F380656

General Info

Members Datasets Scaffolds Average Seq Length
275 139 275 118

Family's Representative Sequence

Representative Sequence 3300046663|Ga0495635_0630047|Ga0495635_0630047_111_488
Length 125
Sequence VEWYNRVVLRDYLPAIVFLVLGGAVGALFSVLNLFLGHRRPNRSKQEPYECGLPSEIQSGFRFGISFYLIAMLFIVFDIEVIFLYPIAVQLRAFGTFAMVETVVFVALLLVGFGYVWRRGALEWR

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
43 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
44 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
45 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
46 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
47 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
70 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
71 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
72 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
73 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
74 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
75 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
76 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
77 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
78 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
79 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
80 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
81 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
82 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
83 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
84 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
85 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
86 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
87 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
88 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
89 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
90 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
91 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
92 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
93 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
94 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
95 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
98 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
99 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
100 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
101 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
102 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
103 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
104 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
105 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
106 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
107 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
108 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
109 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
110 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
111 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
112 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
113 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
114 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
115 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
116 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
117 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
118 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
119 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
120 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
121 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
122 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
134 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
135 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
136 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.73
Metatranscriptomes 3.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.45
Rhizosphere 76
Stem 0
Stem Tuber 0
Unclassified 18.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10127789 3300003659 Bacteria 537
2 Ga0070683_100272868 3300005329 Bacteria 1609
3 Ga0070683_100680926 3300005329 Bacteria 985
4 Ga0070680_100109619 3300005336 Bacteria 2297
5 Ga0070682_100095784 3300005337 Bacteria 1950
6 Ga0070660_100069672 3300005339 Bacteria 2743
7 Ga0070691_10028116 3300005341 Bacteria 2625
8 Ga0070661_100142565 3300005344 Bacteria 1807
9 Ga0070659_100175212 3300005366 Bacteria 1759
10 Ga0070709_10089705 3300005434 Bacteria 2025
11 Ga0070709_10175567 3300005434 Bacteria 1501
12 Ga0070714_100094323 3300005435 Bacteria 2627
13 Ga0070714_100144082 3300005435 Bacteria 2141
14 Ga0070714_100181251 3300005435 Bacteria 1916
15 Ga0070714_100198205 3300005435 Bacteria 1836
16 Ga0070714_100686196 3300005435 Bacteria 988
17 Ga0070714_101381520 3300005435 Bacteria 688
18 Ga0070713_100201107 3300005436 Bacteria 1799
19 Ga0070713_100554440 3300005436 Bacteria 1088
20 Ga0070713_100584425 3300005436 Bacteria 1060
21 Ga0070713_100892582 3300005436 Bacteria 855
22 Ga0070713_100973776 3300005436 Bacteria 818
23 Ga0070710_10292525 3300005437 Bacteria 1060
24 Ga0070710_10396719 3300005437 Bacteria 924
25 Ga0070710_10426996 3300005437 Bacteria 894
26 Ga0070711_100019980 3300005439 Bacteria 4308
27 Ga0070711_100021243 3300005439 Bacteria 4193
28 Ga0070711_100229326 3300005439 Bacteria 1447
29 Ga0070711_101147758 3300005439 Bacteria 671
30 Ga0070663_101100544 3300005455 Bacteria 695
31 Ga0070681_11471251 3300005458 Bacteria 605
32 Ga0070679_100074391 3300005530 Bacteria 3388
33 Ga0070684_100016176 3300005535 Bacteria 6094
34 Ga0070684_100353870 3300005535 Bacteria 1351
35 Ga0068853_100263597 3300005539 Bacteria 1585
36 Ga0070696_101221490 3300005546 Bacteria 636
37 Ga0070696_101417926 3300005546 Bacteria 593
38 Ga0070664_100941693 3300005564 Bacteria 811
39 Ga0068852_100181277 3300005616 Bacteria 1980
40 Ga0070717_10025299 3300006028 Bacteria 4719
41 Ga0070717_10089317 3300006028 Bacteria 2599
42 Ga0070717_10159242 3300006028 Bacteria 1958
43 Ga0070717_10374839 3300006028 Bacteria 1275
44 Ga0070717_11580326 3300006028 Bacteria 594
45 Ga0070717_12090852 3300006028 Bacteria 509
46 Ga0070715_10057327 3300006163 Bacteria 1697
47 Ga0070715_10413415 3300006163 Bacteria 753
48 Ga0070716_100678313 3300006173 Bacteria 785
49 Ga0070712_100002893 3300006175 Bacteria 10651
50 Ga0070712_100140013 3300006175 Bacteria 1845
51 Ga0070712_100409401 3300006175 Bacteria 1122
52 Ga0070712_100779484 3300006175 Bacteria 819
53 Ga0070712_101772092 3300006175 Bacteria 541
54 Ga0097621_101199743 3300006237 Bacteria 715
55 Ga0075434_100356912 3300006871 Bacteria 1483
56 Ga0075435_100345674 3300007076 Bacteria 1275
57 Ga0105240_10030748 3300009093 Bacteria 6975
58 Ga0105240_10183174 3300009093 Bacteria 2470
59 Ga0105245_12840633 3300009098 Bacteria 537
60 Ga0105237_10049423 3300009545 Bacteria 4227
61 Ga0105238_10105166 3300009551 Bacteria 2804
62 Ga0105238_11892346 3300009551 Bacteria 629
63 Ga0105239_10412297 3300010375 Bacteria 1530
64 Ga0157373_11588024 3300013100 Bacteria 501
65 Ga0157371_10399432 3300013102 Bacteria 1006
66 Ga0157370_10028654 3300013104 Bacteria 5475
67 Ga0157369_10032044 3300013105 Bacteria 5782
68 Ga0157378_10477190 3300013297 Bacteria 1242
69 Ga0157372_10084129 3300013307 Bacteria 3605
70 Ga0197907_10335616 3300020069 Bacteria 1103
71 Ga0206356_11371313 3300020070 Bacteria 1453
72 Ga0154015_1137610 3300020610 Bacteria 688
73 Ga0154015_1427584 3300020610 Bacteria 697
74 Ga0213873_10069630 3300021358 Bacteria 967
75 Ga0213874_10000680 3300021377 Bacteria 6873
76 Ga0213874_10143555 3300021377 Bacteria 828
77 Ga0213874_10246681 3300021377 Bacteria 657
78 Ga0213874_10371838 3300021377 Bacteria 551
79 Ga0213876_10009973 3300021384 Bacteria 5104
80 Ga0213876_10023598 3300021384 Bacteria 3249
81 Ga0213876_10170663 3300021384 Bacteria 1157
82 Ga0213876_10211691 3300021384 Bacteria 1030
83 Ga0213875_10000148 3300021388 Bacteria 74125
84 Ga0213875_10014084 3300021388 Bacteria 3910
85 Ga0213875_10020923 3300021388 Bacteria 3137
86 Ga0213875_10033100 3300021388 Bacteria 2441
87 Ga0213875_10040177 3300021388 Bacteria 2203
88 Ga0213875_10143271 3300021388 Bacteria 1119
89 Ga0213875_10144988 3300021388 Bacteria 1112
90 Ga0213875_10171548 3300021388 Bacteria 1018
91 Ga0213875_10331057 3300021388 Bacteria 722
92 Ga0224712_10046718 3300022467 Bacteria 1663
93 Ga0224712_10220782 3300022467 Bacteria 867
94 Ga0207685_10206811 3300025905 Bacteria 925
95 Ga0207685_10258107 3300025905 Bacteria 846
96 Ga0207699_10146848 3300025906 Bacteria 1556
97 Ga0207699_10183139 3300025906 Bacteria 1409
98 Ga0207699_10895378 3300025906 Bacteria 655
99 Ga0207707_10021148 3300025912 Bacteria 5686
100 Ga0207695_10257635 3300025913 Bacteria 1643
101 Ga0207671_10126030 3300025914 Bacteria 1962
102 Ga0207693_10097279 3300025915 Bacteria 2308
103 Ga0207693_10118510 3300025915 Bacteria 2079
104 Ga0207693_10213121 3300025915 Bacteria 1518
105 Ga0207693_10269572 3300025915 Bacteria 1334
106 Ga0207693_10677804 3300025915 Bacteria 800
107 Ga0207693_10715125 3300025915 Bacteria 775
108 Ga0207663_10209956 3300025916 Bacteria 1410
109 Ga0207660_10177284 3300025917 Bacteria 1653
110 Ga0207649_10105072 3300025920 Bacteria 1876
111 Ga0207652_10280434 3300025921 Bacteria 1503
112 Ga0207694_10044745 3300025924 Bacteria 3418
113 Ga0207687_10434870 3300025927 Bacteria 1085
114 Ga0207700_10253420 3300025928 Bacteria 1504
115 Ga0207700_10707513 3300025928 Bacteria 899
116 Ga0207664_10140912 3300025929 Bacteria 2040
117 Ga0207664_10484740 3300025929 Bacteria 1106
118 Ga0207664_10916284 3300025929 Bacteria 787
119 Ga0207690_10081693 3300025932 Bacteria 2259
120 Ga0207665_10089530 3300025939 Bacteria 2131
121 Ga0207665_10217892 3300025939 Bacteria 1397
122 Ga0207665_10365270 3300025939 Bacteria 1092
123 Ga0207661_10849364 3300025944 Bacteria 840
124 Ga0207661_11014423 3300025944 Bacteria 764
125 Ga0207679_10381261 3300025945 Bacteria 1236
126 Ga0207639_10241650 3300026041 Bacteria 1570
127 Ga0207678_10441728 3300026067 Bacteria 1130
128 Ga0207702_10146111 3300026078 Bacteria 2146
129 Ga0373923_0190984 3300035111 Bacteria 944
130 Ga0373953_0021152 3300035117 Bacteria 2438
131 Ga0373954_0022104 3300035118 Bacteria 2884
132 Ga0373957_0056611 3300035120 Bacteria 1510
133 Ga0373946_0231209 3300035171 Bacteria 896
134 Ga0373927_1095910 3300035695 Bacteria 525
135 Ga0373937_0024988 3300036401 Bacteria 5391
136 Ga0436364_0001421 3300037853 Bacteria 2945
137 Ga0436364_0664989 3300037853 Unclassified 1130
138 Ga0436364_0741465 3300037853 Bacteria 3397
139 Ga0436364_0775197 3300037853 Bacteria 1972
140 Ga0436364_0885771 3300037853 Bacteria 790
141 Ga0436364_0944185 3300037853 Bacteria 785
142 Ga0436364_1094382 3300037853 Bacteria 777
143 Ga0436364_1122530 3300037853 Bacteria 16819
144 Ga0436364_1438537 3300037853 Bacteria 5416
145 Ga0436364_1483213 3300037853 Bacteria 11245
146 Ga0436364_1552414 3300037853 Bacteria 2228
147 Ga0436365_0403715 3300039437 Bacteria 17000
148 Ga0436365_0483571 3300039437 Bacteria 877
149 Ga0436365_0501508 3300039437 Bacteria 2970
150 Ga0436365_0669080 3300039437 Bacteria 5688
151 Ga0436365_0887965 3300039437 Bacteria 1175
152 Ga0436365_1005270 3300039437 Bacteria 4382
153 Ga0436365_1468086 3300039437 Bacteria 9438
154 Ga0436365_1688357 3300039437 Bacteria 2235
155 Ga0436365_1725409 3300039437 Bacteria 5697
156 Ga0436365_1871140 3300039437 Bacteria 600
157 Ga0436360_1232423 3300039438 Bacteria 1066
158 Ga0436363_0301667 3300039450 Bacteria 3671
159 Ga0436363_0335111 3300039450 Bacteria 1155
160 Ga0436363_0386698 3300039450 Bacteria 5677
161 Ga0436363_0483995 3300039450 Bacteria 633
162 Ga0436363_0726841 3300039450 Bacteria 607
163 Ga0436363_0844961 3300039450 Bacteria 2564
164 Ga0436363_1064792 3300039450 Bacteria 6028
165 Ga0436363_1400525 3300039450 Bacteria 18081
166 Ga0436363_1450536 3300039450 Bacteria 2092
167 Ga0436363_1495897 3300039450 Bacteria 690
168 Ga0436363_1573316 3300039450 Bacteria 1520
169 Ga0436363_1712442 3300039450 Bacteria 740
170 Ga0436362_0083254 3300039453 Bacteria 511
171 Ga0436362_0506834 3300039453 Bacteria 1469
172 Ga0436362_0803075 3300039453 Bacteria 651
173 Ga0436362_0839555 3300039453 Bacteria 713
174 Ga0436362_0937777 3300039453 Bacteria 1359
175 Ga0436362_1089259 3300039453 Bacteria 769
176 Ga0436362_1244461 3300039453 Bacteria 858
177 Ga0451793_0789644 3300041452 Bacteria 767
178 Ga0451795_1078970 3300041456 Bacteria 569
179 Ga0451802_0372975 3300041460 Unclassified 579
180 Ga0466969_0020168 3300044656 Bacteria 3455
181 Ga0466969_0034232 3300044656 Bacteria 2575
182 Ga0466969_0546839 3300044656 Bacteria 530
183 Ga0466966_0194248 3300044684 Bacteria 1229
184 Ga0466966_0219164 3300044684 Bacteria 1149
185 Ga0466961_0461199 3300044693 Bacteria 769
186 Ga0466963_0015641 3300044694 Bacteria 4705
187 Ga0466963_0237275 3300044694 Bacteria 1278
188 Ga0466963_0611049 3300044694 Bacteria 770
189 Ga0466963_0745479 3300044694 Bacteria 691
190 Ga0466963_1261575 3300044694 Bacteria 519
191 Ga0466964_0331572 3300044706 Bacteria 776
192 Ga0466971_0120078 3300044719 Bacteria 1216
193 Ga0466971_0503060 3300044719 Bacteria 598
194 Ga0466968_0014440 3300044735 Bacteria 3122
195 Ga0466968_0383461 3300044735 Bacteria 687
196 Ga0466970_0174041 3300044765 Bacteria 1193
197 Ga0466957_0156531 3300044842 Bacteria 1477
198 Ga0466957_0328064 3300044842 Bacteria 1034
199 Ga0466960_0707662 3300044901 Bacteria 605
200 Ga0466959_0001464 3300045049 Bacteria 14467
201 Ga0466959_0042236 3300045049 Bacteria 3363
202 Ga0466959_0120495 3300045049 Bacteria 1866
203 Ga0466959_0146812 3300045049 Bacteria 1664
204 Ga0466959_0374727 3300045049 Bacteria 969
205 Ga0466958_0044616 3300045836 Bacteria 2672
206 Ga0466958_0059999 3300045836 Bacteria 2315
207 Ga0466958_0143194 3300045836 Bacteria 1506
208 Ga0466958_0234786 3300045836 Bacteria 1171
209 Ga0466958_0342408 3300045836 Bacteria 962
210 Ga0466958_0416191 3300045836 Bacteria 868
211 Ga0466967_0260919 3300045976 Bacteria 1658
212 Ga0466967_0445054 3300045976 Bacteria 1266
213 Ga0466967_1370985 3300045976 Bacteria 704
214 Ga0495651_0010955 3300046462 Bacteria 6975
215 Ga0495651_0246352 3300046462 Bacteria 1223
216 Ga0495653_0002266 3300046463 Bacteria 15228
217 Ga0495653_0768279 3300046463 Bacteria 581
218 Ga0495662_0437592 3300046476 Bacteria 642
219 Ga0495664_0000073 3300046477 Bacteria 49243
220 Ga0495608_0014976 3300046511 Bacteria 5381
221 Ga0495608_0165171 3300046511 Bacteria 1406
222 Ga0495608_0772215 3300046511 Bacteria 568
223 Ga0495618_0027308 3300046514 Bacteria 3554
224 Ga0495628_0526481 3300046516 Bacteria 851
225 Ga0495628_0753946 3300046516 Bacteria 684
226 Ga0495628_1152759 3300046516 Bacteria 528
227 Ga0495630_0343486 3300046517 Bacteria 1142
228 Ga0495652_0114495 3300046529 Bacteria 2163
229 Ga0495652_0189567 3300046529 Bacteria 1570
230 Ga0495652_0760061 3300046529 Bacteria 648
231 Ga0495640_0151035 3300046533 Bacteria 1492
232 Ga0495587_0010897 3300046536 Bacteria 5769
233 Ga0495645_0000119 3300046543 Bacteria 53463
234 Ga0495645_0354385 3300046543 Bacteria 945
235 Ga0495667_0046512 3300046559 Bacteria 2869
236 Ga0495667_0362622 3300046559 Bacteria 915
237 Ga0495667_0740455 3300046559 Bacteria 608
238 Ga0495634_0257281 3300046642 Bacteria 1066
239 Ga0495635_0011412 3300046663 Bacteria 6232
240 Ga0495635_0630047 3300046663 Bacteria 699
241 Ga0495657_0010844 3300046675 Bacteria 6841
242 Ga0495657_0126524 3300046675 Bacteria 1605
243 Ga0495623_0281311 3300046679 Bacteria 925
244 Ga0495646_0005125 3300046680 Bacteria 8266
245 Ga0495589_0182507 3300046794 Bacteria 995
246 Ga0495600_0135576 3300046809 Bacteria 1599
247 Ga0495600_0220983 3300046809 Bacteria 1212
248 Ga0495604_0223686 3300047317 Bacteria 1294
249 Ga0495674_0015458 3300047319 Bacteria 7132
250 Ga0495680_0003599 3300047322 Bacteria 15170
251 Ga0495684_0011380 3300047471 Bacteria 6870
252 Ga0495602_0013920 3300048088 Bacteria 8197
253 Ga0496101_0591627 3300048904 Bacteria 877
254 Ga0496102_0561812 3300048905 Bacteria 1064
255 Ga0496103_0070931 3300048906 Bacteria 2180
256 Ga0496104_0000006 3300048907 Bacteria 536446
257 Ga0496109_0078754 3300048912 Bacteria 3035
258 Ga0496109_0174927 3300048912 Bacteria 2015
259 Ga0496109_1284001 3300048912 Bacteria 668
260 Ga0496110_0000064 3300048913 Bacteria 52955
261 Ga0496110_0455096 3300048913 Bacteria 1166
262 Ga0496111_0000012 3300048914 Bacteria 83376
263 Ga0496112_0036205 3300048915 Bacteria 4813
264 Ga0496114_0536001 3300048917 Bacteria 1035
265 Ga0496122_0285573 3300048925 Bacteria 899
266 nmdc:mga0n895_336090_c1 3300050512 Bacteria 1530
267 Ga0495601_0035823 3300053077 Bacteria 3099
268 Ga0495595_0028675 3300053084 Bacteria 2487
269 Ga0495619_0018953 3300053085 Bacteria 4370
270 Ga0495619_0050931 3300053085 Bacteria 2735
271 Ga0495619_0128647 3300053085 Bacteria 1740
272 Ga0587073_0214533 3300059492 Bacteria 585
273 Ga0587128_125946 3300059630 Bacteria 562
274 Ga0587075_044035 3300059644 Bacteria 758
275 Ga0466962_0418710 3300061719 Bacteria 672

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041452 Ga0451793_0789644 Ga0451793_0789644_299_589 94
2 3300005329 Ga0070683_100680926 Ga0070683_1006809262 118
3 3300005336 Ga0070680_100109619 Ga0070680_1001096193 118
4 3300005337 Ga0070682_100095784 Ga0070682_1000957842 118
5 3300005339 Ga0070660_100069672 Ga0070660_1000696723 118
6 3300005341 Ga0070691_10028116 Ga0070691_100281163 118
7 3300005344 Ga0070661_100142565 Ga0070661_1001425652 118
8 3300005366 Ga0070659_100175212 Ga0070659_1001752122 118
9 3300005434 Ga0070709_10089705 Ga0070709_100897052 118
10 3300005435 Ga0070714_100094323 Ga0070714_1000943234 118
11 3300005435 Ga0070714_100144082 Ga0070714_1001440822 118
12 3300005435 Ga0070714_100198205 Ga0070714_1001982052 118
13 3300005435 Ga0070714_100686196 Ga0070714_1006861961 118
14 3300005435 Ga0070714_101381520 Ga0070714_1013815201 118
15 3300005436 Ga0070713_100201107 Ga0070713_1002011073 118
16 3300005436 Ga0070713_100554440 Ga0070713_1005544402 118
17 3300005436 Ga0070713_100584425 Ga0070713_1005844252 118
18 3300005436 Ga0070713_100892582 Ga0070713_1008925822 118
19 3300005436 Ga0070713_100973776 Ga0070713_1009737762 118
20 3300005437 Ga0070710_10292525 Ga0070710_102925252 118
21 3300005437 Ga0070710_10396719 Ga0070710_103967191 118
22 3300005437 Ga0070710_10426996 Ga0070710_104269961 118
23 3300005439 Ga0070711_100019980 Ga0070711_1000199805 118
24 3300005439 Ga0070711_100021243 Ga0070711_1000212431 118
25 3300005439 Ga0070711_100229326 Ga0070711_1002293263 118
26 3300005439 Ga0070711_101147758 Ga0070711_1011477582 118
27 3300005455 Ga0070663_101100544 Ga0070663_1011005442 118
28 3300005458 Ga0070681_11471251 Ga0070681_114712511 118
29 3300005530 Ga0070679_100074391 Ga0070679_1000743915 118
30 3300005535 Ga0070684_100016176 Ga0070684_1000161763 118
31 3300005535 Ga0070684_100353870 Ga0070684_1003538702 118
32 3300005539 Ga0068853_100263597 Ga0068853_1002635972 118
33 3300005546 Ga0070696_101221490 Ga0070696_1012214901 118
34 3300005546 Ga0070696_101417926 Ga0070696_1014179261 118
35 3300005564 Ga0070664_100941693 Ga0070664_1009416932 118
36 3300005616 Ga0068852_100181277 Ga0068852_1001812772 118
37 3300006028 Ga0070717_10025299 Ga0070717_100252992 118
38 3300006028 Ga0070717_10089317 Ga0070717_100893174 118
39 3300006028 Ga0070717_10159242 Ga0070717_101592422 118
40 3300006028 Ga0070717_10374839 Ga0070717_103748392 118
41 3300006028 Ga0070717_11580326 Ga0070717_115803261 118
42 3300006028 Ga0070717_12090852 Ga0070717_120908521 118
43 3300006163 Ga0070715_10057327 Ga0070715_100573272 118
44 3300006163 Ga0070715_10413415 Ga0070715_104134152 118
45 3300006173 Ga0070716_100678313 Ga0070716_1006783132 118
46 3300006175 Ga0070712_100002893 Ga0070712_1000028937 118
47 3300006175 Ga0070712_100140013 Ga0070712_1001400134 118
48 3300006175 Ga0070712_100409401 Ga0070712_1004094012 118
49 3300006175 Ga0070712_100779484 Ga0070712_1007794842 118
50 3300006175 Ga0070712_101772092 Ga0070712_1017720922 118
51 3300006237 Ga0097621_101199743 Ga0097621_1011997432 118
52 3300006871 Ga0075434_100356912 Ga0075434_1003569121 118
53 3300007076 Ga0075435_100345674 Ga0075435_1003456742 118
54 3300009093 Ga0105240_10030748 Ga0105240_100307484 118
55 3300009093 Ga0105240_10183174 Ga0105240_101831743 118
56 3300009098 Ga0105245_12840633 Ga0105245_128406331 118
57 3300009545 Ga0105237_10049423 Ga0105237_100494232 118
58 3300009551 Ga0105238_10105166 Ga0105238_101051664 118
59 3300009551 Ga0105238_11892346 Ga0105238_118923461 118
60 3300010375 Ga0105239_10412297 Ga0105239_104122972 118
61 3300013100 Ga0157373_11588024 Ga0157373_115880242 118
62 3300013102 Ga0157371_10399432 Ga0157371_103994322 118
63 3300013104 Ga0157370_10028654 Ga0157370_100286543 118
64 3300013105 Ga0157369_10032044 Ga0157369_100320442 118
65 3300013297 Ga0157378_10477190 Ga0157378_104771901 118
66 3300013307 Ga0157372_10084129 Ga0157372_100841295 118
67 3300020069 Ga0197907_10335616 Ga0197907_103356163 118
68 3300020070 Ga0206356_11371313 Ga0206356_113713132 118
69 3300020610 Ga0154015_1137610 Ga0154015_11376101 118
70 3300020610 Ga0154015_1427584 Ga0154015_14275842 118
71 3300021358 Ga0213873_10069630 Ga0213873_100696302 118
72 3300021377 Ga0213874_10000680 Ga0213874_100006803 118
73 3300021377 Ga0213874_10143555 Ga0213874_101435551 118
74 3300021377 Ga0213874_10246681 Ga0213874_102466812 118
75 3300021377 Ga0213874_10371838 Ga0213874_103718381 118
76 3300021384 Ga0213876_10009973 Ga0213876_100099733 118
77 3300021384 Ga0213876_10023598 Ga0213876_100235985 118
78 3300021384 Ga0213876_10170663 Ga0213876_101706632 118
79 3300021384 Ga0213876_10211691 Ga0213876_102116912 118
80 3300021388 Ga0213875_10014084 Ga0213875_100140842 118
81 3300021388 Ga0213875_10020923 Ga0213875_100209232 118
82 3300021388 Ga0213875_10033100 Ga0213875_100331002 118
83 3300021388 Ga0213875_10040177 Ga0213875_100401772 118
84 3300021388 Ga0213875_10143271 Ga0213875_101432711 118
85 3300021388 Ga0213875_10144988 Ga0213875_101449881 118
86 3300021388 Ga0213875_10171548 Ga0213875_101715482 118
87 3300021388 Ga0213875_10331057 Ga0213875_103310572 118
88 3300022467 Ga0224712_10046718 Ga0224712_100467183 118
89 3300022467 Ga0224712_10220782 Ga0224712_102207822 118
90 3300025905 Ga0207685_10206811 Ga0207685_102068112 118
91 3300025905 Ga0207685_10258107 Ga0207685_102581072 118
92 3300025906 Ga0207699_10146848 Ga0207699_101468482 118
93 3300025906 Ga0207699_10183139 Ga0207699_101831392 118
94 3300025906 Ga0207699_10895378 Ga0207699_108953781 118
95 3300025912 Ga0207707_10021148 Ga0207707_100211483 118
96 3300025913 Ga0207695_10257635 Ga0207695_102576352 118
97 3300025914 Ga0207671_10126030 Ga0207671_101260302 118
98 3300025915 Ga0207693_10097279 Ga0207693_100972792 118
99 3300025915 Ga0207693_10118510 Ga0207693_101185101 118
100 3300025915 Ga0207693_10213121 Ga0207693_102131211 118
101 3300025915 Ga0207693_10269572 Ga0207693_102695722 118
102 3300025915 Ga0207693_10677804 Ga0207693_106778041 118
103 3300025915 Ga0207693_10715125 Ga0207693_107151251 118
104 3300025916 Ga0207663_10209956 Ga0207663_102099562 118
105 3300025917 Ga0207660_10177284 Ga0207660_101772842 118
106 3300025920 Ga0207649_10105072 Ga0207649_101050722 118
107 3300025921 Ga0207652_10280434 Ga0207652_102804341 118
108 3300025924 Ga0207694_10044745 Ga0207694_100447452 118
109 3300025927 Ga0207687_10434870 Ga0207687_104348702 118
110 3300025928 Ga0207700_10253420 Ga0207700_102534203 118
111 3300025928 Ga0207700_10707513 Ga0207700_107075132 118
112 3300025929 Ga0207664_10140912 Ga0207664_101409124 118
113 3300025929 Ga0207664_10484740 Ga0207664_104847402 118
114 3300025929 Ga0207664_10916284 Ga0207664_109162842 118
115 3300025932 Ga0207690_10081693 Ga0207690_100816934 118
116 3300025939 Ga0207665_10089530 Ga0207665_100895304 118
117 3300025939 Ga0207665_10217892 Ga0207665_102178923 118
118 3300025939 Ga0207665_10365270 Ga0207665_103652702 118
119 3300025944 Ga0207661_10849364 Ga0207661_108493642 118
120 3300025944 Ga0207661_11014423 Ga0207661_110144232 118
121 3300025945 Ga0207679_10381261 Ga0207679_103812612 118
122 3300026041 Ga0207639_10241650 Ga0207639_102416503 118
123 3300026067 Ga0207678_10441728 Ga0207678_104417282 118
124 3300026078 Ga0207702_10146111 Ga0207702_101461114 118
125 3300035111 Ga0373923_0190984 Ga0373923_0190984_293_649 118
126 3300035117 Ga0373953_0021152 Ga0373953_0021152_1070_1426 118
127 3300035118 Ga0373954_0022104 Ga0373954_0022104_26_382 118
128 3300035120 Ga0373957_0056611 Ga0373957_0056611_303_659 118
129 3300035171 Ga0373946_0231209 Ga0373946_0231209_103_459 118
130 3300035695 Ga0373927_1095910 Ga0373927_1095910_109_465 118
131 3300036401 Ga0373937_0024988 Ga0373937_0024988_4211_4567 118
132 3300037853 Ga0436364_0001421 Ga0436364_0001421_1350_1706 118
133 3300037853 Ga0436364_0664989 Ga0436364_0664989_10_366 118
134 3300037853 Ga0436364_0741465 Ga0436364_0741465_2201_2557 118
135 3300037853 Ga0436364_0775197 Ga0436364_0775197_1259_1615 118
136 3300037853 Ga0436364_0885771 Ga0436364_0885771_51_407 118
137 3300037853 Ga0436364_0944185 Ga0436364_0944185_313_669 118
138 3300037853 Ga0436364_1094382 Ga0436364_1094382_157_513 118
139 3300037853 Ga0436364_1438537 Ga0436364_1438537_582_938 118
140 3300037853 Ga0436364_1483213 Ga0436364_1483213_3658_4014 118
141 3300037853 Ga0436364_1552414 Ga0436364_1552414_1558_1914 118
142 3300039437 Ga0436365_0403715 Ga0436365_0403715_11194_11550 118
143 3300039437 Ga0436365_0483571 Ga0436365_0483571_174_530 118
144 3300039437 Ga0436365_0501508 Ga0436365_0501508_311_667 118
145 3300039437 Ga0436365_0669080 Ga0436365_0669080_3833_4189 118
146 3300039437 Ga0436365_0887965 Ga0436365_0887965_262_618 118
147 3300039437 Ga0436365_1005270 Ga0436365_1005270_384_740 118
148 3300039437 Ga0436365_1468086 Ga0436365_1468086_847_1203 118
149 3300039437 Ga0436365_1688357 Ga0436365_1688357_668_1024 118
150 3300039437 Ga0436365_1725409 Ga0436365_1725409_3182_3538 118
151 3300039437 Ga0436365_1871140 Ga0436365_1871140_139_495 118
152 3300039438 Ga0436360_1232423 Ga0436360_1232423_455_811 118
153 3300039450 Ga0436363_0301667 Ga0436363_0301667_2997_3353 118
154 3300039450 Ga0436363_0335111 Ga0436363_0335111_614_970 118
155 3300039450 Ga0436363_0386698 Ga0436363_0386698_2585_2941 118
156 3300039450 Ga0436363_0483995 Ga0436363_0483995_15_371 118
157 3300039450 Ga0436363_0726841 Ga0436363_0726841_41_397 118
158 3300039450 Ga0436363_0844961 Ga0436363_0844961_161_517 118
159 3300039450 Ga0436363_1064792 Ga0436363_1064792_1790_2146 118
160 3300039450 Ga0436363_1400525 Ga0436363_1400525_3116_3472 118
161 3300039450 Ga0436363_1450536 Ga0436363_1450536_1408_1764 118
162 3300039450 Ga0436363_1573316 Ga0436363_1573316_656_1012 118
163 3300039450 Ga0436363_1712442 Ga0436363_1712442_19_375 118
164 3300039453 Ga0436362_0083254 Ga0436362_0083254_20_376 118
165 3300039453 Ga0436362_0506834 Ga0436362_0506834_580_936 118
166 3300039453 Ga0436362_0803075 Ga0436362_0803075_47_403 118
167 3300039453 Ga0436362_0839555 Ga0436362_0839555_88_444 118
168 3300039453 Ga0436362_0937777 Ga0436362_0937777_625_981 118
169 3300039453 Ga0436362_1089259 Ga0436362_1089259_239_595 118
170 3300039453 Ga0436362_1244461 Ga0436362_1244461_377_739 118
171 3300041456 Ga0451795_1078970 Ga0451795_1078970_88_444 118
172 3300041460 Ga0451802_0372975 Ga0451802_0372975_142_498 118
173 3300044656 Ga0466969_0020168 Ga0466969_0020168_483_845 118
174 3300044656 Ga0466969_0034232 Ga0466969_0034232_358_717 118
175 3300044656 Ga0466969_0546839 Ga0466969_0546839_17_373 118
176 3300044684 Ga0466966_0194248 Ga0466966_0194248_403_759 118
177 3300044684 Ga0466966_0219164 Ga0466966_0219164_537_893 118
178 3300044693 Ga0466961_0461199 Ga0466961_0461199_227_583 118
179 3300044694 Ga0466963_0237275 Ga0466963_0237275_34_390 118
180 3300044694 Ga0466963_0611049 Ga0466963_0611049_112_468 118
181 3300044694 Ga0466963_0745479 Ga0466963_0745479_187_543 118
182 3300044694 Ga0466963_1261575 Ga0466963_1261575_134_490 118
183 3300044706 Ga0466964_0331572 Ga0466964_0331572_16_372 118
184 3300044719 Ga0466971_0120078 Ga0466971_0120078_819_1175 118
185 3300044719 Ga0466971_0503060 Ga0466971_0503060_33_389 118
186 3300044735 Ga0466968_0383461 Ga0466968_0383461_98_454 118
187 3300044765 Ga0466970_0174041 Ga0466970_0174041_344_700 118
188 3300044842 Ga0466957_0156531 Ga0466957_0156531_1072_1428 118
189 3300044842 Ga0466957_0328064 Ga0466957_0328064_68_424 118
190 3300044901 Ga0466960_0707662 Ga0466960_0707662_73_429 118
191 3300045049 Ga0466959_0001464 Ga0466959_0001464_7706_8068 118
192 3300045049 Ga0466959_0042236 Ga0466959_0042236_538_894 118
193 3300045049 Ga0466959_0120495 Ga0466959_0120495_791_1147 118
194 3300045049 Ga0466959_0146812 Ga0466959_0146812_333_692 118
195 3300045049 Ga0466959_0374727 Ga0466959_0374727_217_573 118
196 3300045836 Ga0466958_0044616 Ga0466958_0044616_132_488 118
197 3300045836 Ga0466958_0059999 Ga0466958_0059999_1098_1454 118
198 3300045836 Ga0466958_0234786 Ga0466958_0234786_556_912 118
199 3300045836 Ga0466958_0342408 Ga0466958_0342408_218_580 118
200 3300045836 Ga0466958_0416191 Ga0466958_0416191_377_733 118
201 3300045976 Ga0466967_0260919 Ga0466967_0260919_284_640 118
202 3300045976 Ga0466967_0445054 Ga0466967_0445054_455_811 118
203 3300045976 Ga0466967_1370985 Ga0466967_1370985_104_460 118
204 3300046462 Ga0495651_0010955 Ga0495651_0010955_4465_4821 118
205 3300046462 Ga0495651_0246352 Ga0495651_0246352_266_622 118
206 3300046463 Ga0495653_0002266 Ga0495653_0002266_14529_14885 118
207 3300046463 Ga0495653_0768279 Ga0495653_0768279_157_513 118
208 3300046476 Ga0495662_0437592 Ga0495662_0437592_173_529 118
209 3300046477 Ga0495664_0000073 Ga0495664_0000073_61_417 118
210 3300046511 Ga0495608_0014976 Ga0495608_0014976_320_676 118
211 3300046511 Ga0495608_0165171 Ga0495608_0165171_878_1234 118
212 3300046511 Ga0495608_0772215 Ga0495608_0772215_111_467 118
213 3300046514 Ga0495618_0027308 Ga0495618_0027308_1922_2278 118
214 3300046516 Ga0495628_0526481 Ga0495628_0526481_47_403 118
215 3300046516 Ga0495628_0753946 Ga0495628_0753946_284_640 118
216 3300046516 Ga0495628_1152759 Ga0495628_1152759_22_378 118
217 3300046517 Ga0495630_0343486 Ga0495630_0343486_405_761 118
218 3300046529 Ga0495652_0114495 Ga0495652_0114495_1635_1991 118
219 3300046529 Ga0495652_0189567 Ga0495652_0189567_1060_1416 118
220 3300046529 Ga0495652_0760061 Ga0495652_0760061_120_476 118
221 3300046533 Ga0495640_0151035 Ga0495640_0151035_429_785 118
222 3300046536 Ga0495587_0010897 Ga0495587_0010897_335_691 118
223 3300046543 Ga0495645_0000119 Ga0495645_0000119_49549_49905 118
224 3300046543 Ga0495645_0354385 Ga0495645_0354385_86_442 118
225 3300046559 Ga0495667_0046512 Ga0495667_0046512_1934_2290 118
226 3300046559 Ga0495667_0362622 Ga0495667_0362622_423_779 118
227 3300046559 Ga0495667_0740455 Ga0495667_0740455_73_429 118
228 3300046642 Ga0495634_0257281 Ga0495634_0257281_79_435 118
229 3300046663 Ga0495635_0011412 Ga0495635_0011412_2976_3332 118
230 3300046663 Ga0495635_0630047 Ga0495635_0630047_111_488 118
231 3300046675 Ga0495657_0010844 Ga0495657_0010844_5937_6293 118
232 3300046675 Ga0495657_0126524 Ga0495657_0126524_396_752 118
233 3300046679 Ga0495623_0281311 Ga0495623_0281311_324_680 118
234 3300046680 Ga0495646_0005125 Ga0495646_0005125_567_923 118
235 3300046809 Ga0495600_0135576 Ga0495600_0135576_292_648 118
236 3300046809 Ga0495600_0220983 Ga0495600_0220983_661_1017 118
237 3300047317 Ga0495604_0223686 Ga0495604_0223686_743_1099 118
238 3300047319 Ga0495674_0015458 Ga0495674_0015458_4556_4912 118
239 3300047322 Ga0495680_0003599 Ga0495680_0003599_9082_9438 118
240 3300047471 Ga0495684_0011380 Ga0495684_0011380_4012_4368 118
241 3300048088 Ga0495602_0013920 Ga0495602_0013920_7503_7859 118
242 3300048904 Ga0496101_0591627 Ga0496101_0591627_453_809 118
243 3300048905 Ga0496102_0561812 Ga0496102_0561812_696_1052 118
244 3300048906 Ga0496103_0070931 Ga0496103_0070931_447_803 118
245 3300048907 Ga0496104_0000006 Ga0496104_0000006_428261_428617 118
246 3300048912 Ga0496109_0078754 Ga0496109_0078754_2596_2952 118
247 3300048912 Ga0496109_0174927 Ga0496109_0174927_1603_1959 118
248 3300048912 Ga0496109_1284001 Ga0496109_1284001_46_402 118
249 3300048913 Ga0496110_0000064 Ga0496110_0000064_8432_8788 118
250 3300048913 Ga0496110_0455096 Ga0496110_0455096_346_702 118
251 3300048914 Ga0496111_0000012 Ga0496111_0000012_1613_1969 118
252 3300048915 Ga0496112_0036205 Ga0496112_0036205_857_1213 118
253 3300048917 Ga0496114_0536001 Ga0496114_0536001_608_964 118
254 3300048925 Ga0496122_0285573 Ga0496122_0285573_405_761 118
255 3300050512 nmdc:mga0n895_336090_c1 nmdc:mga0n895_336090_c1_1075_1431 118
256 3300053077 Ga0495601_0035823 Ga0495601_0035823_1299_1655 118
257 3300053084 Ga0495595_0028675 Ga0495595_0028675_224_580 118
258 3300053085 Ga0495619_0018953 Ga0495619_0018953_3601_3957 118
259 3300053085 Ga0495619_0050931 Ga0495619_0050931_839_1195 118
260 3300053085 Ga0495619_0128647 Ga0495619_0128647_1136_1492 118
261 3300059492 Ga0587073_0214533 Ga0587073_0214533_111_467 118
262 3300059644 Ga0587075_044035 Ga0587075_044035_355_711 118
263 3300061719 Ga0466962_0418710 Ga0466962_0418710_123_479 118
264 3300044735 Ga0466968_0014440 Ga0466968_0014440_1789_2148 119
265 3300003659 JGI25404J52841_10127789 JGI25404J52841_101277891 120
266 3300005329 Ga0070683_100272868 Ga0070683_1002728682 120
267 3300005434 Ga0070709_10175567 Ga0070709_101755671 120
268 3300005435 Ga0070714_100181251 Ga0070714_1001812512 120
269 3300021388 Ga0213875_10000148 Ga0213875_1000014866 120
270 3300037853 Ga0436364_1122530 Ga0436364_1122530_4643_5005 120
271 3300039450 Ga0436363_1495897 Ga0436363_1495897_125_487 120
272 3300044694 Ga0466963_0015641 Ga0466963_0015641_3836_4198 120
273 3300045836 Ga0466958_0143194 Ga0466958_0143194_1123_1485 120
274 3300046794 Ga0495589_0182507 Ga0495589_0182507_183_545 120
275 3300059630 Ga0587128_125946 Ga0587128_125946_148_510 120

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00507

Oxidored_q4

NADH-ubiquinone/plastoquinone oxidoreductase, chain 3

26

124

0.97

Feature Viewer

pLDDT pTM Quality
69.45 0.45 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map