10000317 | Ga0105237_1000031739 | 235 |
| 6 | 3300009551 | Ga0105238_10040134 | Ga0105238_100401342 | 235 |
| 7 | 3300010375 | Ga0105239_10004519 | Ga0105239_100045193 | 235 |
| 8 | 3300025913 | Ga0207695_10000019 | Ga0207695_10000019219 | 235 |
| 9 | 3300025914 | Ga0207671_10015952 | Ga0207671_100159522 | 235 |
| 10 | 3300025924 | Ga0207694_10014569 | Ga0207694_100145692 | 235 |
| 11 | 3300013307 | Ga0157372_10132981 | Ga0157372_101329813 | 236 |
| 12 | 3300031731 | Ga0307405_10060938 | Ga0307405_100609383 | 236 |
| 13 | 3300031852 | Ga0307410_10001845 | Ga0307410_100018456 | 236 |
| 14 | 3300031901 | Ga0307406_10000075 | Ga0307406_100000751 | 236 |
| 15 | 3300031903 | Ga0307407_10006316 | Ga0307407_100063162 | 236 |
| 16 | 3300031911 | Ga0307412_10371801 | Ga0307412_103718011 | 236 |
| 17 | 3300046462 | Ga0495651_0199990 | Ga0495651_0199990_266_1036 | 237 |
| 18 | 3300005288 | Ga0065714_10064615 | Ga0065714_1006461522 | 241 |
| 19 | 3300009174 | Ga0105241_10082644 | Ga0105241_100826443 | 241 |
| 20 | 3300014497 | Ga0182008_10000004 | Ga0182008_1000000413 | 241 |
| 21 | 3300017792 | Ga0163161_10010850 | Ga0163161_100108501 | 241 |
| 22 | 3300025272 | Ga0209455_1009236 | Ga0209455_10092364 | 241 |
| 23 | 3300005338 | Ga0068868_100103170 | Ga0068868_1001031703 | 242 |
| 24 | 3300005347 | Ga0070668_100133527 | Ga0070668_1001335272 | 242 |
| 25 | 3300025960 | Ga0207651_10064468 | Ga0207651_100644682 | 242 |
| 26 | 3300025972 | Ga0207668_10056206 | Ga0207668_100562062 | 242 |
| 27 | 3300026023 | Ga0207677_10076679 | Ga0207677_100766793 | 242 |
| 28 | 3300026089 | Ga0207648_10401073 | Ga0207648_104010731 | 242 |
| 29 | 3300003794 | Ga0055531_10000033 | Ga0055531_1000003360 | 243 |
| 30 | 3300005548 | Ga0070665_100008074 | Ga0070665_1000080746 | 243 |
| 31 | 3300009545 | Ga0105237_10003435 | Ga0105237_100034357 | 243 |
| 32 | 3300009551 | Ga0105238_10505574 | Ga0105238_105055741 | 243 |
| 33 | 3300014497 | Ga0182008_10000974 | Ga0182008_100009748 | 243 |
| 34 | 3300025304 | Ga0209257_1000023 | Ga0209257_1000023315 | 243 |
| 35 | 3300025904 | Ga0207647_10002070 | Ga0207647_1000207012 | 243 |
| 36 | 3300025913 | Ga0207695_10009762 | Ga0207695_100097626 | 243 |
| 37 | 3300028379 | Ga0268266_10003330 | Ga0268266_100033305 | 243 |
| 38 | 3300028794 | Ga0307515_10279437 | Ga0307515_102794372 | 243 |
| 39 | 3300003316 | rootH1_10057825 | rootH1_100578255 | 245 |
| 40 | 3300031903 | Ga0307407_10194918 | Ga0307407_101949181 | 245 |
| 41 | 3300031911 | Ga0307412_10053613 | Ga0307412_100536131 | 245 |
| 42 | 3300046529 | Ga0495652_0101826 | Ga0495652_0101826_761_1531 | 245 |
| 43 | 3300005344 | Ga0070661_100161969 | Ga0070661_1001619692 | 246 |
| 44 | 3300025920 | Ga0207649_10124394 | Ga0207649_101243942 | 246 |
| 45 | 3300028380 | Ga0268265_10096047 | Ga0268265_100960473 | 246 |
| 46 | 3300005563 | Ga0068855_100011309 | Ga0068855_1000113096 | 247 |
| 47 | 3300005577 | Ga0068857_100003869 | Ga0068857_1000038697 | 247 |
| 48 | 3300005614 | Ga0068856_100040589 | Ga0068856_1000405894 | 247 |
| 49 | 3300009545 | Ga0105237_10003076 | Ga0105237_1000307614 | 247 |
| 50 | 3300025949 | Ga0207667_10009293 | Ga0207667_100092936 | 247 |
| 51 | 3300026078 | Ga0207702_10069092 | Ga0207702_100690922 | 247 |
| 52 | 3300026116 | Ga0207674_10007074 | Ga0207674_100070746 | 247 |
| 53 | 3300006844 | Ga0075428_100016242 | Ga0075428_1000162424 | 249 |
| 54 | 3300009094 | Ga0111539_10025888 | Ga0111539_100258884 | 249 |
| 55 | 3300050511 | nmdc:mga08y16_38973_c1 | nmdc:mga08y16_38973_c1_161_910 | 249 |
| 56 | 3300005436 | Ga0070713_100675192 | Ga0070713_1006751921 | 250 |
| 57 | 3300003323 | rootH1_10011789 | rootH1_1001178947 | 251 |
| 58 | 3300005288 | Ga0065714_10082539 | Ga0065714_100825393 | 252 |
| 59 | 3300014326 | Ga0157380_10254304 | Ga0157380_102543042 | 252 |
| 60 | 3300014968 | Ga0157379_10227368 | Ga0157379_102273681 | 252 |
| 61 | 3300033180 | Ga0307510_10234147 | Ga0307510_102341472 | 252 |
| 62 | 3300041406 | Ga0439439_0004463 | Ga0439439_0004463_2101_2859 | 252 |
| 63 | iso_pu_bacteria | 2738541283 | 2738758647 | 252 |
| 64 | iso_pu_bacteria | 2852623160 | 2852626109 | 252 |
| 65 | iso_pu_bacteria | 2884933994 | 2884935420 | 252 |
| 66 | iso_pu_bacteria | 2932082852 | 2932083702 | 252 |
| 67 | 3300005289 | Ga0065704_10122952 | Ga0065704_101229522 | 253 |
| 68 | iso_pu_bacteria | 2738543023 | 2739300302 | 253 |
| 69 | 3300013102 | Ga0157371_10414904 | Ga0157371_104149041 | 254 |
| 70 | 3300013297 | Ga0157378_10067809 | Ga0157378_100678094 | 254 |
| 71 | 3300013307 | Ga0157372_10017833 | Ga0157372_100178333 | 254 |
| 72 | 3300013307 | Ga0157372_10270111 | Ga0157372_102701112 | 254 |
| 73 | 3300005435 | Ga0070714_100265279 | Ga0070714_1002652792 | 255 |
| 74 | 3300025929 | Ga0207664_10059218 | Ga0207664_100592184 | 255 |
| 75 | 3300029957 | Ga0265324_10019579 | Ga0265324_100195792 | 255 |
| 76 | 3300031249 | Ga0265339_10090164 | Ga0265339_100901642 | 255 |
| 77 | 3300001904 | JGI24736J21556_1005098 | JGI24736J21556_10050982 | 256 |
| 78 | 3300001989 | JGI24739J22299_10026646 | JGI24739J22299_100266463 | 256 |
| 79 | 3300002067 | JGI24735J21928_10000012 | JGI24735J21928_10000012166 | 256 |
| 80 | 3300002738 | JGI25154J39366_1005588 | JGI25154J39366_10055883 | 256 |
| 81 | 3300002741 | JGI25157J39369_1008982 | JGI25157J39369_10089822 | 256 |
| 82 | 3300003316 | rootH1_10014902 | rootH1_100149028 | 256 |
| 83 | 3300003316 | rootH1_10095269 | rootH1_100952695 | 256 |
| 84 | 3300003320 | rootH2_10000256 | rootH2_100002565 | 256 |
| 85 | 3300003320 | rootH2_10004072 | rootH2_1000407223 | 256 |
| 86 | 3300003320 | rootH2_10072708 | rootH2_100727084 | 256 |
| 87 | 3300003322 | rootL2_10013153 | rootL2_1001315341 | 256 |
| 88 | 3300003322 | rootL2_10181017 | rootL2_101810174 | 256 |
| 89 | 3300003322 | rootL2_10213473 | rootL2_102134732 | 256 |
| 90 | 3300003322 | rootL2_10228406 | rootL2_102284062 | 256 |
| 91 | 3300003322 | rootL2_10316265 | rootL2_103162652 | 256 |
| 92 | 3300003323 | rootH1_10017667 | rootH1_100176678 | 256 |
| 93 | 3300003323 | rootH1_10122433 | rootH1_101224338 | 256 |
| 94 | 3300003323 | rootH1_10326300 | rootH1_103263002 | 256 |
| 95 | 3300005288 | Ga0065714_10004122 | Ga0065714_1000412214 | 256 |
| 96 | 3300005327 | Ga0070658_10099094 | Ga0070658_100990941 | 256 |
| 97 | 3300005334 | Ga0068869_100013604 | Ga0068869_1000136044 | 256 |
| 98 | 3300005334 | Ga0068869_100175458 | Ga0068869_1001754582 | 256 |
| 99 | 3300005335 | Ga0070666_10000583 | Ga0070666_1000058319 | 256 |
| 100 | 3300005339 | Ga0070660_100054052 | Ga0070660_1000540522 | 256 |
| 101 | 3300005353 | Ga0070669_100493926 | Ga0070669_1004939261 | 256 |
| 102 | 3300005365 | Ga0070688_100191089 | Ga0070688_1001910892 | 256 |
| 103 | 3300005366 | Ga0070659_100000352 | Ga0070659_10000035221 | 256 |
| 104 | 3300005366 | Ga0070659_100008383 | Ga0070659_1000083832 | 256 |
| 105 | 3300005366 | Ga0070659_100012460 | Ga0070659_1000124605 | 256 |
| 106 | 3300005367 | Ga0070667_100015504 | Ga0070667_1000155042 | 256 |
| 107 | 3300005466 | Ga0070685_10274412 | Ga0070685_102744121 | 256 |
| 108 | 3300005535 | Ga0070684_100066427 | Ga0070684_1000664274 | 256 |
| 109 | 3300005539 | Ga0068853_100023268 | Ga0068853_1000232684 | 256 |
| 110 | 3300005539 | Ga0068853_100088493 | Ga0068853_1000884933 | 256 |
| 111 | 3300005563 | Ga0068855_100051774 | Ga0068855_1000517743 | 256 |
| 112 | 3300005563 | Ga0068855_100600461 | Ga0068855_1006004612 | 256 |
| 113 | 3300005577 | Ga0068857_100425637 | Ga0068857_1004256372 | 256 |
| 114 | 3300005577 | Ga0068857_101014156 | Ga0068857_1010141561 | 256 |
| 115 | 3300005578 | Ga0068854_100291852 | Ga0068854_1002918521 | 256 |
| 116 | 3300005614 | Ga0068856_100000224 | Ga0068856_10000022457 | 256 |
| 117 | 3300005614 | Ga0068856_100018106 | Ga0068856_1000181066 | 256 |
| 118 | 3300005614 | Ga0068856_100027680 | Ga0068856_1000276802 | 256 |
| 119 | 3300005614 | Ga0068856_100210565 | Ga0068856_1002105652 | 256 |
| 120 | 3300005614 | Ga0068856_100225580 | Ga0068856_1002255803 | 256 |
| 121 | 3300005616 | Ga0068852_100014321 | Ga0068852_1000143215 | 256 |
| 122 | 3300005616 | Ga0068852_100053026 | Ga0068852_1000530263 | 256 |
| 123 | 3300005617 | Ga0068859_100000041 | Ga0068859_10000004155 | 256 |
| 124 | 3300005617 | Ga0068859_100447874 | Ga0068859_1004478742 | 256 |
| 125 | 3300005618 | Ga0068864_100031625 | Ga0068864_1000316252 | 256 |
| 126 | 3300005834 | Ga0068851_10045196 | Ga0068851_100451962 | 256 |
| 127 | 3300005841 | Ga0068863_100003110 | Ga0068863_10000311017 | 256 |
| 128 | 3300005842 | Ga0068858_100190829 | Ga0068858_1001908292 | 256 |
| 129 | 3300005843 | Ga0068860_100012286 | Ga0068860_1000122866 | 256 |
| 130 | 3300006195 | Ga0075366_10076148 | Ga0075366_100761483 | 256 |
| 131 | 3300006846 | Ga0075430_100503921 | Ga0075430_1005039211 | 256 |
| 132 | 3300006931 | Ga0097620_100000041 | Ga0097620_100000041110 | 256 |
| 133 | 3300006931 | Ga0097620_100447924 | Ga0097620_1004479242 | 256 |
| 134 | 3300009093 | Ga0105240_10000054 | Ga0105240_10000054132 | 256 |
| 135 | 3300009093 | Ga0105240_10000098 | Ga0105240_1000009852 | 256 |
| 136 | 3300009093 | Ga0105240_10155002 | Ga0105240_101550023 | 256 |
| 137 | 3300009093 | Ga0105240_10155381 | Ga0105240_101553812 | 256 |
| 138 | 3300009098 | Ga0105245_10082249 | Ga0105245_100822492 | 256 |
| 139 | 3300009147 | Ga0114129_10012202 | Ga0114129_1001220210 | 256 |
| 140 | 3300009174 | Ga0105241_10000706 | Ga0105241_100007068 | 256 |
| 141 | 3300009174 | Ga0105241_10075684 | Ga0105241_100756843 | 256 |
| 142 | 3300009545 | Ga0105237_10002453 | Ga0105237_1000245313 | 256 |
| 143 | 3300009545 | Ga0105237_10006429 | Ga0105237_1000642912 | 256 |
| 144 | 3300009545 | Ga0105237_10007625 | Ga0105237_1000762511 | 256 |
| 145 | 3300009545 | Ga0105237_10008496 | Ga0105237_100084964 | 256 |
| 146 | 3300009545 | Ga0105237_10021652 | Ga0105237_100216525 | 256 |
| 147 | 3300009545 | Ga0105237_10022692 | Ga0105237_100226922 | 256 |
| 148 | 3300009545 | Ga0105237_10039730 | Ga0105237_100397303 | 256 |
| 149 | 3300009545 | Ga0105237_10063939 | Ga0105237_100639392 | 256 |
| 150 | 3300009551 | Ga0105238_10202063 | Ga0105238_102020633 | 256 |
| 151 | 3300009553 | Ga0105249_10003956 | Ga0105249_100039568 | 256 |
| 152 | 3300010375 | Ga0105239_10000193 | Ga0105239_100001939 | 256 |
| 153 | 3300010375 | Ga0105239_10006489 | Ga0105239_100064893 | 256 |
| 154 | 3300010375 | Ga0105239_10100522 | Ga0105239_101005222 | 256 |
| 155 | 3300011119 | Ga0105246_10014723 | Ga0105246_100147234 | 256 |
| 156 | 3300013100 | Ga0157373_10023825 | Ga0157373_100238252 | 256 |
| 157 | 3300013102 | Ga0157371_10007181 | Ga0157371_100071815 | 256 |
| 158 | 3300013102 | Ga0157371_10039196 | Ga0157371_100391963 | 256 |
| 159 | 3300013102 | Ga0157371_10042893 | Ga0157371_100428933 | 256 |
| 160 | 3300013104 | Ga0157370_10005029 | Ga0157370_1000502919 | 256 |
| 161 | 3300013104 | Ga0157370_10165250 | Ga0157370_101652501 | 256 |
| 162 | 3300013105 | Ga0157369_10018816 | Ga0157369_100188162 | 256 |
| 163 | 3300013105 | Ga0157369_10130085 | Ga0157369_101300853 | 256 |
| 164 | 3300013296 | Ga0157374_10136302 | Ga0157374_101363022 | 256 |
| 165 | 3300013297 | Ga0157378_10961924 | Ga0157378_109619241 | 256 |
| 166 | 3300013306 | Ga0163162_10000409 | Ga0163162_1000040918 | 256 |
| 167 | 3300013307 | Ga0157372_10000350 | Ga0157372_1000035028 | 256 |
| 168 | 3300013307 | Ga0157372_10029273 | Ga0157372_100292737 | 256 |
| 169 | 3300013307 | Ga0157372_10052084 | Ga0157372_100520843 | 256 |
| 170 | 3300013307 | Ga0157372_10180426 | Ga0157372_101804262 | 256 |
| 171 | 3300013308 | Ga0157375_10065647 | Ga0157375_100656472 | 256 |
| 172 | 3300014326 | Ga0157380_10002328 | Ga0157380_100023288 | 256 |
| 173 | 3300014968 | Ga0157379_10047919 | Ga0157379_100479193 | 256 |
| 174 | 3300014969 | Ga0157376_10158117 | Ga0157376_101581173 | 256 |
| 175 | 3300015261 | Ga0182006_1007967 | Ga0182006_10079673 | 256 |
| 176 | 3300025246 | Ga0209646_1001027 | Ga0209646_10010276 | 256 |
| 177 | 3300025250 | Ga0209026_1000484 | Ga0209026_10004847 | 256 |
| 178 | 3300025298 | Ga0209050_1001952 | Ga0209050_100195221 | 256 |
| 179 | 3300025321 | Ga0207656_10042792 | Ga0207656_100427922 | 256 |
| 180 | 3300025904 | Ga0207647_10000011 | Ga0207647_1000001175 | 256 |
| 181 | 3300025911 | Ga0207654_10001382 | Ga0207654_100013829 | 256 |
| 182 | 3300025911 | Ga0207654_10191447 | Ga0207654_101914471 | 256 |
| 183 | 3300025913 | Ga0207695_10000043 | Ga0207695_10000043165 | 256 |
| 184 | 3300025913 | Ga0207695_10011786 | Ga0207695_100117868 | 256 |
| 185 | 3300025914 | Ga0207671_10000248 | Ga0207671_1000024833 | 256 |
| 186 | 3300025914 | Ga0207671_10000468 | Ga0207671_1000046813 | 256 |
| 187 | 3300025914 | Ga0207671_10003737 | Ga0207671_1000373711 | 256 |
| 188 | 3300025914 | Ga0207671_10005727 | Ga0207671_100057274 | 256 |
| 189 | 3300025914 | Ga0207671_10036331 | Ga0207671_100363312 | 256 |
| 190 | 3300025914 | Ga0207671_10226931 | Ga0207671_102269312 | 256 |
| 191 | 3300025919 | Ga0207657_10061201 | Ga0207657_100612013 | 256 |
| 192 | 3300025919 | Ga0207657_10159791 | Ga0207657_101597913 | 256 |
| 193 | 3300025932 | Ga0207690_10001264 | Ga0207690_1000126411 | 256 |
| 194 | 3300025932 | Ga0207690_10058225 | Ga0207690_100582252 | 256 |
| 195 | 3300025937 | Ga0207669_10258106 | Ga0207669_102581062 | 256 |
| 196 | 3300025940 | Ga0207691_10067924 | Ga0207691_100679243 | 256 |
| 197 | 3300025942 | Ga0207689_10000684 | Ga0207689_100006844 | 256 |
| 198 | 3300025949 | Ga0207667_10127675 | Ga0207667_101276753 | 256 |
| 199 | 3300025961 | Ga0207712_10002569 | Ga0207712_100025698 | 256 |
| 200 | 3300025981 | Ga0207640_10338083 | Ga0207640_103380831 | 256 |
| 201 | 3300025986 | Ga0207658_10088231 | Ga0207658_100882312 | 256 |
| 202 | 3300026035 | Ga0207703_10011021 | Ga0207703_100110218 | 256 |
| 203 | 3300026041 | Ga0207639_10076970 | Ga0207639_100769701 | 256 |
| 204 | 3300026041 | Ga0207639_10126984 | Ga0207639_101269842 | 256 |
| 205 | 3300026041 | Ga0207639_10135821 | Ga0207639_101358213 | 256 |
| 206 | 3300026078 | Ga0207702_10000223 | Ga0207702_1000022316 | 256 |
| 207 | 3300026078 | Ga0207702_10012756 | Ga0207702_100127562 | 256 |
| 208 | 3300026078 | Ga0207702_10290504 | Ga0207702_102905042 | 256 |
| 209 | 3300026088 | Ga0207641_10000369 | Ga0207641_1000036950 | 256 |
| 210 | 3300026116 | Ga0207674_10436423 | Ga0207674_104364231 | 256 |
| 211 | 3300026142 | Ga0207698_10045823 | Ga0207698_100458233 | 256 |
| 212 | 3300026142 | Ga0207698_10089325 | Ga0207698_100893252 | 256 |
| 213 | 3300028381 | Ga0268264_10017331 | Ga0268264_100173316 | 256 |
| 214 | 3300028786 | Ga0307517_10002012 | Ga0307517_100020129 | 256 |
| 215 | 3300031251 | Ga0265327_10000090 | Ga0265327_1000009042 | 256 |
| 216 | 3300031507 | Ga0307509_10129376 | Ga0307509_101293763 | 256 |
| 217 | 3300031507 | Ga0307509_10254744 | Ga0307509_102547442 | 256 |
| 218 | 3300032126 | Ga0307415_100197193 | Ga0307415_1001971932 | 256 |
| 219 | 3300036401 | Ga0373937_0042142 | Ga0373937_0042142_3189_3959 | 256 |
| 220 | 3300042014 | Ga0439457_002836 | Ga0439457_002836_953_1723 | 256 |
| 221 | 3300042876 | Ga0451577_0000763 | Ga0451577_0000763_27299_28105 | 256 |
| 222 | 3300044658 | Ga0466972_0000063 | Ga0466972_0000063_77040_77810 | 256 |
| 223 | 3300044712 | Ga0453684_0000626 | Ga0453684_0000626_1473_2243 | 256 |
| 224 | 3300044712 | Ga0453684_0001992 | Ga0453684_0001992_25517_26323 | 256 |
| 225 | 3300044712 | Ga0453684_0439768 | Ga0453684_0439768_328_1101 | 256 |
| 226 | 3300044842 | Ga0466957_0006772 | Ga0466957_0006772_4490_5260 | 256 |
| 227 | 3300045051 | Ga0451576_0005368 | Ga0451576_0005368_5271_6041 | 256 |
| 228 | 3300045051 | Ga0451576_0109183 | Ga0451576_0109183_1128_1910 | 256 |
| 229 | 3300046454 | Ga0495592_0143899 | Ga0495592_0143899_207_1019 | 256 |
| 230 | 3300046460 | Ga0495638_0000015 | Ga0495638_0000015_120138_120914 | 256 |
| 231 | 3300046460 | Ga0495638_0183570 | Ga0495638_0183570_237_1007 | 256 |
| 232 | 3300046477 | Ga0495664_0152628 | Ga0495664_0152628_553_1365 | 256 |
| 233 | 3300046528 | Ga0495642_0087861 | Ga0495642_0087861_182_952 | 256 |
| 234 | 3300046533 | Ga0495640_0361679 | Ga0495640_0361679_51_863 | 256 |
| 235 | 3300046616 | Ga0495668_0000003 | Ga0495668_0000003_40390_41184 | 256 |
| 236 | 3300046660 | Ga0495625_0000607 | Ga0495625_0000607_8460_9254 | 256 |
| 237 | 3300046691 | Ga0495670_0053602 | Ga0495670_0053602_580_1350 | 256 |
| 238 | 3300048089 | Ga0495614_0027058 | Ga0495614_0027058_1150_1944 | 256 |
| 239 | 3300048917 | Ga0496114_0003996 | Ga0496114_0003996_6858_7637 | 256 |
| 240 | 3300049569 | Ga0501032_0012415 | Ga0501032_0012415_4523_5293 | 256 |
| 241 | 3300049569 | Ga0501032_0102132 | Ga0501032_0102132_567_1337 | 256 |
| 242 | 3300049571 | Ga0501034_0005294 | Ga0501034_0005294_4452_5222 | 256 |
| 243 | 3300049571 | Ga0501034_0137821 | Ga0501034_0137821_601_1371 | 256 |
| 244 | 3300049571 | Ga0501034_0144686 | Ga0501034_0144686_705_1475 | 256 |
| 245 | 3300049571 | Ga0501034_0194782 | Ga0501034_0194782_1051_1821 | 256 |
| 246 | 3300049571 | Ga0501034_0234091 | Ga0501034_0234091_147_917 | 256 |
| 247 | 3300049572 | Ga0501036_0007972 | Ga0501036_0007972_7167_7937 | 256 |
| 248 | 3300049573 | Ga0501037_0248057 | Ga0501037_0248057_257_1027 | 256 |
| 249 | 3300049574 | Ga0501038_0040447 | Ga0501038_0040447_1625_2395 | 256 |
| 250 | 3300049575 | Ga0501039_0017391 | Ga0501039_0017391_2641_3411 | 256 |
| 251 | 3300049579 | Ga0501043_0004679 | Ga0501043_0004679_1998_2768 | 256 |
| 252 | 3300049579 | Ga0501043_0011803 | Ga0501043_0011803_3832_4602 | 256 |
| 253 | 3300049580 | Ga0501046_0001390 | Ga0501046_0001390_21979_22749 | 256 |
| 254 | 3300049580 | Ga0501046_0085775 | Ga0501046_0085775_576_1346 | 256 |
| 255 | 3300049580 | Ga0501046_0207386 | Ga0501046_0207386_558_1328 | 256 |
| 256 | 3300049581 | Ga0501047_0004353 | Ga0501047_0004353_1100_1870 | 256 |
| 257 | 3300049581 | Ga0501047_0203394 | Ga0501047_0203394_356_1126 | 256 |
| 258 | 3300049589 | Ga0501073_0061872 | Ga0501073_0061872_1100_1870 | 256 |
| 259 | 3300049589 | Ga0501073_0481092 | Ga0501073_0481092_42_812 | 256 |
| 260 | 3300049590 | Ga0501074_0002763 | Ga0501074_0002763_681_1451 | 256 |
| 261 | 3300049590 | Ga0501074_0014458 | Ga0501074_0014458_4666_5436 | 256 |
| 262 | 3300049652 | Ga0501202_003189 | Ga0501202_003189_1048_1818 | 256 |
| 263 | 3300049742 | Ga0501080_0105598 | Ga0501080_0105598_1100_1870 | 256 |
| 264 | 3300049742 | Ga0501080_0149605 | Ga0501080_0149605_1100_1870 | 256 |
| 265 | 3300049822 | Ga0501035_0002292 | Ga0501035_0002292_10192_10962 | 256 |
| 266 | 3300049823 | Ga0501044_0004343 | Ga0501044_0004343_6781_7551 | 256 |
| 267 | 3300049823 | Ga0501044_0016187 | Ga0501044_0016187_5330_6100 | 256 |
| 268 | 3300050493 | nmdc:mga0k408_38946_c1 | nmdc:mga0k408_38946_c1_617_1387 | 256 |
| 269 | 3300050507 | nmdc:mga05p37_11886_c1 | nmdc:mga05p37_11886_c1_6794_7564 | 256 |
| 270 | 3300050509 | nmdc:mga0qj67_369570_c1 | nmdc:mga0qj67_369570_c1_64_837 | 256 |
| 271 | 3300053088 | Ga0500644_0027928 | Ga0500644_0027928_328_1098 | 256 |
| 272 | 3300053134 | Ga0500658_0082587 | Ga0500658_0082587_75_845 | 256 |
| 273 | 3300053140 | Ga0500573_0122410 | Ga0500573_0122410_427_1197 | 256 |
| 274 | 3300053156 | Ga0500622_0002388 | Ga0500622_0002388_1821_2591 | 256 |
| 275 | 3300053156 | Ga0500622_0011729 | Ga0500622_0011729_2265_3035 | 256 |
| 276 | 3300053177 | Ga0500636_0032946 | Ga0500636_0032946_493_1263 | 256 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8fee-assembly1.cif.gz_I | structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) | 0.944 | 8 | 248 |
| 7d08-assembly1.cif.gz_A | acinetobacter mlafedb complex in atp-bound vtrans1 conformation | 0.9414 | 8 | 248 |
| 7d06-assembly1.cif.gz_D | cryo em structure of the nucleotide free acinetobacter mlafedb complex | 0.9404 | 8 | 248 |
| 7d0a-assembly1.cif.gz_D | acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation | 0.9343 | 8 | 248 |
| 6z5u-assembly1.cif.gz_B | cryo-em structure of the a. baumannii mlabdef complex bound to appnhp | 0.9247 | 8 | 249 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4DBB5_96_268_1.10.357.20 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain | 0.4256 | 44 | 247 | 1.10.357.20 |
| af_Q4DBB5_96_268_1.10.357.20 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain | 0.4115 | 44 | 247 | 1.10.357.20 |
| af_F4J158_268_430_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3905 | 15 | 192 | 1.20.1250.20 |
| af_Q9UT92_325_480_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3846 | 41 | 193 | 1.20.1250.20 |
| af_Q96JW4_154_338_1.10.357.20 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain | 0.3822 | 52 | 242 | 1.10.357.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y4QQ90-F1-model_v4 | ABC transporter permease | 0.9945 | 8 | 252 |
GO:0005548
GO:0043190 |
| AF-A0A519M3I3-F1-model_v4 | ABC transporter permease | 0.9895 | 6 | 251 |
GO:0005548
GO:0043190 |
| AF-A0A3C1JWC4-F1-model_v4 | ABC transporter permease | 0.9887 | 6 | 253 |
GO:0005548
GO:0043190 |
| AF-A0A2N2YKC7-F1-model_v4 | ABC transporter permease | 0.988 | 8 | 252 |
GO:0005548
GO:0043190 |
| AF-A0A3D1KZZ7-F1-model_v4 | ABC transporter permease | 0.9875 | 6 | 252 |
GO:0005548
GO:0043190 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar