F380393

General Info

Members Datasets Scaffolds Average Seq Length
275 117 550 423

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10002813|Ga0114129_1000281311
Length 483
Sequence LNIAAFLSLEVYDTSVSPGLLQWQAWCQTGFRAKCGVSRACRAIRLRRAAAARPTRWCVRYHVPRMRSRLLNVPYGAWHAREVPAPDPLLTRTDPGTPCGEYLRRFWQPVAFARDLGDVPRRIRIMGEDLVVFRDRSGRAGLLQLHCTHRGTSLEFGIPQERGIRCCYHGWVFDVDGRILETPGEPAESTLRHRLCQGAYPTLEFCGLVFAYMGPPDARPPFPTYDTFAVPGLELHPAAQFMLPCNWLQVKDNAMDPVHTSFLHAISSGYHFTEAFGALAELEWQETPYGMIYIATRRVGDFVWVRICDFMAPNVHQFTREIEEAAAERIASRPVVIRWAVPVDDTRTLNFELAQADPAWGLTPEEIARPGFGQSADRPYEERQRHPGDYDAQSSQRTIAVHDLEHLASTDRGVVMLRKIVRDGIRAVEAGETPCGIGFKPGETITTHCQDTVLRLPAASEADERAVLRQIGRRVVAGDYRRP

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
51 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
72 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
75 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
76 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
77 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
78 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
79 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
85 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
86 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
87 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
88 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
89 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
90 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
91 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
92 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
93 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
97 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
98 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
99 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
100 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
101 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
102 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
103 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
104 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
105 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
106 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
107 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
108 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
109 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
110 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
111 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
112 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
113 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
114 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
115 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
117 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.27
Metatranscriptomes 0.73
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.73
Nodule 0
Rhizoplane 0.73
Rhizosphere 95.27
Stem 0
Stem Tuber 0
Unclassified 1.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10002813 3300009147 Bacteria 24271
2 JGI25406J46586_10006346 3300003203 Bacteria 5455
3 Ga0070690_100026198 3300005330 Bacteria 3595
4 Ga0070689_100017596 3300005340 Bacteria 5253
5 Ga0070669_100040563 3300005353 Bacteria 3384
6 Ga0070671_100269643 3300005355 Bacteria 1447
7 Ga0070714_100036812 3300005435 Bacteria 4107
8 Ga0070714_100043204 3300005435 Bacteria 3810
9 Ga0070713_100015987 3300005436 Bacteria 5632
10 Ga0070701_10089184 3300005438 Bacteria 1686
11 Ga0070711_100025659 3300005439 Bacteria 3857
12 Ga0070705_100041664 3300005440 Bacteria 2620
13 Ga0070708_100010481 3300005445 Bacteria 7514
14 Ga0070708_100022841 3300005445 Bacteria 5311
15 Ga0070708_100060055 3300005445 Plasmid 3392
16 Ga0070706_100007943 3300005467 Bacteria 9906
17 Ga0070706_100045454 3300005467 Bacteria 4056
18 Ga0070706_100059136 3300005467 Bacteria 3537
19 Ga0070707_100002180 3300005468 Bacteria 18721
20 Ga0070707_100064595 3300005468 Bacteria 3514
21 Ga0070698_100004229 3300005471 Bacteria 15783
22 Ga0070698_100096707 3300005471 Bacteria 2929
23 Ga0070699_100057287 3300005518 Bacteria 3375
24 Ga0070699_100097082 3300005518 Bacteria 2581
25 Ga0070699_100160296 3300005518 Bacteria 1991
26 Ga0070697_100007709 3300005536 Bacteria 8386
27 Ga0070697_100031381 3300005536 Bacteria 4274
28 Ga0070697_100052669 3300005536 Bacteria 3307
29 Ga0070697_100177561 3300005536 Bacteria 1804
30 Ga0070696_100112559 3300005546 Bacteria 1961
31 Ga0068856_100109677 3300005614 Bacteria 2756
32 Ga0068856_100219820 3300005614 Bacteria 1915
33 Ga0068859_100043176 3300005617 Bacteria 4531
34 Ga0068861_100170729 3300005719 Bacteria 1802
35 Ga0068863_100045044 3300005841 Bacteria 4186
36 Ga0068860_100022628 3300005843 Bacteria 6077
37 Ga0068860_100077992 3300005843 Bacteria 3151
38 Ga0081455_10012003 3300005937 Bacteria 8669
39 Ga0081455_10012419 3300005937 Bacteria 8498
40 Ga0081455_10177668 3300005937 Bacteria 1615
41 Ga0081538_10011148 3300005981 Bacteria 7304
42 Ga0081538_10038947 3300005981 Bacteria 3056
43 Ga0081538_10055521 3300005981 Bacteria 2331
44 Ga0081540_1009772 3300005983 Bacteria 6568
45 Ga0081539_10000020 3300005985 Bacteria 366549
46 Ga0081539_10028388 3300005985 Bacteria 3520
47 Ga0081539_10034237 3300005985 Bacteria 3076
48 Ga0075432_10020741 3300006058 Bacteria 2247
49 Ga0070712_100088683 3300006175 Bacteria 2261
50 Ga0070712_100096301 3300006175 Bacteria 2179
51 Ga0070712_100218755 3300006175 Bacteria 1506
52 Ga0075369_10035055 3300006186 Bacteria 2132
53 Ga0075428_100001496 3300006844 Bacteria 24994
54 Ga0075428_100003042 3300006844 Bacteria 18310
55 Ga0075428_100050828 3300006844 Bacteria 4545
56 Ga0075428_100301126 3300006844 Bacteria 1724
57 Ga0075430_100000597 3300006846 Bacteria 27474
58 Ga0075430_100010824 3300006846 Bacteria 7727
59 Ga0075430_100011501 3300006846 Bacteria 7520
60 Ga0075430_100046754 3300006846 Bacteria 3655
61 Ga0075430_100180459 3300006846 Bacteria 1756
62 Ga0075431_100000115 3300006847 Bacteria 51366
63 Ga0075431_100005160 3300006847 Bacteria 12857
64 Ga0075431_100007139 3300006847 Bacteria 11100
65 Ga0075431_100034028 3300006847 Bacteria 5251
66 Ga0075431_100040228 3300006847 Bacteria 4817
67 Ga0075431_100146230 3300006847 Bacteria 2436
68 Ga0075433_10000225 3300006852 Bacteria 32311
69 Ga0075433_10000948 3300006852 Bacteria 20482
70 Ga0075433_10149848 3300006852 Bacteria 2075
71 Ga0075434_100002399 3300006871 Bacteria 16443
72 Ga0075434_100017584 3300006871 Bacteria 6892
73 Ga0075434_100053359 3300006871 Bacteria 4017
74 Ga0075434_100074166 3300006871 Bacteria 3396
75 Ga0075434_100076836 3300006871 Bacteria 3334
76 Ga0075434_100086134 3300006871 Bacteria 3141
77 Ga0075434_100143433 3300006871 Bacteria 2409
78 Ga0075434_100278881 3300006871 Bacteria 1691
79 Ga0075429_100000439 3300006880 Bacteria 30919
80 Ga0075429_100006697 3300006880 Bacteria 9989
81 Ga0075429_100012903 3300006880 Bacteria 7250
82 Ga0075429_100019850 3300006880 Bacteria 5827
83 Ga0075429_100038765 3300006880 Bacteria 4148
84 Ga0075429_100047069 3300006880 Bacteria 3752
85 Ga0075429_100145209 3300006880 Bacteria 2077
86 Ga0075436_100001023 3300006914 Bacteria 18812
87 Ga0075436_100012768 3300006914 Bacteria 5759
88 Ga0075436_100149914 3300006914 Bacteria 1641
89 Ga0097620_100043174 3300006931 Bacteria 4531
90 Ga0075435_100000033 3300007076 Bacteria 70531
91 Ga0075435_100002040 3300007076 Bacteria 13228
92 Ga0075435_100023030 3300007076 Bacteria 4810
93 Ga0075435_100029683 3300007076 Bacteria 4294
94 Ga0075435_100094177 3300007076 Bacteria 2475
95 Ga0099794_10023068 3300007265 Bacteria 2843
96 Ga0099794_10026610 3300007265 Bacteria 2676
97 Ga0111539_10003740 3300009094 Bacteria 20021
98 Ga0111539_10006420 3300009094 Bacteria 15161
99 Ga0111539_10025582 3300009094 Bacteria 7234
100 Ga0111539_10035006 3300009094 Bacteria 6081
101 Ga0114129_10000541 3300009147 Bacteria 46363
102 Ga0114129_10000579 3300009147 Bacteria 45143
103 Ga0114129_10006426 3300009147 Bacteria 16667
104 Ga0114129_10007717 3300009147 Bacteria 15305
105 Ga0114129_10010980 3300009147 Bacteria 12903
106 Ga0114129_10011170 3300009147 Bacteria 12801
107 Ga0114129_10063840 3300009147 Bacteria 5140
108 Ga0114129_10106382 3300009147 Bacteria 3875
109 Ga0114129_10136415 3300009147 Bacteria 3367
110 Ga0114129_10175848 3300009147 Bacteria 2916
111 Ga0114129_10211319 3300009147 Unclassified 2623
112 Ga0114129_10666153 3300009147 Bacteria 1341
113 Ga0105242_10165291 3300009176 Bacteria 1941
114 Ga0105248_10060280 3300009177 Bacteria 4260
115 Ga0105248_10331921 3300009177 Bacteria 1713
116 Ga0105249_10021275 3300009553 Bacteria 5807
117 Ga0105249_10316802 3300009553 Bacteria 1570
118 Ga0099796_10025706 3300010159 Bacteria 1862
119 Ga0099796_10040241 3300010159 Bacteria 1577
120 Ga0163162_10036103 3300013306 Bacteria 4925
121 Ga0157372_10073680 3300013307 Bacteria 3849
122 Ga0163163_10025422 3300014325 Bacteria 5644
123 Ga0182008_10025277 3300014497 Bacteria 3016
124 Ga0213875_10000498 3300021388 Bacteria 32954
125 Ga0213875_10003388 3300021388 Bacteria 9079
126 Ga0213875_10005961 3300021388 Bacteria 6463
127 Ga0224712_10005382 3300022467 Unclassified 3558
128 Ga0207699_10133721 3300025906 Bacteria 1621
129 Ga0207684_10001301 3300025910 Bacteria 27465
130 Ga0207684_10005198 3300025910 Bacteria 12104
131 Ga0207684_10029541 3300025910 Bacteria 4667
132 Ga0207684_10156120 3300025910 Bacteria 1964
133 Ga0207693_10004110 3300025915 Bacteria 12364
134 Ga0207693_10027641 3300025915 Bacteria 4484
135 Ga0207693_10100377 3300025915 Bacteria 2269
136 Ga0207693_10244980 3300025915 Bacteria 1407
137 Ga0207646_10001330 3300025922 Bacteria 30700
138 Ga0207646_10041744 3300025922 Bacteria 4122
139 Ga0207681_10040408 3300025923 Bacteria 3104
140 Ga0207681_10123258 3300025923 Bacteria 1904
141 Ga0207700_10021664 3300025928 Bacteria 4393
142 Ga0207700_10030270 3300025928 Bacteria 3831
143 Ga0207700_10056942 3300025928 Bacteria 2945
144 Ga0207644_10089025 3300025931 Bacteria 2297
145 Ga0207709_10113472 3300025935 Bacteria 1816
146 Ga0207670_10016476 3300025936 Bacteria 4442
147 Ga0207704_10043953 3300025938 Bacteria 2643
148 Ga0207691_10084817 3300025940 Bacteria 2843
149 Ga0207639_10024990 3300026041 Bacteria 4329
150 Ga0207702_10084148 3300026078 Bacteria 2769
151 Ga0207641_10096946 3300026088 Bacteria 2591
152 Ga0207648_10150286 3300026089 Bacteria 2055
153 Ga0207674_10111853 3300026116 Bacteria 2705
154 Ga0207675_100031091 3300026118 Bacteria 4971
155 Ga0207428_10000018 3300027907 Bacteria 293117
156 Ga0207428_10035107 3300027907 Bacteria 4101
157 Ga0207428_10046074 3300027907 Bacteria 3508
158 Ga0207428_10138557 3300027907 Bacteria 1859
159 Ga0268265_10035126 3300028380 Bacteria 3659
160 Ga0265338_10054235 3300028800 Bacteria 3577
161 Ga0307408_100026895 3300031548 Bacteria 3958
162 Ga0307416_100017576 3300032002 Bacteria 5009
163 Ga0373949_0017928 3300035090 Bacteria 1600
164 Ga0373954_0018214 3300035118 Bacteria 3159
165 Ga0373931_0046554 3300035691 Bacteria 2293
166 Ga0373935_0004469 3300035692 Bacteria 8211
167 Ga0373927_0053895 3300035695 Bacteria 2602
168 Ga0373947_0025585 3300035725 Bacteria 3443
169 Ga0373925_0052518 3300037068 Bacteria 3045
170 Ga0373925_0187677 3300037068 Bacteria 1639
171 Ga0395900_0106376 3300037418 Bacteria 2882
172 Ga0436364_0647679 3300037853 Bacteria 14855
173 Ga0436364_0648956 3300037853 Bacteria 5907
174 Ga0436364_0726974 3300037853 Bacteria 13796
175 Ga0436364_0969418 3300037853 Bacteria 2173
176 Ga0436365_1773876 3300039437 Bacteria 5070
177 Ga0436360_0363624 3300039438 Bacteria 3396
178 Ga0436360_0985437 3300039438 Bacteria 1740
179 Ga0436360_1151815 3300039438 Bacteria 1895
180 Ga0436360_1236006 3300039438 Bacteria 3284
181 Ga0436363_0176310 3300039450 Bacteria 7005
182 Ga0436362_1237578 3300039453 Bacteria 7161
183 Ga0451576_0168634 3300045051 Bacteria 2285
184 Ga0451576_0251029 3300045051 Bacteria 1849
185 Ga0451576_0309509 3300045051 Bacteria 1652
186 Ga0495580_0022363 3300046472 Bacteria 4653
187 Ga0495642_0030071 3300046528 Bacteria 2172
188 Ga0495586_0021434 3300046535 Bacteria 3445
189 Ga0496104_0062859 3300048907 Bacteria 3521
190 Ga0496112_0017529 3300048915 Bacteria 6730
191 Ga0501031_0081053 3300049568 Bacteria 2116
192 Ga0501041_0046734 3300049577 Bacteria 2634
193 Ga0501043_0248190 3300049579 Bacteria 1372
194 Ga0501067_0014818 3300049583 Bacteria 4314
195 Ga0501071_0035566 3300049587 Bacteria 3548
196 Ga0501072_0055036 3300049588 Bacteria 3136
197 Ga0501072_0067302 3300049588 Bacteria 2826
198 Ga0501075_0098164 3300049591 Bacteria 2224
199 Ga0501075_0211131 3300049591 Unclassified 1481
200 Ga0501076_0006975 3300049592 Bacteria 8213
201 Ga0501076_0123954 3300049592 Bacteria 2093
202 Ga0501077_0055869 3300049593 Bacteria 2506
203 Ga0501080_0053688 3300049742 Bacteria 3753
204 Ga0501081_0028121 3300049743 Bacteria 3793
205 Ga0501081_0145347 3300049743 Bacteria 1701
206 nmdc:mga05p37_133622_c1 3300050507 Bacteria 3044
207 nmdc:mga05p37_15276_c1 3300050507 Bacteria 9223
208 nmdc:mga05p37_242640_c1 3300050507 Bacteria 2165
209 nmdc:mga05p37_256371_c1 3300050507 Bacteria 2096
210 nmdc:mga05p37_263824_c1 3300050507 Bacteria 2060
211 nmdc:mga05p37_26787_c1 3300050507 Bacteria 7011
212 nmdc:mga05p37_3894_c1 3300050507 Bacteria 17461
213 nmdc:mga05p37_4306_c1 3300050507 Bacteria 16620
214 nmdc:mga05p37_43501_c1 3300050507 Bacteria 5526
215 nmdc:mga05p37_6228_c1 3300050507 Bacteria 14045
216 nmdc:mga05p37_6330_c1 3300050507 Bacteria 13945
217 nmdc:mga05p37_650_c1 3300050507 Bacteria 38420
218 nmdc:mga05p37_702_c1 3300050507 Bacteria 37071
219 nmdc:mga05p37_79078_c1 3300050507 Bacteria 4050
220 nmdc:mga05p37_96435_c1 3300050507 Bacteria 3644
221 nmdc:mga09592_20882_c1 3300050508 Bacteria 5392
222 nmdc:mga09592_213_c1 3300050508 Bacteria 41780
223 nmdc:mga09592_5248_c1 3300050508 Bacteria 10523
224 nmdc:mga09592_64552_c1 3300050508 Bacteria 3100
225 nmdc:mga0qj67_13269_c1 3300050509 Bacteria 6217
226 nmdc:mga0qj67_1580_c1 3300050509 Bacteria 16011
227 nmdc:mga0qj67_23116_c1 3300050509 Bacteria 4780
228 nmdc:mga0qj67_311_c1 3300050509 Bacteria 33699
229 nmdc:mga0qj67_62267_c1 3300050509 Bacteria 2965
230 nmdc:mga06r32_182476_c1 3300050510 Unclassified 2085
231 nmdc:mga06r32_2237_c1 3300050510 Bacteria 17323
232 nmdc:mga06r32_2324_c1 3300050510 Bacteria 17027
233 nmdc:mga06r32_24814_c1 3300050510 Bacteria 5572
234 nmdc:mga06r32_63653_c1 3300050510 Bacteria 3556
235 nmdc:mga08y16_124359_c1 3300050511 Bacteria 2683
236 nmdc:mga08y16_138_c1 3300050511 Bacteria 63184
237 nmdc:mga08y16_164868_c1 3300050511 Bacteria 2302
238 nmdc:mga08y16_2413_c1 3300050511 Bacteria 19203
239 nmdc:mga08y16_303906_c1 3300050511 Bacteria 1644
240 nmdc:mga08y16_55875_c1 3300050511 Bacteria 4125
241 nmdc:mga08y16_9084_c1 3300050511 Bacteria 10435
242 nmdc:mga0n895_113551_c1 3300050512 Bacteria 2727
243 nmdc:mga0n895_123809_c1 3300050512 Bacteria 2608
244 nmdc:mga0n895_165699_c1 3300050512 Bacteria 2242
245 nmdc:mga0n895_1678_c1 3300050512 Bacteria 16725
246 nmdc:mga0n895_186_c1 3300050512 Bacteria 38327
247 nmdc:mga0n895_274766_c1 3300050512 Bacteria 1709
248 nmdc:mga0n895_284526_c1 3300050512 Bacteria 1676
249 nmdc:mga0n895_44501_c1 3300050512 Bacteria 4329
250 nmdc:mga0n895_6463_c1 3300050512 Bacteria 9955
251 nmdc:mga0n895_83425_c1 3300050512 Bacteria 3187
252 nmdc:mga0rr50_101410_c1 3300050513 Bacteria 2263
253 nmdc:mga0rr50_16530_c1 3300050513 Bacteria 4905
254 nmdc:mga0rr50_2655_c1 3300050513 Bacteria 10130
255 nmdc:mga0rr50_27001_c1 3300050513 Bacteria 4015
256 nmdc:mga0rr50_446_c1 3300050513 Bacteria 22057
257 nmdc:mga0rr50_44797_c1 3300050513 Bacteria 3247
258 nmdc:mga0rr50_6341_c1 3300050513 Bacteria 7191
259 nmdc:mga08x19_22697_c1 3300050514 Bacteria 3887
260 nmdc:mga08x19_2893_c1 3300050514 Bacteria 10332
261 nmdc:mga08x19_29576_c1 3300050514 Bacteria 3436
262 nmdc:mga0a205_132713_c1 3300050515 Bacteria 2391
263 nmdc:mga0a205_1371_c1 3300050515 Bacteria 20576
264 nmdc:mga0a205_32679_c1 3300050515 Bacteria 4988
265 nmdc:mga0a205_33630_c1 3300050515 Bacteria 4916
266 nmdc:mga0a205_66237_c1 3300050515 Bacteria 3490
267 nmdc:mga0a205_884_c1 3300050515 Bacteria 24576
268 nmdc:mga0a205_99781_c1 3300050515 Bacteria 1987
269 nmdc:mga0sz30_35816_c1 3300050516 Bacteria 1719
270 Ga0501084_0007522 3300054114 Bacteria 8981
271 Ga0587079_008615 3300059647 Bacteria 1565
272 Ga0501082_0019522 3300060353 Bacteria 5844
273 Ga0501082_0219075 3300060353 Bacteria 1656
274 Ga0530510_0018572 3300061734 Bacteria 4930
275 Ga0530510_0026883 3300061734 Bacteria 4122
276 Ga0114129_10002813
277 JGI25406J46586_10006346
278 Ga0070690_100026198
279 Ga0070689_100017596
280 Ga0070669_100040563
281 Ga0070671_100269643
282 Ga0070714_100036812
283 Ga0070714_100043204
284 Ga0070713_100015987
285 Ga0070701_10089184
286 Ga0070711_100025659
287 Ga0070705_100041664
288 Ga0070708_100010481
289 Ga0070708_100022841
290 Ga0070708_100060055
291 Ga0070706_100007943
292 Ga0070706_100045454
293 Ga0070706_100059136
294 Ga0070707_100002180
295 Ga0070707_100064595
296 Ga0070698_100004229
297 Ga0070698_100096707
298 Ga0070699_100057287
299 Ga0070699_100097082
300 Ga0070699_100160296
301 Ga0070697_100007709
302 Ga0070697_100031381
303 Ga0070697_100052669
304 Ga0070697_100177561
305 Ga0070696_100112559
306 Ga0068856_100109677
307 Ga0068856_100219820
308 Ga0068859_100043176
309 Ga0068861_100170729
310 Ga0068863_100045044
311 Ga0068860_100022628
312 Ga0068860_100077992
313 Ga0081455_10012003
314 Ga0081455_10012419
315 Ga0081455_10177668
316 Ga0081538_10011148
317 Ga0081538_10038947
318 Ga0081538_10055521
319 Ga0081540_1009772
320 Ga0081539_10000020
321 Ga0081539_10028388
322 Ga0081539_10034237
323 Ga0075432_10020741
324 Ga0070712_100088683
325 Ga0070712_100096301
326 Ga0070712_100218755
327 Ga0075369_10035055
328 Ga0075428_100001496
329 Ga0075428_100003042
330 Ga0075428_100050828
331 Ga0075428_100301126
332 Ga0075430_100000597
333 Ga0075430_100010824
334 Ga0075430_100011501
335 Ga0075430_100046754
336 Ga0075430_100180459
337 Ga0075431_100000115
338 Ga0075431_100005160
339 Ga0075431_100007139
340 Ga0075431_100034028
341 Ga0075431_100040228
342 Ga0075431_100146230
343 Ga0075433_10000225
344 Ga0075433_10000948
345 Ga0075433_10149848
346 Ga0075434_100002399
347 Ga0075434_100017584
348 Ga0075434_100053359
349 Ga0075434_100074166
350 Ga0075434_100076836
351 Ga0075434_100086134
352 Ga0075434_100143433
353 Ga0075434_100278881
354 Ga0075429_100000439
355 Ga0075429_100006697
356 Ga0075429_100012903
357 Ga0075429_100019850
358 Ga0075429_100038765
359 Ga0075429_100047069
360 Ga0075429_100145209
361 Ga0075436_100001023
362 Ga0075436_100012768
363 Ga0075436_100149914
364 Ga0097620_100043174
365 Ga0075435_100000033
366 Ga0075435_100002040
367 Ga0075435_100023030
368 Ga0075435_100029683
369 Ga0075435_100094177
370 Ga0099794_10023068
371 Ga0099794_10026610
372 Ga0111539_10003740
373 Ga0111539_10006420
374 Ga0111539_10025582
375 Ga0111539_10035006
376 Ga0114129_10000541
377 Ga0114129_10000579
378 Ga0114129_10006426
379 Ga0114129_10007717
380 Ga0114129_10010980
381 Ga0114129_10011170
382 Ga0114129_10063840
383 Ga0114129_10106382
384 Ga0114129_10136415
385 Ga0114129_10175848
386 Ga0114129_10211319
387 Ga0114129_10666153
388 Ga0105242_10165291
389 Ga0105248_10060280
390 Ga0105248_10331921
391 Ga0105249_10021275
392 Ga0105249_10316802
393 Ga0099796_10025706
394 Ga0099796_10040241
395 Ga0163162_10036103
396 Ga0157372_10073680
397 Ga0163163_10025422
398 Ga0182008_10025277
399 Ga0213875_10000498
400 Ga0213875_10003388
401 Ga0213875_10005961
402 Ga0224712_10005382
403 Ga0207699_10133721
404 Ga0207684_10001301
405 Ga0207684_10005198
406 Ga0207684_10029541
407 Ga0207684_10156120
408 Ga0207693_10004110
409 Ga0207693_10027641
410 Ga0207693_10100377
411 Ga0207693_10244980
412 Ga0207646_10001330
413 Ga0207646_10041744
414 Ga0207681_10040408
415 Ga0207681_10123258
416 Ga0207700_10021664
417 Ga0207700_10030270
418 Ga0207700_10056942
419 Ga0207644_10089025
420 Ga0207709_10113472
421 Ga0207670_10016476
422 Ga0207704_10043953
423 Ga0207691_10084817
424 Ga0207639_10024990
425 Ga0207702_10084148
426 Ga0207641_10096946
427 Ga0207648_10150286
428 Ga0207674_10111853
429 Ga0207675_100031091
430 Ga0207428_10000018
431 Ga0207428_10035107
432 Ga0207428_10046074
433 Ga0207428_10138557
434 Ga0268265_10035126
435 Ga0265338_10054235
436 Ga0307408_100026895
437 Ga0307416_100017576
438 Ga0373949_0017928
439 Ga0373954_0018214
440 Ga0373931_0046554
441 Ga0373935_0004469
442 Ga0373927_0053895
443 Ga0373947_0025585
444 Ga0373925_0052518
445 Ga0373925_0187677
446 Ga0395900_0106376
447 Ga0436364_0647679
448 Ga0436364_0648956
449 Ga0436364_0726974
450 Ga0436364_0969418
451 Ga0436365_1773876
452 Ga0436360_0363624
453 Ga0436360_0985437
454 Ga0436360_1151815
455 Ga0436360_1236006
456 Ga0436363_0176310
457 Ga0436362_1237578
458 Ga0451576_0168634
459 Ga0451576_0251029
460 Ga0451576_0309509
461 Ga0495580_0022363
462 Ga0495642_0030071
463 Ga0495586_0021434
464 Ga0496104_0062859
465 Ga0496112_0017529
466 Ga0501031_0081053
467 Ga0501041_0046734
468 Ga0501043_0248190
469 Ga0501067_0014818
470 Ga0501071_0035566
471 Ga0501072_0055036
472 Ga0501072_0067302
473 Ga0501075_0098164
474 Ga0501075_0211131
475 Ga0501076_0006975
476 Ga0501076_0123954
477 Ga0501077_0055869
478 Ga0501080_0053688
479 Ga0501081_0028121
480 Ga0501081_0145347
481 nmdc:mga05p37_133622_c1
482 nmdc:mga05p37_15276_c1
483 nmdc:mga05p37_242640_c1
484 nmdc:mga05p37_256371_c1
485 nmdc:mga05p37_263824_c1
486 nmdc:mga05p37_26787_c1
487 nmdc:mga05p37_3894_c1
488 nmdc:mga05p37_4306_c1
489 nmdc:mga05p37_43501_c1
490 nmdc:mga05p37_6228_c1
491 nmdc:mga05p37_6330_c1
492 nmdc:mga05p37_650_c1
493 nmdc:mga05p37_702_c1
494 nmdc:mga05p37_79078_c1
495 nmdc:mga05p37_96435_c1
496 nmdc:mga09592_20882_c1
497 nmdc:mga09592_213_c1
498 nmdc:mga09592_5248_c1
499 nmdc:mga09592_64552_c1
500 nmdc:mga0qj67_13269_c1
501 nmdc:mga0qj67_1580_c1
502 nmdc:mga0qj67_23116_c1
503 nmdc:mga0qj67_311_c1
504 nmdc:mga0qj67_62267_c1
505 nmdc:mga06r32_182476_c1
506 nmdc:mga06r32_2237_c1
507 nmdc:mga06r32_2324_c1
508 nmdc:mga06r32_24814_c1
509 nmdc:mga06r32_63653_c1
510 nmdc:mga08y16_124359_c1
511 nmdc:mga08y16_138_c1
512 nmdc:mga08y16_164868_c1
513 nmdc:mga08y16_2413_c1
514 nmdc:mga08y16_303906_c1
515 nmdc:mga08y16_55875_c1
516 nmdc:mga08y16_9084_c1
517 nmdc:mga0n895_113551_c1
518 nmdc:mga0n895_123809_c1
519 nmdc:mga0n895_165699_c1
520 nmdc:mga0n895_1678_c1
521 nmdc:mga0n895_186_c1
522 nmdc:mga0n895_274766_c1
523 nmdc:mga0n895_284526_c1
524 nmdc:mga0n895_44501_c1
525 nmdc:mga0n895_6463_c1
526 nmdc:mga0n895_83425_c1
527 nmdc:mga0rr50_101410_c1
528 nmdc:mga0rr50_16530_c1
529 nmdc:mga0rr50_2655_c1
530 nmdc:mga0rr50_27001_c1
531 nmdc:mga0rr50_446_c1
532 nmdc:mga0rr50_44797_c1
533 nmdc:mga0rr50_6341_c1
534 nmdc:mga08x19_22697_c1
535 nmdc:mga08x19_2893_c1
536 nmdc:mga08x19_29576_c1
537 nmdc:mga0a205_132713_c1
538 nmdc:mga0a205_1371_c1
539 nmdc:mga0a205_32679_c1
540 nmdc:mga0a205_33630_c1
541 nmdc:mga0a205_66237_c1
542 nmdc:mga0a205_884_c1
543 nmdc:mga0a205_99781_c1
544 nmdc:mga0sz30_35816_c1
545 Ga0501084_0007522
546 Ga0587079_008615
547 Ga0501082_0019522
548 Ga0501082_0219075
549 Ga0530510_0018572
550 Ga0530510_0026883

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00355

Rieske

Rieske [2Fe-2S] domain

106

201

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bok-assembly1.cif.gz_A ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2 0.8444 41 147
2qpz-assembly1.cif.gz_A naphthalene 1,2-dioxygenase rieske ferredoxin 0.8152 41 148
5bok-assembly1.cif.gz_A ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2 0.8148 41 147
6jwp-assembly2.cif.gz_J crystal structure of egoc 0.8101 215 241
4emj-assembly1.cif.gz_B complex between the reductase and ferredoxin components of toluene dioxygenase 0.8034 41 149
ID Description Score Start End Superfamily
af_Q6DHJ3_118_252_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8947 41 146 2.102.10.10
af_A0A0P0W4T7_38_167_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8898 42 151 2.102.10.10
af_Q9FYC2_83_225_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8845 37 146 2.102.10.10
af_I1JZ61_209_331_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8796 36 150 2.102.10.10
af_Q6K689_84_212_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8788 38 151 2.102.10.10
ID Description Score Start End GO Terms
AF-A0A2V7BVL2-F1-model_v4 (Fe-S)-binding protein 0.9848 4 263 GO:0016491
GO:0046872
GO:0051537
AF-A0A3D4B7V3-F1-model_v4 (2Fe-2S)-binding protein 0.9808 34 149 GO:0046872
GO:0051537
AF-A0A7Z9M5G1-F1-model_v4 Aromatic ring-hydroxylating dioxygenase subunit alpha 0.9763 9 250 GO:0005506
GO:0051213
GO:0051537
AF-A0A5N9GWS7-F1-model_v4 Rieske 2Fe-2S domain-containing protein 0.9758 62 135 GO:0046872
GO:0051537
AF-A0A3D3DNV1-F1-model_v4 Iron-sulfur protein 0.9668 39 247 GO:0005506
GO:0016491
GO:0051537

Map