F380656
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 275 | 139 | 275 | 118 |
Family's Representative Sequence
| Representative Sequence | 3300046663|Ga0495635_0630047|Ga0495635_0630047_111_488 |
| Length | 125 |
| Sequence | VEWYNRVVLRDYLPAIVFLVLGGAVGALFSVLNLFLGHRRPNRSKQEPYECGLPSEIQSGFRFGISFYLIAMLFIVFDIEVIFLYPIAVQLRAFGTFAMVETVVFVALLLVGFGYVWRRGALEWR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 19 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 22 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 28 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 29 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 41 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 42 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 43 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 44 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 45 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 46 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 47 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 48 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 70 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 71 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 72 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 73 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 74 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 75 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 76 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 77 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 78 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 79 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 80 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 81 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 82 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 83 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 84 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 85 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 86 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 87 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 88 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 89 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 90 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 91 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 92 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 93 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 94 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 95 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 96 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 97 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 123 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 124 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 125 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 126 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 127 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 128 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 129 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 130 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 131 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 132 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 133 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 137 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 138 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 139 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.73 |
| Metatranscriptomes | 3.27 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.45 |
| Rhizosphere | 76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 18.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25404J52841_10127789 | 3300003659 | Bacteria | 537 |
| 2 | Ga0070683_100272868 | 3300005329 | Bacteria | 1609 |
| 3 | Ga0070683_100680926 | 3300005329 | Bacteria | 985 |
| 4 | Ga0070680_100109619 | 3300005336 | Bacteria | 2297 |
| 5 | Ga0070682_100095784 | 3300005337 | Bacteria | 1950 |
| 6 | Ga0070660_100069672 | 3300005339 | Bacteria | 2743 |
| 7 | Ga0070691_10028116 | 3300005341 | Bacteria | 2625 |
| 8 | Ga0070661_100142565 | 3300005344 | Bacteria | 1807 |
| 9 | Ga0070659_100175212 | 3300005366 | Bacteria | 1759 |
| 10 | Ga0070709_10089705 | 3300005434 | Bacteria | 2025 |
| 11 | Ga0070709_10175567 | 3300005434 | Bacteria | 1501 |
| 12 | Ga0070714_100094323 | 3300005435 | Bacteria | 2627 |
| 13 | Ga0070714_100144082 | 3300005435 | Bacteria | 2141 |
| 14 | Ga0070714_100181251 | 3300005435 | Bacteria | 1916 |
| 15 | Ga0070714_100198205 | 3300005435 | Bacteria | 1836 |
| 16 | Ga0070714_100686196 | 3300005435 | Bacteria | 988 |
| 17 | Ga0070714_101381520 | 3300005435 | Bacteria | 688 |
| 18 | Ga0070713_100201107 | 3300005436 | Bacteria | 1799 |
| 19 | Ga0070713_100554440 | 3300005436 | Bacteria | 1088 |
| 20 | Ga0070713_100584425 | 3300005436 | Bacteria | 1060 |
| 21 | Ga0070713_100892582 | 3300005436 | Bacteria | 855 |
| 22 | Ga0070713_100973776 | 3300005436 | Bacteria | 818 |
| 23 | Ga0070710_10292525 | 3300005437 | Bacteria | 1060 |
| 24 | Ga0070710_10396719 | 3300005437 | Bacteria | 924 |
| 25 | Ga0070710_10426996 | 3300005437 | Bacteria | 894 |
| 26 | Ga0070711_100019980 | 3300005439 | Bacteria | 4308 |
| 27 | Ga0070711_100021243 | 3300005439 | Bacteria | 4193 |
| 28 | Ga0070711_100229326 | 3300005439 | Bacteria | 1447 |
| 29 | Ga0070711_101147758 | 3300005439 | Bacteria | 671 |
| 30 | Ga0070663_101100544 | 3300005455 | Bacteria | 695 |
| 31 | Ga0070681_11471251 | 3300005458 | Bacteria | 605 |
| 32 | Ga0070679_100074391 | 3300005530 | Bacteria | 3388 |
| 33 | Ga0070684_100016176 | 3300005535 | Bacteria | 6094 |
| 34 | Ga0070684_100353870 | 3300005535 | Bacteria | 1351 |
| 35 | Ga0068853_100263597 | 3300005539 | Bacteria | 1585 |
| 36 | Ga0070696_101221490 | 3300005546 | Bacteria | 636 |
| 37 | Ga0070696_101417926 | 3300005546 | Bacteria | 593 |
| 38 | Ga0070664_100941693 | 3300005564 | Bacteria | 811 |
| 39 | Ga0068852_100181277 | 3300005616 | Bacteria | 1980 |
| 40 | Ga0070717_10025299 | 3300006028 | Bacteria | 4719 |
| 41 | Ga0070717_10089317 | 3300006028 | Bacteria | 2599 |
| 42 | Ga0070717_10159242 | 3300006028 | Bacteria | 1958 |
| 43 | Ga0070717_10374839 | 3300006028 | Bacteria | 1275 |
| 44 | Ga0070717_11580326 | 3300006028 | Bacteria | 594 |
| 45 | Ga0070717_12090852 | 3300006028 | Bacteria | 509 |
| 46 | Ga0070715_10057327 | 3300006163 | Bacteria | 1697 |
| 47 | Ga0070715_10413415 | 3300006163 | Bacteria | 753 |
| 48 | Ga0070716_100678313 | 3300006173 | Bacteria | 785 |
| 49 | Ga0070712_100002893 | 3300006175 | Bacteria | 10651 |
| 50 | Ga0070712_100140013 | 3300006175 | Bacteria | 1845 |
| 51 | Ga0070712_100409401 | 3300006175 | Bacteria | 1122 |
| 52 | Ga0070712_100779484 | 3300006175 | Bacteria | 819 |
| 53 | Ga0070712_101772092 | 3300006175 | Bacteria | 541 |
| 54 | Ga0097621_101199743 | 3300006237 | Bacteria | 715 |
| 55 | Ga0075434_100356912 | 3300006871 | Bacteria | 1483 |
| 56 | Ga0075435_100345674 | 3300007076 | Bacteria | 1275 |
| 57 | Ga0105240_10030748 | 3300009093 | Bacteria | 6975 |
| 58 | Ga0105240_10183174 | 3300009093 | Bacteria | 2470 |
| 59 | Ga0105245_12840633 | 3300009098 | Bacteria | 537 |
| 60 | Ga0105237_10049423 | 3300009545 | Bacteria | 4227 |
| 61 | Ga0105238_10105166 | 3300009551 | Bacteria | 2804 |
| 62 | Ga0105238_11892346 | 3300009551 | Bacteria | 629 |
| 63 | Ga0105239_10412297 | 3300010375 | Bacteria | 1530 |
| 64 | Ga0157373_11588024 | 3300013100 | Bacteria | 501 |
| 65 | Ga0157371_10399432 | 3300013102 | Bacteria | 1006 |
| 66 | Ga0157370_10028654 | 3300013104 | Bacteria | 5475 |
| 67 | Ga0157369_10032044 | 3300013105 | Bacteria | 5782 |
| 68 | Ga0157378_10477190 | 3300013297 | Bacteria | 1242 |
| 69 | Ga0157372_10084129 | 3300013307 | Bacteria | 3605 |
| 70 | Ga0197907_10335616 | 3300020069 | Bacteria | 1103 |
| 71 | Ga0206356_11371313 | 3300020070 | Bacteria | 1453 |
| 72 | Ga0154015_1137610 | 3300020610 | Bacteria | 688 |
| 73 | Ga0154015_1427584 | 3300020610 | Bacteria | 697 |
| 74 | Ga0213873_10069630 | 3300021358 | Bacteria | 967 |
| 75 | Ga0213874_10000680 | 3300021377 | Bacteria | 6873 |
| 76 | Ga0213874_10143555 | 3300021377 | Bacteria | 828 |
| 77 | Ga0213874_10246681 | 3300021377 | Bacteria | 657 |
| 78 | Ga0213874_10371838 | 3300021377 | Bacteria | 551 |
| 79 | Ga0213876_10009973 | 3300021384 | Bacteria | 5104 |
| 80 | Ga0213876_10023598 | 3300021384 | Bacteria | 3249 |
| 81 | Ga0213876_10170663 | 3300021384 | Bacteria | 1157 |
| 82 | Ga0213876_10211691 | 3300021384 | Bacteria | 1030 |
| 83 | Ga0213875_10000148 | 3300021388 | Bacteria | 74125 |
| 84 | Ga0213875_10014084 | 3300021388 | Bacteria | 3910 |
| 85 | Ga0213875_10020923 | 3300021388 | Bacteria | 3137 |
| 86 | Ga0213875_10033100 | 3300021388 | Bacteria | 2441 |
| 87 | Ga0213875_10040177 | 3300021388 | Bacteria | 2203 |
| 88 | Ga0213875_10143271 | 3300021388 | Bacteria | 1119 |
| 89 | Ga0213875_10144988 | 3300021388 | Bacteria | 1112 |
| 90 | Ga0213875_10171548 | 3300021388 | Bacteria | 1018 |
| 91 | Ga0213875_10331057 | 3300021388 | Bacteria | 722 |
| 92 | Ga0224712_10046718 | 3300022467 | Bacteria | 1663 |
| 93 | Ga0224712_10220782 | 3300022467 | Bacteria | 867 |
| 94 | Ga0207685_10206811 | 3300025905 | Bacteria | 925 |
| 95 | Ga0207685_10258107 | 3300025905 | Bacteria | 846 |
| 96 | Ga0207699_10146848 | 3300025906 | Bacteria | 1556 |
| 97 | Ga0207699_10183139 | 3300025906 | Bacteria | 1409 |
| 98 | Ga0207699_10895378 | 3300025906 | Bacteria | 655 |
| 99 | Ga0207707_10021148 | 3300025912 | Bacteria | 5686 |
| 100 | Ga0207695_10257635 | 3300025913 | Bacteria | 1643 |
| 101 | Ga0207671_10126030 | 3300025914 | Bacteria | 1962 |
| 102 | Ga0207693_10097279 | 3300025915 | Bacteria | 2308 |
| 103 | Ga0207693_10118510 | 3300025915 | Bacteria | 2079 |
| 104 | Ga0207693_10213121 | 3300025915 | Bacteria | 1518 |
| 105 | Ga0207693_10269572 | 3300025915 | Bacteria | 1334 |
| 106 | Ga0207693_10677804 | 3300025915 | Bacteria | 800 |
| 107 | Ga0207693_10715125 | 3300025915 | Bacteria | 775 |
| 108 | Ga0207663_10209956 | 3300025916 | Bacteria | 1410 |
| 109 | Ga0207660_10177284 | 3300025917 | Bacteria | 1653 |
| 110 | Ga0207649_10105072 | 3300025920 | Bacteria | 1876 |
| 111 | Ga0207652_10280434 | 3300025921 | Bacteria | 1503 |
| 112 | Ga0207694_10044745 | 3300025924 | Bacteria | 3418 |
| 113 | Ga0207687_10434870 | 3300025927 | Bacteria | 1085 |
| 114 | Ga0207700_10253420 | 3300025928 | Bacteria | 1504 |
| 115 | Ga0207700_10707513 | 3300025928 | Bacteria | 899 |
| 116 | Ga0207664_10140912 | 3300025929 | Bacteria | 2040 |
| 117 | Ga0207664_10484740 | 3300025929 | Bacteria | 1106 |
| 118 | Ga0207664_10916284 | 3300025929 | Bacteria | 787 |
| 119 | Ga0207690_10081693 | 3300025932 | Bacteria | 2259 |
| 120 | Ga0207665_10089530 | 3300025939 | Bacteria | 2131 |
| 121 | Ga0207665_10217892 | 3300025939 | Bacteria | 1397 |
| 122 | Ga0207665_10365270 | 3300025939 | Bacteria | 1092 |
| 123 | Ga0207661_10849364 | 3300025944 | Bacteria | 840 |
| 124 | Ga0207661_11014423 | 3300025944 | Bacteria | 764 |
| 125 | Ga0207679_10381261 | 3300025945 | Bacteria | 1236 |
| 126 | Ga0207639_10241650 | 3300026041 | Bacteria | 1570 |
| 127 | Ga0207678_10441728 | 3300026067 | Bacteria | 1130 |
| 128 | Ga0207702_10146111 | 3300026078 | Bacteria | 2146 |
| 129 | Ga0373923_0190984 | 3300035111 | Bacteria | 944 |
| 130 | Ga0373953_0021152 | 3300035117 | Bacteria | 2438 |
| 131 | Ga0373954_0022104 | 3300035118 | Bacteria | 2884 |
| 132 | Ga0373957_0056611 | 3300035120 | Bacteria | 1510 |
| 133 | Ga0373946_0231209 | 3300035171 | Bacteria | 896 |
| 134 | Ga0373927_1095910 | 3300035695 | Bacteria | 525 |
| 135 | Ga0373937_0024988 | 3300036401 | Bacteria | 5391 |
| 136 | Ga0436364_0001421 | 3300037853 | Bacteria | 2945 |
| 137 | Ga0436364_0664989 | 3300037853 | Unclassified | 1130 |
| 138 | Ga0436364_0741465 | 3300037853 | Bacteria | 3397 |
| 139 | Ga0436364_0775197 | 3300037853 | Bacteria | 1972 |
| 140 | Ga0436364_0885771 | 3300037853 | Bacteria | 790 |
| 141 | Ga0436364_0944185 | 3300037853 | Bacteria | 785 |
| 142 | Ga0436364_1094382 | 3300037853 | Bacteria | 777 |
| 143 | Ga0436364_1122530 | 3300037853 | Bacteria | 16819 |
| 144 | Ga0436364_1438537 | 3300037853 | Bacteria | 5416 |
| 145 | Ga0436364_1483213 | 3300037853 | Bacteria | 11245 |
| 146 | Ga0436364_1552414 | 3300037853 | Bacteria | 2228 |
| 147 | Ga0436365_0403715 | 3300039437 | Bacteria | 17000 |
| 148 | Ga0436365_0483571 | 3300039437 | Bacteria | 877 |
| 149 | Ga0436365_0501508 | 3300039437 | Bacteria | 2970 |
| 150 | Ga0436365_0669080 | 3300039437 | Bacteria | 5688 |
| 151 | Ga0436365_0887965 | 3300039437 | Bacteria | 1175 |
| 152 | Ga0436365_1005270 | 3300039437 | Bacteria | 4382 |
| 153 | Ga0436365_1468086 | 3300039437 | Bacteria | 9438 |
| 154 | Ga0436365_1688357 | 3300039437 | Bacteria | 2235 |
| 155 | Ga0436365_1725409 | 3300039437 | Bacteria | 5697 |
| 156 | Ga0436365_1871140 | 3300039437 | Bacteria | 600 |
| 157 | Ga0436360_1232423 | 3300039438 | Bacteria | 1066 |
| 158 | Ga0436363_0301667 | 3300039450 | Bacteria | 3671 |
| 159 | Ga0436363_0335111 | 3300039450 | Bacteria | 1155 |
| 160 | Ga0436363_0386698 | 3300039450 | Bacteria | 5677 |
| 161 | Ga0436363_0483995 | 3300039450 | Bacteria | 633 |
| 162 | Ga0436363_0726841 | 3300039450 | Bacteria | 607 |
| 163 | Ga0436363_0844961 | 3300039450 | Bacteria | 2564 |
| 164 | Ga0436363_1064792 | 3300039450 | Bacteria | 6028 |
| 165 | Ga0436363_1400525 | 3300039450 | Bacteria | 18081 |
| 166 | Ga0436363_1450536 | 3300039450 | Bacteria | 2092 |
| 167 | Ga0436363_1495897 | 3300039450 | Bacteria | 690 |
| 168 | Ga0436363_1573316 | 3300039450 | Bacteria | 1520 |
| 169 | Ga0436363_1712442 | 3300039450 | Bacteria | 740 |
| 170 | Ga0436362_0083254 | 3300039453 | Bacteria | 511 |
| 171 | Ga0436362_0506834 | 3300039453 | Bacteria | 1469 |
| 172 | Ga0436362_0803075 | 3300039453 | Bacteria | 651 |
| 173 | Ga0436362_0839555 | 3300039453 | Bacteria | 713 |
| 174 | Ga0436362_0937777 | 3300039453 | Bacteria | 1359 |
| 175 | Ga0436362_1089259 | 3300039453 | Bacteria | 769 |
| 176 | Ga0436362_1244461 | 3300039453 | Bacteria | 858 |
| 177 | Ga0451793_0789644 | 3300041452 | Bacteria | 767 |
| 178 | Ga0451795_1078970 | 3300041456 | Bacteria | 569 |
| 179 | Ga0451802_0372975 | 3300041460 | Unclassified | 579 |
| 180 | Ga0466969_0020168 | 3300044656 | Bacteria | 3455 |
| 181 | Ga0466969_0034232 | 3300044656 | Bacteria | 2575 |
| 182 | Ga0466969_0546839 | 3300044656 | Bacteria | 530 |
| 183 | Ga0466966_0194248 | 3300044684 | Bacteria | 1229 |
| 184 | Ga0466966_0219164 | 3300044684 | Bacteria | 1149 |
| 185 | Ga0466961_0461199 | 3300044693 | Bacteria | 769 |
| 186 | Ga0466963_0015641 | 3300044694 | Bacteria | 4705 |
| 187 | Ga0466963_0237275 | 3300044694 | Bacteria | 1278 |
| 188 | Ga0466963_0611049 | 3300044694 | Bacteria | 770 |
| 189 | Ga0466963_0745479 | 3300044694 | Bacteria | 691 |
| 190 | Ga0466963_1261575 | 3300044694 | Bacteria | 519 |
| 191 | Ga0466964_0331572 | 3300044706 | Bacteria | 776 |
| 192 | Ga0466971_0120078 | 3300044719 | Bacteria | 1216 |
| 193 | Ga0466971_0503060 | 3300044719 | Bacteria | 598 |
| 194 | Ga0466968_0014440 | 3300044735 | Bacteria | 3122 |
| 195 | Ga0466968_0383461 | 3300044735 | Bacteria | 687 |
| 196 | Ga0466970_0174041 | 3300044765 | Bacteria | 1193 |
| 197 | Ga0466957_0156531 | 3300044842 | Bacteria | 1477 |
| 198 | Ga0466957_0328064 | 3300044842 | Bacteria | 1034 |
| 199 | Ga0466960_0707662 | 3300044901 | Bacteria | 605 |
| 200 | Ga0466959_0001464 | 3300045049 | Bacteria | 14467 |
| 201 | Ga0466959_0042236 | 3300045049 | Bacteria | 3363 |
| 202 | Ga0466959_0120495 | 3300045049 | Bacteria | 1866 |
| 203 | Ga0466959_0146812 | 3300045049 | Bacteria | 1664 |
| 204 | Ga0466959_0374727 | 3300045049 | Bacteria | 969 |
| 205 | Ga0466958_0044616 | 3300045836 | Bacteria | 2672 |
| 206 | Ga0466958_0059999 | 3300045836 | Bacteria | 2315 |
| 207 | Ga0466958_0143194 | 3300045836 | Bacteria | 1506 |
| 208 | Ga0466958_0234786 | 3300045836 | Bacteria | 1171 |
| 209 | Ga0466958_0342408 | 3300045836 | Bacteria | 962 |
| 210 | Ga0466958_0416191 | 3300045836 | Bacteria | 868 |
| 211 | Ga0466967_0260919 | 3300045976 | Bacteria | 1658 |
| 212 | Ga0466967_0445054 | 3300045976 | Bacteria | 1266 |
| 213 | Ga0466967_1370985 | 3300045976 | Bacteria | 704 |
| 214 | Ga0495651_0010955 | 3300046462 | Bacteria | 6975 |
| 215 | Ga0495651_0246352 | 3300046462 | Bacteria | 1223 |
| 216 | Ga0495653_0002266 | 3300046463 | Bacteria | 15228 |
| 217 | Ga0495653_0768279 | 3300046463 | Bacteria | 581 |
| 218 | Ga0495662_0437592 | 3300046476 | Bacteria | 642 |
| 219 | Ga0495664_0000073 | 3300046477 | Bacteria | 49243 |
| 220 | Ga0495608_0014976 | 3300046511 | Bacteria | 5381 |
| 221 | Ga0495608_0165171 | 3300046511 | Bacteria | 1406 |
| 222 | Ga0495608_0772215 | 3300046511 | Bacteria | 568 |
| 223 | Ga0495618_0027308 | 3300046514 | Bacteria | 3554 |
| 224 | Ga0495628_0526481 | 3300046516 | Bacteria | 851 |
| 225 | Ga0495628_0753946 | 3300046516 | Bacteria | 684 |
| 226 | Ga0495628_1152759 | 3300046516 | Bacteria | 528 |
| 227 | Ga0495630_0343486 | 3300046517 | Bacteria | 1142 |
| 228 | Ga0495652_0114495 | 3300046529 | Bacteria | 2163 |
| 229 | Ga0495652_0189567 | 3300046529 | Bacteria | 1570 |
| 230 | Ga0495652_0760061 | 3300046529 | Bacteria | 648 |
| 231 | Ga0495640_0151035 | 3300046533 | Bacteria | 1492 |
| 232 | Ga0495587_0010897 | 3300046536 | Bacteria | 5769 |
| 233 | Ga0495645_0000119 | 3300046543 | Bacteria | 53463 |
| 234 | Ga0495645_0354385 | 3300046543 | Bacteria | 945 |
| 235 | Ga0495667_0046512 | 3300046559 | Bacteria | 2869 |
| 236 | Ga0495667_0362622 | 3300046559 | Bacteria | 915 |
| 237 | Ga0495667_0740455 | 3300046559 | Bacteria | 608 |
| 238 | Ga0495634_0257281 | 3300046642 | Bacteria | 1066 |
| 239 | Ga0495635_0011412 | 3300046663 | Bacteria | 6232 |
| 240 | Ga0495635_0630047 | 3300046663 | Bacteria | 699 |
| 241 | Ga0495657_0010844 | 3300046675 | Bacteria | 6841 |
| 242 | Ga0495657_0126524 | 3300046675 | Bacteria | 1605 |
| 243 | Ga0495623_0281311 | 3300046679 | Bacteria | 925 |
| 244 | Ga0495646_0005125 | 3300046680 | Bacteria | 8266 |
| 245 | Ga0495589_0182507 | 3300046794 | Bacteria | 995 |
| 246 | Ga0495600_0135576 | 3300046809 | Bacteria | 1599 |
| 247 | Ga0495600_0220983 | 3300046809 | Bacteria | 1212 |
| 248 | Ga0495604_0223686 | 3300047317 | Bacteria | 1294 |
| 249 | Ga0495674_0015458 | 3300047319 | Bacteria | 7132 |
| 250 | Ga0495680_0003599 | 3300047322 | Bacteria | 15170 |
| 251 | Ga0495684_0011380 | 3300047471 | Bacteria | 6870 |
| 252 | Ga0495602_0013920 | 3300048088 | Bacteria | 8197 |
| 253 | Ga0496101_0591627 | 3300048904 | Bacteria | 877 |
| 254 | Ga0496102_0561812 | 3300048905 | Bacteria | 1064 |
| 255 | Ga0496103_0070931 | 3300048906 | Bacteria | 2180 |
| 256 | Ga0496104_0000006 | 3300048907 | Bacteria | 536446 |
| 257 | Ga0496109_0078754 | 3300048912 | Bacteria | 3035 |
| 258 | Ga0496109_0174927 | 3300048912 | Bacteria | 2015 |
| 259 | Ga0496109_1284001 | 3300048912 | Bacteria | 668 |
| 260 | Ga0496110_0000064 | 3300048913 | Bacteria | 52955 |
| 261 | Ga0496110_0455096 | 3300048913 | Bacteria | 1166 |
| 262 | Ga0496111_0000012 | 3300048914 | Bacteria | 83376 |
| 263 | Ga0496112_0036205 | 3300048915 | Bacteria | 4813 |
| 264 | Ga0496114_0536001 | 3300048917 | Bacteria | 1035 |
| 265 | Ga0496122_0285573 | 3300048925 | Bacteria | 899 |
| 266 | nmdc:mga0n895_336090_c1 | 3300050512 | Bacteria | 1530 |
| 267 | Ga0495601_0035823 | 3300053077 | Bacteria | 3099 |
| 268 | Ga0495595_0028675 | 3300053084 | Bacteria | 2487 |
| 269 | Ga0495619_0018953 | 3300053085 | Bacteria | 4370 |
| 270 | Ga0495619_0050931 | 3300053085 | Bacteria | 2735 |
| 271 | Ga0495619_0128647 | 3300053085 | Bacteria | 1740 |
| 272 | Ga0587073_0214533 | 3300059492 | Bacteria | 585 |
| 273 | Ga0587128_125946 | 3300059630 | Bacteria | 562 |
| 274 | Ga0587075_044035 | 3300059644 | Bacteria | 758 |
| 275 | Ga0466962_0418710 | 3300061719 | Bacteria | 672 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041452 | Ga0451793_0789644 | Ga0451793_0789644_299_589 | 94 |
| 2 | 3300005329 | Ga0070683_100680926 | Ga0070683_1006809262 | 118 |
| 3 | 3300005336 | Ga0070680_100109619 | Ga0070680_1001096193 | 118 |
| 4 | 3300005337 | Ga0070682_100095784 | Ga0070682_1000957842 | 118 |
| 5 | 3300005339 | Ga0070660_100069672 | Ga0070660_1000696723 | 118 |
| 6 | 3300005341 | Ga0070691_10028116 | Ga0070691_100281163 | 118 |
| 7 | 3300005344 | Ga0070661_100142565 | Ga0070661_1001425652 | 118 |
| 8 | 3300005366 | Ga0070659_100175212 | Ga0070659_1001752122 | 118 |
| 9 | 3300005434 | Ga0070709_10089705 | Ga0070709_100897052 | 118 |
| 10 | 3300005435 | Ga0070714_100094323 | Ga0070714_1000943234 | 118 |
| 11 | 3300005435 | Ga0070714_100144082 | Ga0070714_1001440822 | 118 |
| 12 | 3300005435 | Ga0070714_100198205 | Ga0070714_1001982052 | 118 |
| 13 | 3300005435 | Ga0070714_100686196 | Ga0070714_1006861961 | 118 |
| 14 | 3300005435 | Ga0070714_101381520 | Ga0070714_1013815201 | 118 |
| 15 | 3300005436 | Ga0070713_100201107 | Ga0070713_1002011073 | 118 |
| 16 | 3300005436 | Ga0070713_100554440 | Ga0070713_1005544402 | 118 |
| 17 | 3300005436 | Ga0070713_100584425 | Ga0070713_1005844252 | 118 |
| 18 | 3300005436 | Ga0070713_100892582 | Ga0070713_1008925822 | 118 |
| 19 | 3300005436 | Ga0070713_100973776 | Ga0070713_1009737762 | 118 |
| 20 | 3300005437 | Ga0070710_10292525 | Ga0070710_102925252 | 118 |
| 21 | 3300005437 | Ga0070710_10396719 | Ga0070710_103967191 | 118 |
| 22 | 3300005437 | Ga0070710_10426996 | Ga0070710_104269961 | 118 |
| 23 | 3300005439 | Ga0070711_100019980 | Ga0070711_1000199805 | 118 |
| 24 | 3300005439 | Ga0070711_100021243 | Ga0070711_1000212431 | 118 |
| 25 | 3300005439 | Ga0070711_100229326 | Ga0070711_1002293263 | 118 |
| 26 | 3300005439 | Ga0070711_101147758 | Ga0070711_1011477582 | 118 |
| 27 | 3300005455 | Ga0070663_101100544 | Ga0070663_1011005442 | 118 |
| 28 | 3300005458 | Ga0070681_11471251 | Ga0070681_114712511 | 118 |
| 29 | 3300005530 | Ga0070679_100074391 | Ga0070679_1000743915 | 118 |
| 30 | 3300005535 | Ga0070684_100016176 | Ga0070684_1000161763 | 118 |
| 31 | 3300005535 | Ga0070684_100353870 | Ga0070684_1003538702 | 118 |
| 32 | 3300005539 | Ga0068853_100263597 | Ga0068853_1002635972 | 118 |
| 33 | 3300005546 | Ga0070696_101221490 | Ga0070696_1012214901 | 118 |
| 34 | 3300005546 | Ga0070696_101417926 | Ga0070696_1014179261 | 118 |
| 35 | 3300005564 | Ga0070664_100941693 | Ga0070664_1009416932 | 118 |
| 36 | 3300005616 | Ga0068852_100181277 | Ga0068852_1001812772 | 118 |
| 37 | 3300006028 | Ga0070717_10025299 | Ga0070717_100252992 | 118 |
| 38 | 3300006028 | Ga0070717_10089317 | Ga0070717_100893174 | 118 |
| 39 | 3300006028 | Ga0070717_10159242 | Ga0070717_101592422 | 118 |
| 40 | 3300006028 | Ga0070717_10374839 | Ga0070717_103748392 | 118 |
| 41 | 3300006028 | Ga0070717_11580326 | Ga0070717_115803261 | 118 |
| 42 | 3300006028 | Ga0070717_12090852 | Ga0070717_120908521 | 118 |
| 43 | 3300006163 | Ga0070715_10057327 | Ga0070715_100573272 | 118 |
| 44 | 3300006163 | Ga0070715_10413415 | Ga0070715_104134152 | 118 |
| 45 | 3300006173 | Ga0070716_100678313 | Ga0070716_1006783132 | 118 |
| 46 | 3300006175 | Ga0070712_100002893 | Ga0070712_1000028937 | 118 |
| 47 | 3300006175 | Ga0070712_100140013 | Ga0070712_1001400134 | 118 |
| 48 | 3300006175 | Ga0070712_100409401 | Ga0070712_1004094012 | 118 |
| 49 | 3300006175 | Ga0070712_100779484 | Ga0070712_1007794842 | 118 |
| 50 | 3300006175 | Ga0070712_101772092 | Ga0070712_1017720922 | 118 |
| 51 | 3300006237 | Ga0097621_101199743 | Ga0097621_1011997432 | 118 |
| 52 | 3300006871 | Ga0075434_100356912 | Ga0075434_1003569121 | 118 |
| 53 | 3300007076 | Ga0075435_100345674 | Ga0075435_1003456742 | 118 |
| 54 | 3300009093 | Ga0105240_10030748 | Ga0105240_100307484 | 118 |
| 55 | 3300009093 | Ga0105240_10183174 | Ga0105240_101831743 | 118 |
| 56 | 3300009098 | Ga0105245_12840633 | Ga0105245_128406331 | 118 |
| 57 | 3300009545 | Ga0105237_10049423 | Ga0105237_100494232 | 118 |
| 58 | 3300009551 | Ga0105238_10105166 | Ga0105238_101051664 | 118 |
| 59 | 3300009551 | Ga0105238_11892346 | Ga0105238_118923461 | 118 |
| 60 | 3300010375 | Ga0105239_10412297 | Ga0105239_104122972 | 118 |
| 61 | 3300013100 | Ga0157373_11588024 | Ga0157373_115880242 | 118 |
| 62 | 3300013102 | Ga0157371_10399432 | Ga0157371_103994322 | 118 |
| 63 | 3300013104 | Ga0157370_10028654 | Ga0157370_100286543 | 118 |
| 64 | 3300013105 | Ga0157369_10032044 | Ga0157369_100320442 | 118 |
| 65 | 3300013297 | Ga0157378_10477190 | Ga0157378_104771901 | 118 |
| 66 | 3300013307 | Ga0157372_10084129 | Ga0157372_100841295 | 118 |
| 67 | 3300020069 | Ga0197907_10335616 | Ga0197907_103356163 | 118 |
| 68 | 3300020070 | Ga0206356_11371313 | Ga0206356_113713132 | 118 |
| 69 | 3300020610 | Ga0154015_1137610 | Ga0154015_11376101 | 118 |
| 70 | 3300020610 | Ga0154015_1427584 | Ga0154015_14275842 | 118 |
| 71 | 3300021358 | Ga0213873_10069630 | Ga0213873_100696302 | 118 |
| 72 | 3300021377 | Ga0213874_10000680 | Ga0213874_100006803 | 118 |
| 73 | 3300021377 | Ga0213874_10143555 | Ga0213874_101435551 | 118 |
| 74 | 3300021377 | Ga0213874_10246681 | Ga0213874_102466812 | 118 |
| 75 | 3300021377 | Ga0213874_10371838 | Ga0213874_103718381 | 118 |
| 76 | 3300021384 | Ga0213876_10009973 | Ga0213876_100099733 | 118 |
| 77 | 3300021384 | Ga0213876_10023598 | Ga0213876_100235985 | 118 |
| 78 | 3300021384 | Ga0213876_10170663 | Ga0213876_101706632 | 118 |
| 79 | 3300021384 | Ga0213876_10211691 | Ga0213876_102116912 | 118 |
| 80 | 3300021388 | Ga0213875_10014084 | Ga0213875_100140842 | 118 |
| 81 | 3300021388 | Ga0213875_10020923 | Ga0213875_100209232 | 118 |
| 82 | 3300021388 | Ga0213875_10033100 | Ga0213875_100331002 | 118 |
| 83 | 3300021388 | Ga0213875_10040177 | Ga0213875_100401772 | 118 |
| 84 | 3300021388 | Ga0213875_10143271 | Ga0213875_101432711 | 118 |
| 85 | 3300021388 | Ga0213875_10144988 | Ga0213875_101449881 | 118 |
| 86 | 3300021388 | Ga0213875_10171548 | Ga0213875_101715482 | 118 |
| 87 | 3300021388 | Ga0213875_10331057 | Ga0213875_103310572 | 118 |
| 88 | 3300022467 | Ga0224712_10046718 | Ga0224712_100467183 | 118 |
| 89 | 3300022467 | Ga0224712_10220782 | Ga0224712_102207822 | 118 |
| 90 | 3300025905 | Ga0207685_10206811 | Ga0207685_102068112 | 118 |
| 91 | 3300025905 | Ga0207685_10258107 | Ga0207685_102581072 | 118 |
| 92 | 3300025906 | Ga0207699_10146848 | Ga0207699_101468482 | 118 |
| 93 | 3300025906 | Ga0207699_10183139 | Ga0207699_101831392 | 118 |
| 94 | 3300025906 | Ga0207699_10895378 | Ga0207699_108953781 | 118 |
| 95 | 3300025912 | Ga0207707_10021148 | Ga0207707_100211483 | 118 |
| 96 | 3300025913 | Ga0207695_10257635 | Ga0207695_102576352 | 118 |
| 97 | 3300025914 | Ga0207671_10126030 | Ga0207671_101260302 | 118 |
| 98 | 3300025915 | Ga0207693_10097279 | Ga0207693_100972792 | 118 |
| 99 | 3300025915 | Ga0207693_10118510 | Ga0207693_101185101 | 118 |
| 100 | 3300025915 | Ga0207693_10213121 | Ga0207693_102131211 | 118 |
| 101 | 3300025915 | Ga0207693_10269572 | Ga0207693_102695722 | 118 |
| 102 | 3300025915 | Ga0207693_10677804 | Ga0207693_106778041 | 118 |
| 103 | 3300025915 | Ga0207693_10715125 | Ga0207693_107151251 | 118 |
| 104 | 3300025916 | Ga0207663_10209956 | Ga0207663_102099562 | 118 |
| 105 | 3300025917 | Ga0207660_10177284 | Ga0207660_101772842 | 118 |
| 106 | 3300025920 | Ga0207649_10105072 | Ga0207649_101050722 | 118 |
| 107 | 3300025921 | Ga0207652_10280434 | Ga0207652_102804341 | 118 |
| 108 | 3300025924 | Ga0207694_10044745 | Ga0207694_100447452 | 118 |
| 109 | 3300025927 | Ga0207687_10434870 | Ga0207687_104348702 | 118 |
| 110 | 3300025928 | Ga0207700_10253420 | Ga0207700_102534203 | 118 |
| 111 | 3300025928 | Ga0207700_10707513 | Ga0207700_107075132 | 118 |
| 112 | 3300025929 | Ga0207664_10140912 | Ga0207664_101409124 | 118 |
| 113 | 3300025929 | Ga0207664_10484740 | Ga0207664_104847402 | 118 |
| 114 | 3300025929 | Ga0207664_10916284 | Ga0207664_109162842 | 118 |
| 115 | 3300025932 | Ga0207690_10081693 | Ga0207690_100816934 | 118 |
| 116 | 3300025939 | Ga0207665_10089530 | Ga0207665_100895304 | 118 |
| 117 | 3300025939 | Ga0207665_10217892 | Ga0207665_102178923 | 118 |
| 118 | 3300025939 | Ga0207665_10365270 | Ga0207665_103652702 | 118 |
| 119 | 3300025944 | Ga0207661_10849364 | Ga0207661_108493642 | 118 |
| 120 | 3300025944 | Ga0207661_11014423 | Ga0207661_110144232 | 118 |
| 121 | 3300025945 | Ga0207679_10381261 | Ga0207679_103812612 | 118 |
| 122 | 3300026041 | Ga0207639_10241650 | Ga0207639_102416503 | 118 |
| 123 | 3300026067 | Ga0207678_10441728 | Ga0207678_104417282 | 118 |
| 124 | 3300026078 | Ga0207702_10146111 | Ga0207702_101461114 | 118 |
| 125 | 3300035111 | Ga0373923_0190984 | Ga0373923_0190984_293_649 | 118 |
| 126 | 3300035117 | Ga0373953_0021152 | Ga0373953_0021152_1070_1426 | 118 |
| 127 | 3300035118 | Ga0373954_0022104 | Ga0373954_0022104_26_382 | 118 |
| 128 | 3300035120 | Ga0373957_0056611 | Ga0373957_0056611_303_659 | 118 |
| 129 | 3300035171 | Ga0373946_0231209 | Ga0373946_0231209_103_459 | 118 |
| 130 | 3300035695 | Ga0373927_1095910 | Ga0373927_1095910_109_465 | 118 |
| 131 | 3300036401 | Ga0373937_0024988 | Ga0373937_0024988_4211_4567 | 118 |
| 132 | 3300037853 | Ga0436364_0001421 | Ga0436364_0001421_1350_1706 | 118 |
| 133 | 3300037853 | Ga0436364_0664989 | Ga0436364_0664989_10_366 | 118 |
| 134 | 3300037853 | Ga0436364_0741465 | Ga0436364_0741465_2201_2557 | 118 |
| 135 | 3300037853 | Ga0436364_0775197 | Ga0436364_0775197_1259_1615 | 118 |
| 136 | 3300037853 | Ga0436364_0885771 | Ga0436364_0885771_51_407 | 118 |
| 137 | 3300037853 | Ga0436364_0944185 | Ga0436364_0944185_313_669 | 118 |
| 138 | 3300037853 | Ga0436364_1094382 | Ga0436364_1094382_157_513 | 118 |
| 139 | 3300037853 | Ga0436364_1438537 | Ga0436364_1438537_582_938 | 118 |
| 140 | 3300037853 | Ga0436364_1483213 | Ga0436364_1483213_3658_4014 | 118 |
| 141 | 3300037853 | Ga0436364_1552414 | Ga0436364_1552414_1558_1914 | 118 |
| 142 | 3300039437 | Ga0436365_0403715 | Ga0436365_0403715_11194_11550 | 118 |
| 143 | 3300039437 | Ga0436365_0483571 | Ga0436365_0483571_174_530 | 118 |
| 144 | 3300039437 | Ga0436365_0501508 | Ga0436365_0501508_311_667 | 118 |
| 145 | 3300039437 | Ga0436365_0669080 | Ga0436365_0669080_3833_4189 | 118 |
| 146 | 3300039437 | Ga0436365_0887965 | Ga0436365_0887965_262_618 | 118 |
| 147 | 3300039437 | Ga0436365_1005270 | Ga0436365_1005270_384_740 | 118 |
| 148 | 3300039437 | Ga0436365_1468086 | Ga0436365_1468086_847_1203 | 118 |
| 149 | 3300039437 | Ga0436365_1688357 | Ga0436365_1688357_668_1024 | 118 |
| 150 | 3300039437 | Ga0436365_1725409 | Ga0436365_1725409_3182_3538 | 118 |
| 151 | 3300039437 | Ga0436365_1871140 | Ga0436365_1871140_139_495 | 118 |
| 152 | 3300039438 | Ga0436360_1232423 | Ga0436360_1232423_455_811 | 118 |
| 153 | 3300039450 | Ga0436363_0301667 | Ga0436363_0301667_2997_3353 | 118 |
| 154 | 3300039450 | Ga0436363_0335111 | Ga0436363_0335111_614_970 | 118 |
| 155 | 3300039450 | Ga0436363_0386698 | Ga0436363_0386698_2585_2941 | 118 |
| 156 | 3300039450 | Ga0436363_0483995 | Ga0436363_0483995_15_371 | 118 |
| 157 | 3300039450 | Ga0436363_0726841 | Ga0436363_0726841_41_397 | 118 |
| 158 | 3300039450 | Ga0436363_0844961 | Ga0436363_0844961_161_517 | 118 |
| 159 | 3300039450 | Ga0436363_1064792 | Ga0436363_1064792_1790_2146 | 118 |
| 160 | 3300039450 | Ga0436363_1400525 | Ga0436363_1400525_3116_3472 | 118 |
| 161 | 3300039450 | Ga0436363_1450536 | Ga0436363_1450536_1408_1764 | 118 |
| 162 | 3300039450 | Ga0436363_1573316 | Ga0436363_1573316_656_1012 | 118 |
| 163 | 3300039450 | Ga0436363_1712442 | Ga0436363_1712442_19_375 | 118 |
| 164 | 3300039453 | Ga0436362_0083254 | Ga0436362_0083254_20_376 | 118 |
| 165 | 3300039453 | Ga0436362_0506834 | Ga0436362_0506834_580_936 | 118 |
| 166 | 3300039453 | Ga0436362_0803075 | Ga0436362_0803075_47_403 | 118 |
| 167 | 3300039453 | Ga0436362_0839555 | Ga0436362_0839555_88_444 | 118 |
| 168 | 3300039453 | Ga0436362_0937777 | Ga0436362_0937777_625_981 | 118 |
| 169 | 3300039453 | Ga0436362_1089259 | Ga0436362_1089259_239_595 | 118 |
| 170 | 3300039453 | Ga0436362_1244461 | Ga0436362_1244461_377_739 | 118 |
| 171 | 3300041456 | Ga0451795_1078970 | Ga0451795_1078970_88_444 | 118 |
| 172 | 3300041460 | Ga0451802_0372975 | Ga0451802_0372975_142_498 | 118 |
| 173 | 3300044656 | Ga0466969_0020168 | Ga0466969_0020168_483_845 | 118 |
| 174 | 3300044656 | Ga0466969_0034232 | Ga0466969_0034232_358_717 | 118 |
| 175 | 3300044656 | Ga0466969_0546839 | Ga0466969_0546839_17_373 | 118 |
| 176 | 3300044684 | Ga0466966_0194248 | Ga0466966_0194248_403_759 | 118 |
| 177 | 3300044684 | Ga0466966_0219164 | Ga0466966_0219164_537_893 | 118 |
| 178 | 3300044693 | Ga0466961_0461199 | Ga0466961_0461199_227_583 | 118 |
| 179 | 3300044694 | Ga0466963_0237275 | Ga0466963_0237275_34_390 | 118 |
| 180 | 3300044694 | Ga0466963_0611049 | Ga0466963_0611049_112_468 | 118 |
| 181 | 3300044694 | Ga0466963_0745479 | Ga0466963_0745479_187_543 | 118 |
| 182 | 3300044694 | Ga0466963_1261575 | Ga0466963_1261575_134_490 | 118 |
| 183 | 3300044706 | Ga0466964_0331572 | Ga0466964_0331572_16_372 | 118 |
| 184 | 3300044719 | Ga0466971_0120078 | Ga0466971_0120078_819_1175 | 118 |
| 185 | 3300044719 | Ga0466971_0503060 | Ga0466971_0503060_33_389 | 118 |
| 186 | 3300044735 | Ga0466968_0383461 | Ga0466968_0383461_98_454 | 118 |
| 187 | 3300044765 | Ga0466970_0174041 | Ga0466970_0174041_344_700 | 118 |
| 188 | 3300044842 | Ga0466957_0156531 | Ga0466957_0156531_1072_1428 | 118 |
| 189 | 3300044842 | Ga0466957_0328064 | Ga0466957_0328064_68_424 | 118 |
| 190 | 3300044901 | Ga0466960_0707662 | Ga0466960_0707662_73_429 | 118 |
| 191 | 3300045049 | Ga0466959_0001464 | Ga0466959_0001464_7706_8068 | 118 |
| 192 | 3300045049 | Ga0466959_0042236 | Ga0466959_0042236_538_894 | 118 |
| 193 | 3300045049 | Ga0466959_0120495 | Ga0466959_0120495_791_1147 | 118 |
| 194 | 3300045049 | Ga0466959_0146812 | Ga0466959_0146812_333_692 | 118 |
| 195 | 3300045049 | Ga0466959_0374727 | Ga0466959_0374727_217_573 | 118 |
| 196 | 3300045836 | Ga0466958_0044616 | Ga0466958_0044616_132_488 | 118 |
| 197 | 3300045836 | Ga0466958_0059999 | Ga0466958_0059999_1098_1454 | 118 |
| 198 | 3300045836 | Ga0466958_0234786 | Ga0466958_0234786_556_912 | 118 |
| 199 | 3300045836 | Ga0466958_0342408 | Ga0466958_0342408_218_580 | 118 |
| 200 | 3300045836 | Ga0466958_0416191 | Ga0466958_0416191_377_733 | 118 |
| 201 | 3300045976 | Ga0466967_0260919 | Ga0466967_0260919_284_640 | 118 |
| 202 | 3300045976 | Ga0466967_0445054 | Ga0466967_0445054_455_811 | 118 |
| 203 | 3300045976 | Ga0466967_1370985 | Ga0466967_1370985_104_460 | 118 |
| 204 | 3300046462 | Ga0495651_0010955 | Ga0495651_0010955_4465_4821 | 118 |
| 205 | 3300046462 | Ga0495651_0246352 | Ga0495651_0246352_266_622 | 118 |
| 206 | 3300046463 | Ga0495653_0002266 | Ga0495653_0002266_14529_14885 | 118 |
| 207 | 3300046463 | Ga0495653_0768279 | Ga0495653_0768279_157_513 | 118 |
| 208 | 3300046476 | Ga0495662_0437592 | Ga0495662_0437592_173_529 | 118 |
| 209 | 3300046477 | Ga0495664_0000073 | Ga0495664_0000073_61_417 | 118 |
| 210 | 3300046511 | Ga0495608_0014976 | Ga0495608_0014976_320_676 | 118 |
| 211 | 3300046511 | Ga0495608_0165171 | Ga0495608_0165171_878_1234 | 118 |
| 212 | 3300046511 | Ga0495608_0772215 | Ga0495608_0772215_111_467 | 118 |
| 213 | 3300046514 | Ga0495618_0027308 | Ga0495618_0027308_1922_2278 | 118 |
| 214 | 3300046516 | Ga0495628_0526481 | Ga0495628_0526481_47_403 | 118 |
| 215 | 3300046516 | Ga0495628_0753946 | Ga0495628_0753946_284_640 | 118 |
| 216 | 3300046516 | Ga0495628_1152759 | Ga0495628_1152759_22_378 | 118 |
| 217 | 3300046517 | Ga0495630_0343486 | Ga0495630_0343486_405_761 | 118 |
| 218 | 3300046529 | Ga0495652_0114495 | Ga0495652_0114495_1635_1991 | 118 |
| 219 | 3300046529 | Ga0495652_0189567 | Ga0495652_0189567_1060_1416 | 118 |
| 220 | 3300046529 | Ga0495652_0760061 | Ga0495652_0760061_120_476 | 118 |
| 221 | 3300046533 | Ga0495640_0151035 | Ga0495640_0151035_429_785 | 118 |
| 222 | 3300046536 | Ga0495587_0010897 | Ga0495587_0010897_335_691 | 118 |
| 223 | 3300046543 | Ga0495645_0000119 | Ga0495645_0000119_49549_49905 | 118 |
| 224 | 3300046543 | Ga0495645_0354385 | Ga0495645_0354385_86_442 | 118 |
| 225 | 3300046559 | Ga0495667_0046512 | Ga0495667_0046512_1934_2290 | 118 |
| 226 | 3300046559 | Ga0495667_0362622 | Ga0495667_0362622_423_779 | 118 |
| 227 | 3300046559 | Ga0495667_0740455 | Ga0495667_0740455_73_429 | 118 |
| 228 | 3300046642 | Ga0495634_0257281 | Ga0495634_0257281_79_435 | 118 |
| 229 | 3300046663 | Ga0495635_0011412 | Ga0495635_0011412_2976_3332 | 118 |
| 230 | 3300046663 | Ga0495635_0630047 | Ga0495635_0630047_111_488 | 118 |
| 231 | 3300046675 | Ga0495657_0010844 | Ga0495657_0010844_5937_6293 | 118 |
| 232 | 3300046675 | Ga0495657_0126524 | Ga0495657_0126524_396_752 | 118 |
| 233 | 3300046679 | Ga0495623_0281311 | Ga0495623_0281311_324_680 | 118 |
| 234 | 3300046680 | Ga0495646_0005125 | Ga0495646_0005125_567_923 | 118 |
| 235 | 3300046809 | Ga0495600_0135576 | Ga0495600_0135576_292_648 | 118 |
| 236 | 3300046809 | Ga0495600_0220983 | Ga0495600_0220983_661_1017 | 118 |
| 237 | 3300047317 | Ga0495604_0223686 | Ga0495604_0223686_743_1099 | 118 |
| 238 | 3300047319 | Ga0495674_0015458 | Ga0495674_0015458_4556_4912 | 118 |
| 239 | 3300047322 | Ga0495680_0003599 | Ga0495680_0003599_9082_9438 | 118 |
| 240 | 3300047471 | Ga0495684_0011380 | Ga0495684_0011380_4012_4368 | 118 |
| 241 | 3300048088 | Ga0495602_0013920 | Ga0495602_0013920_7503_7859 | 118 |
| 242 | 3300048904 | Ga0496101_0591627 | Ga0496101_0591627_453_809 | 118 |
| 243 | 3300048905 | Ga0496102_0561812 | Ga0496102_0561812_696_1052 | 118 |
| 244 | 3300048906 | Ga0496103_0070931 | Ga0496103_0070931_447_803 | 118 |
| 245 | 3300048907 | Ga0496104_0000006 | Ga0496104_0000006_428261_428617 | 118 |
| 246 | 3300048912 | Ga0496109_0078754 | Ga0496109_0078754_2596_2952 | 118 |
| 247 | 3300048912 | Ga0496109_0174927 | Ga0496109_0174927_1603_1959 | 118 |
| 248 | 3300048912 | Ga0496109_1284001 | Ga0496109_1284001_46_402 | 118 |
| 249 | 3300048913 | Ga0496110_0000064 | Ga0496110_0000064_8432_8788 | 118 |
| 250 | 3300048913 | Ga0496110_0455096 | Ga0496110_0455096_346_702 | 118 |
| 251 | 3300048914 | Ga0496111_0000012 | Ga0496111_0000012_1613_1969 | 118 |
| 252 | 3300048915 | Ga0496112_0036205 | Ga0496112_0036205_857_1213 | 118 |
| 253 | 3300048917 | Ga0496114_0536001 | Ga0496114_0536001_608_964 | 118 |
| 254 | 3300048925 | Ga0496122_0285573 | Ga0496122_0285573_405_761 | 118 |
| 255 | 3300050512 | nmdc:mga0n895_336090_c1 | nmdc:mga0n895_336090_c1_1075_1431 | 118 |
| 256 | 3300053077 | Ga0495601_0035823 | Ga0495601_0035823_1299_1655 | 118 |
| 257 | 3300053084 | Ga0495595_0028675 | Ga0495595_0028675_224_580 | 118 |
| 258 | 3300053085 | Ga0495619_0018953 | Ga0495619_0018953_3601_3957 | 118 |
| 259 | 3300053085 | Ga0495619_0050931 | Ga0495619_0050931_839_1195 | 118 |
| 260 | 3300053085 | Ga0495619_0128647 | Ga0495619_0128647_1136_1492 | 118 |
| 261 | 3300059492 | Ga0587073_0214533 | Ga0587073_0214533_111_467 | 118 |
| 262 | 3300059644 | Ga0587075_044035 | Ga0587075_044035_355_711 | 118 |
| 263 | 3300061719 | Ga0466962_0418710 | Ga0466962_0418710_123_479 | 118 |
| 264 | 3300044735 | Ga0466968_0014440 | Ga0466968_0014440_1789_2148 | 119 |
| 265 | 3300003659 | JGI25404J52841_10127789 | JGI25404J52841_101277891 | 120 |
| 266 | 3300005329 | Ga0070683_100272868 | Ga0070683_1002728682 | 120 |
| 267 | 3300005434 | Ga0070709_10175567 | Ga0070709_101755671 | 120 |
| 268 | 3300005435 | Ga0070714_100181251 | Ga0070714_1001812512 | 120 |
| 269 | 3300021388 | Ga0213875_10000148 | Ga0213875_1000014866 | 120 |
| 270 | 3300037853 | Ga0436364_1122530 | Ga0436364_1122530_4643_5005 | 120 |
| 271 | 3300039450 | Ga0436363_1495897 | Ga0436363_1495897_125_487 | 120 |
| 272 | 3300044694 | Ga0466963_0015641 | Ga0466963_0015641_3836_4198 | 120 |
| 273 | 3300045836 | Ga0466958_0143194 | Ga0466958_0143194_1123_1485 | 120 |
| 274 | 3300046794 | Ga0495589_0182507 | Ga0495589_0182507_183_545 | 120 |
| 275 | 3300059630 | Ga0587128_125946 | Ga0587128_125946_148_510 | 120 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar