F379990

General Info

Members Datasets Scaffolds Average Seq Length
274 127 548 398

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0031998|Ga0496104_0031998_3522_4778
Length 418
Sequence VADAGTNVWAAGRHHGXXGEVTGASAVEVYYDPFDFEIDNDPYPAWKRLRDEAPLYYNEKFRFYALSRYEDVARELPNWEAYRSGRGTTMDVITSGIEVPPGVILFEDPPLHDLHRRLLSRVFTPRRMEEIEPLTRQFCVRALDPLVGSSRFDFIQDIGAMVPMRTIGYLLGIPEEDQRGIRDKTDRVLGLKEGKFRTVTAEAFENSYQLFAEYIEWRADHPSDDLMTQLLTAEVEEDGALRRLTRTEVLTYTSMIAGAGNETTTRLIGFIGQLLAEHPDQRRELAADFSLIPKAIEEVLRYEAPSPVQARYVARDVECHGHTVPEGSVMLLLNGSANRDERHFPDADRFDIHRSGGHLSFGQGLHFCLGSALARMQARVVLEEVLTRWPDWEVDYDSAAMAHTSSVRGWGKLPVIIG

Samples

Sample ID Description Type Environment
1 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
12 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
13 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
14 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
15 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
16 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
23 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
61 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
62 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
63 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
64 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
65 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
66 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
67 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
68 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
69 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
70 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
71 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
72 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
73 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
74 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
75 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
76 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
77 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
78 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
79 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
80 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
81 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
82 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
83 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
84 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
85 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
86 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
87 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
88 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
89 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
90 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
91 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
92 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
93 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
94 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
95 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
96 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
97 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
98 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
99 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
100 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
101 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
102 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
103 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
104 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
105 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
106 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
107 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
108 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
109 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
110 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
111 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
112 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
113 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
114 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
115 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
116 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
117 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
118 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
119 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
120 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
121 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
122 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
123 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
124 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
125 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
126 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
127 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.18
Metatranscriptomes 0
Isolates 1.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 31.02
Nodule 0.36
Rhizoplane 13.5
Rhizosphere 48.54
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496104_0031998 3300048907 Bacteria 4895
2 Ga0070682_100003990 3300005337 Bacteria 8196
3 Ga0070669_100000494 3300005353 Bacteria 29775
4 Ga0070671_100002308 3300005355 Bacteria 14722
5 Ga0070671_100083441 3300005355 Bacteria 2672
6 Ga0070659_100196415 3300005366 Bacteria 1660
7 Ga0070667_100000313 3300005367 Bacteria 54181
8 Ga0070667_100000632 3300005367 Bacteria 34198
9 Ga0070667_100001285 3300005367 Bacteria 22677
10 Ga0070667_100012904 3300005367 Bacteria 6906
11 Ga0070667_100017092 3300005367 Bacteria 6009
12 Ga0070667_100018795 3300005367 Bacteria 5732
13 Ga0070667_100036998 3300005367 Bacteria 4092
14 Ga0070714_100047054 3300005435 Bacteria 3662
15 Ga0070714_100118906 3300005435 Bacteria 2348
16 Ga0070663_100063795 3300005455 Bacteria 2661
17 Ga0070681_10143064 3300005458 Bacteria 2321
18 Ga0070681_10329691 3300005458 Bacteria 1436
19 Ga0070665_100003555 3300005548 Bacteria 16535
20 Ga0070665_100016677 3300005548 Bacteria 7361
21 Ga0068859_100000081 3300005617 Bacteria 87606
22 Ga0068859_100034395 3300005617 Bacteria 5086
23 Ga0068861_100248645 3300005719 Bacteria 1516
24 Ga0068863_100000389 3300005841 Bacteria 44673
25 Ga0068863_100002039 3300005841 Bacteria 20023
26 Ga0068863_100031311 3300005841 Bacteria 5078
27 Ga0068863_100173115 3300005841 Bacteria 2071
28 Ga0068858_100015124 3300005842 Bacteria 7257
29 Ga0068858_100268054 3300005842 Bacteria 1624
30 Ga0068860_100000162 3300005843 Bacteria 109869
31 Ga0068860_100000227 3300005843 Bacteria 87278
32 Ga0068860_100459283 3300005843 Bacteria 1267
33 Ga0068862_100000234 3300005844 Bacteria 61937
34 Ga0068862_100133546 3300005844 Bacteria 2197
35 Ga0068862_100143432 3300005844 Bacteria 2121
36 Ga0081455_10087852 3300005937 Bacteria 2528
37 Ga0081539_10013574 3300005985 Bacteria 6126
38 Ga0075365_10004061 3300006038 Bacteria 7681
39 Ga0075365_10014001 3300006038 Bacteria 4815
40 Ga0075365_10030501 3300006038 Bacteria 3454
41 Ga0075365_10036106 3300006038 Bacteria 3202
42 Ga0075365_10117309 3300006038 Bacteria 1833
43 Ga0075365_10139915 3300006038 Bacteria 1680
44 Ga0075363_100001374 3300006048 Bacteria 9169
45 Ga0075363_100001404 3300006048 Bacteria 9106
46 Ga0075363_100002806 3300006048 Bacteria 7233
47 Ga0075363_100004448 3300006048 Bacteria 6136
48 Ga0075363_100006043 3300006048 Bacteria 5458
49 Ga0075363_100007936 3300006048 Bacteria 4915
50 Ga0075363_100012768 3300006048 Bacteria 4054
51 Ga0075363_100021537 3300006048 Bacteria 3249
52 Ga0075363_100071187 3300006048 Bacteria 1889
53 Ga0075364_10000301 3300006051 Bacteria 24078
54 Ga0075364_10000418 3300006051 Bacteria 21287
55 Ga0075364_10001595 3300006051 Bacteria 12400
56 Ga0075364_10002043 3300006051 Bacteria 11260
57 Ga0075364_10004162 3300006051 Bacteria 8294
58 Ga0075364_10004807 3300006051 Bacteria 7816
59 Ga0075364_10005202 3300006051 Bacteria 7550
60 Ga0075364_10033433 3300006051 Bacteria 3312
61 Ga0075364_10048776 3300006051 Bacteria 2760
62 Ga0075364_10050632 3300006051 Bacteria 2711
63 Ga0075364_10088854 3300006051 Bacteria 2049
64 Ga0075364_10095833 3300006051 Bacteria 1973
65 Ga0075367_10020204 3300006178 Bacteria 3706
66 Ga0075369_10000041 3300006186 Bacteria 33583
67 Ga0075369_10000107 3300006186 Bacteria 22435
68 Ga0075369_10000383 3300006186 Bacteria 13305
69 Ga0075369_10041194 3300006186 Bacteria 1977
70 Ga0075369_10045200 3300006186 Bacteria 1893
71 Ga0075370_10001860 3300006353 Bacteria 9457
72 Ga0075370_10003738 3300006353 Bacteria 7281
73 Ga0075370_10008973 3300006353 Bacteria 5171
74 Ga0075370_10009226 3300006353 Bacteria 5112
75 Ga0075370_10009290 3300006353 Bacteria 5102
76 Ga0075370_10010142 3300006353 Bacteria 4911
77 Ga0075370_10044293 3300006353 Bacteria 2516
78 Ga0075370_10083858 3300006353 Bacteria 1834
79 Ga0075428_100073058 3300006844 Bacteria 3745
80 Ga0075431_100119485 3300006847 Bacteria 2719
81 Ga0097620_100000081 3300006931 Bacteria 87606
82 Ga0097620_100034390 3300006931 Bacteria 5086
83 Ga0105250_10012107 3300009092 Bacteria 3570
84 Ga0111539_10002432 3300009094 Bacteria 24762
85 Ga0105245_10132576 3300009098 Bacteria 2338
86 Ga0105245_10169337 3300009098 Bacteria 2079
87 Ga0105247_10000007 3300009101 Bacteria 409490
88 Ga0105242_10052751 3300009176 Bacteria 3319
89 Ga0105248_10000172 3300009177 Bacteria 75084
90 Ga0105248_10000884 3300009177 Bacteria 33587
91 Ga0105248_10084529 3300009177 Bacteria 3570
92 Ga0105249_10000098 3300009553 Bacteria 120091
93 Ga0105249_10013181 3300009553 Bacteria 7294
94 Ga0105249_10017074 3300009553 Bacteria 6440
95 Ga0105249_10460908 3300009553 Bacteria 1311
96 Ga0105239_10138245 3300010375 Bacteria 2713
97 Ga0157378_10054546 3300013297 Bacteria 3559
98 Ga0163162_10014227 3300013306 Bacteria 7772
99 Ga0163162_10202578 3300013306 Bacteria 2113
100 Ga0163163_10004370 3300014325 Bacteria 12041
101 Ga0163163_10244374 3300014325 Bacteria 1845
102 Ga0157379_10006878 3300014968 Bacteria 9835
103 Ga0207696_1028996 3300025711 Bacteria 1693
104 Ga0207710_10000013 3300025900 Bacteria 409402
105 Ga0207693_10278751 3300025915 Bacteria 1310
106 Ga0207681_10000727 3300025923 Bacteria 21633
107 Ga0207687_10083296 3300025927 Bacteria 2315
108 Ga0207687_10085365 3300025927 Bacteria 2290
109 Ga0207644_10013985 3300025931 Bacteria 5363
110 Ga0207711_10000264 3300025941 Bacteria 57029
111 Ga0207711_10000667 3300025941 Bacteria 34138
112 Ga0207712_10000076 3300025961 Bacteria 120445
113 Ga0207712_10024977 3300025961 Bacteria 3965
114 Ga0207668_10115278 3300025972 Bacteria 2024
115 Ga0207640_10019558 3300025981 Bacteria 4004
116 Ga0207658_10000952 3300025986 Bacteria 23914
117 Ga0207658_10001055 3300025986 Bacteria 22349
118 Ga0207658_10023141 3300025986 Bacteria 4333
119 Ga0207658_10026335 3300025986 Bacteria 4077
120 Ga0207658_10026468 3300025986 Bacteria 4066
121 Ga0207658_10039437 3300025986 Bacteria 3408
122 Ga0207703_10012393 3300026035 Bacteria 6645
123 Ga0207678_10029347 3300026067 Bacteria 4800
124 Ga0207641_10002383 3300026088 Bacteria 17335
125 Ga0207641_10013088 3300026088 Bacteria 6804
126 Ga0207641_10027809 3300026088 Bacteria 4671
127 Ga0207641_10187978 3300026088 Bacteria 1896
128 Ga0207676_10112725 3300026095 Bacteria 2279
129 Ga0207675_100208469 3300026118 Bacteria 1879
130 Ga0207675_100250392 3300026118 Bacteria 1714
131 Ga0207428_10007590 3300027907 Bacteria 9887
132 Ga0268266_10043629 3300028379 Bacteria 3833
133 Ga0268265_10000245 3300028380 Bacteria 61952
134 Ga0268265_10113636 3300028380 Bacteria 2216
135 Ga0268264_10000017 3300028381 Bacteria 498037
136 Ga0268264_10000152 3300028381 Bacteria 157374
137 Ga0307413_10058384 3300031824 Bacteria 2365
138 Ga0307410_10012470 3300031852 Bacteria 4919
139 Ga0307409_100000569 3300031995 Bacteria 16044
140 Ga0307415_100001063 3300032126 Bacteria 12774
141 Ga0316584_0026212 3300036712 Bacteria 4283
142 Ga0436364_0691554 3300037853 Bacteria 3222
143 Ga0439461_0012797 3300041410 Bacteria 1575
144 Ga0439461_0018292 3300041410 Bacteria 1370
145 Ga0439465_0003129 3300041413 Bacteria 5401
146 Ga0439465_0003652 3300041413 Bacteria 5015
147 Ga0439465_0004564 3300041413 Bacteria 4472
148 Ga0439465_0018444 3300041413 Bacteria 2180
149 Ga0466969_0016799 3300044656 Bacteria 3827
150 Ga0466972_0056245 3300044658 Bacteria 1892
151 Ga0466972_0063700 3300044658 Bacteria 1766
152 Ga0466966_0005488 3300044684 Bacteria 8334
153 Ga0466961_0008658 3300044693 Bacteria 6486
154 Ga0466963_0039630 3300044694 Bacteria 3086
155 Ga0466968_0014358 3300044735 Bacteria 3130
156 Ga0466970_0068057 3300044765 Bacteria 1913
157 Ga0466959_0002142 3300045049 Bacteria 12518
158 Ga0466959_0027855 3300045049 Bacteria 4191
159 Ga0466958_0000569 3300045836 Bacteria 15728
160 Ga0466958_0068703 3300045836 Bacteria 2166
161 Ga0466967_0285388 3300045976 Bacteria 1585
162 Ga0495638_0010442 3300046460 Bacteria 6448
163 Ga0495630_0015580 3300046517 Bacteria 5554
164 Ga0495624_0054160 3300046690 Bacteria 2530
165 Ga0495581_0061045 3300047315 Bacteria 2178
166 Ga0495674_0173513 3300047319 Bacteria 1798
167 Ga0495593_0008397 3300047673 Bacteria 6006
168 Ga0496100_0032535 3300048903 Bacteria 3254
169 Ga0496100_0172945 3300048903 Bacteria 1557
170 Ga0496101_0002121 3300048904 Bacteria 12094
171 Ga0496101_0105200 3300048904 Bacteria 2118
172 Ga0496101_0108162 3300048904 Bacteria 2090
173 Ga0496102_0000169 3300048905 Bacteria 88452
174 Ga0496102_0000171 3300048905 Bacteria 87903
175 Ga0496102_0019639 3300048905 Bacteria 5953
176 Ga0496102_0029353 3300048905 Bacteria 4922
177 Ga0496102_0097782 3300048905 Bacteria 2723
178 Ga0496102_0180478 3300048905 Bacteria 1989
179 Ga0496103_0000260 3300048906 Bacteria 50741
180 Ga0496103_0000871 3300048906 Bacteria 21931
181 Ga0496103_0025810 3300048906 Bacteria 3553
182 Ga0496104_0017195 3300048907 Bacteria 6579
183 Ga0496105_0034779 3300048908 Bacteria 4146
184 Ga0496107_0020972 3300048910 Bacteria 4618
185 Ga0496108_0007333 3300048911 Bacteria 8938
186 Ga0496108_0062188 3300048911 Bacteria 3144
187 Ga0496108_0188584 3300048911 Bacteria 1787
188 Ga0496108_0195453 3300048911 Bacteria 1754
189 Ga0496109_0038022 3300048912 Bacteria 4350
190 Ga0496109_0053127 3300048912 Bacteria 3694
191 Ga0496109_0104994 3300048912 Bacteria 2624
192 Ga0496109_0114943 3300048912 Bacteria 2504
193 Ga0496110_0025355 3300048913 Bacteria 5066
194 Ga0496110_0099091 3300048913 Bacteria 2613
195 Ga0496110_0150121 3300048913 Bacteria 2110
196 Ga0496111_0102470 3300048914 Bacteria 2104
197 Ga0496112_0005840 3300048915 Bacteria 10717
198 Ga0496112_0006738 3300048915 Bacteria 10119
199 Ga0496112_0056150 3300048915 Bacteria 3875
200 Ga0496112_0126975 3300048915 Bacteria 2521
201 Ga0496112_0273975 3300048915 Bacteria 1635
202 Ga0496112_0375102 3300048915 Bacteria 1364
203 Ga0496114_0011801 3300048917 Bacteria 6991
204 Ga0496116_0003736 3300048919 Bacteria 14887
205 Ga0496116_0033942 3300048919 Bacteria 3610
206 Ga0496117_0000149 3300048920 Bacteria 149137
207 Ga0496118_0000049 3300048921 Bacteria 251875
208 Ga0496118_0000448 3300048921 Bacteria 68329
209 Ga0496119_0008616 3300048922 Bacteria 8930
210 Ga0496119_0028069 3300048922 Bacteria 3851
211 Ga0496120_0007759 3300048923 Bacteria 7926
212 Ga0496121_0000172 3300048924 Bacteria 143849
213 Ga0496124_0000330 3300048927 Bacteria 87622
214 Ga0496124_0109986 3300048927 Bacteria 2219
215 Ga0496125_0044600 3300048928 Bacteria 3746
216 Ga0496126_0000180 3300048929 Bacteria 142694
217 Ga0496126_0127011 3300048929 Bacteria 2206
218 Ga0501067_0031482 3300049583 Bacteria 2943
219 Ga0501070_0153230 3300049586 Bacteria 1901
220 nmdc:mga03n38_10379_c1 3300050490 Bacteria 3422
221 nmdc:mga03n38_33559_c1 3300050490 Bacteria 2185
222 nmdc:mga03n38_474_c1 3300050490 Bacteria 10050
223 nmdc:mga03n38_49806_c1 3300050490 Bacteria 1864
224 nmdc:mga03n38_56336_c1 3300050490 Bacteria 1774
225 nmdc:mga03n38_9122_c1 3300050490 Bacteria 3592
226 nmdc:mga00v17_1005_c1 3300050491 Bacteria 15092
227 nmdc:mga00v17_104641_c1 3300050491 Bacteria 1790
228 nmdc:mga00v17_1372_c1 3300050491 Bacteria 12766
229 nmdc:mga00v17_1408_c1 3300050491 Bacteria 12615
230 nmdc:mga00v17_21852_c1 3300050491 Bacteria 3684
231 nmdc:mga00v17_24189_c1 3300050491 Bacteria 3521
232 nmdc:mga00v17_2706_c1 3300050491 Bacteria 9095
233 nmdc:mga00v17_51965_c1 3300050491 Bacteria 2492
234 nmdc:mga00v17_5292_c1 3300050491 Bacteria 6800
235 nmdc:mga00v17_721_c1 3300050491 Bacteria 18067
236 nmdc:mga00v17_82228_c1 3300050491 Bacteria 2012
237 nmdc:mga00v17_915_c1 3300050491 Bacteria 15862
238 nmdc:mga0yw44_121875_c1 3300050492 Bacteria 1680
239 nmdc:mga0yw44_19731_c1 3300050492 Bacteria 3724
240 nmdc:mga0yw44_2770_c1 3300050492 Bacteria 7589
241 nmdc:mga0yw44_32918_c1 3300050492 Bacteria 3024
242 nmdc:mga0yw44_34556_c1 3300050492 Bacteria 2963
243 nmdc:mga0yw44_67778_c1 3300050492 Bacteria 2206
244 nmdc:mga06z11_83579_c1 3300050494 Bacteria 1718
245 nmdc:mga07m45_31561_c2 3300050496 Bacteria 2608
246 nmdc:mga07m45_34481_c1 3300050496 Bacteria 2813
247 nmdc:mga07m45_54436_c1 3300050496 Bacteria 2261
248 nmdc:mga07m45_9575_c1 3300050496 Bacteria 5032
249 nmdc:mga07m45_9822_c1 3300050496 Bacteria 4977
250 nmdc:mga08y16_251246_c1 3300050511 Bacteria 1827
251 nmdc:mga08y16_9636_c1 3300050511 Bacteria 10140
252 nmdc:mga08x19_188424_c1 3300050514 Bacteria 1410
253 nmdc:mga0sz30_15332_c1 3300050516 Bacteria 3027
254 nmdc:mga0sz30_20_c1 3300050516 Bacteria 61066
255 nmdc:mga0sz30_24376_c2 3300050516 Bacteria 1560
256 nmdc:mga0sz30_377_c1 3300050516 Bacteria 17040
257 nmdc:mga0sz30_400_c1 3300050516 Bacteria 16502
258 nmdc:mga0sz30_59502_c1 3300050516 Bacteria 1630
259 nmdc:mga0sz30_642_c1 3300050516 Bacteria 12927
260 Ga0500635_0000812 3300053080 Bacteria 7715
261 Ga0495655_0004784 3300053083 Bacteria 2344
262 Ga0495619_0102351 3300053085 Bacteria 1951
263 Ga0500652_000466 3300053131 Bacteria 14326
264 Ga0500652_001155 3300053131 Bacteria 8446
265 Ga0500559_0039221 3300053136 Bacteria 2060
266 Ga0500627_0001985 3300053158 Bacteria 5904
267 Ga0500645_000074 3300053730 Bacteria 78753
268 Ga0500645_003195 3300053730 Bacteria 6809
269 Ga0501082_0242933 3300060353 Bacteria 1567
270 2644633949 2643221715 Bacteria 6671032
271 2738703818 2738541274 Bacteria 6909446
272 2739330706 2738543028 Bacteria 6917070
273 2744954960 2744054611 Bacteria 5611514
274 2842137860 2842134933 Bacteria 5847019
275 Ga0496104_0031998
276 Ga0070682_100003990
277 Ga0070669_100000494
278 Ga0070671_100002308
279 Ga0070671_100083441
280 Ga0070659_100196415
281 Ga0070667_100000313
282 Ga0070667_100000632
283 Ga0070667_100001285
284 Ga0070667_100012904
285 Ga0070667_100017092
286 Ga0070667_100018795
287 Ga0070667_100036998
288 Ga0070714_100047054
289 Ga0070714_100118906
290 Ga0070663_100063795
291 Ga0070681_10143064
292 Ga0070681_10329691
293 Ga0070665_100003555
294 Ga0070665_100016677
295 Ga0068859_100000081
296 Ga0068859_100034395
297 Ga0068861_100248645
298 Ga0068863_100000389
299 Ga0068863_100002039
300 Ga0068863_100031311
301 Ga0068863_100173115
302 Ga0068858_100015124
303 Ga0068858_100268054
304 Ga0068860_100000162
305 Ga0068860_100000227
306 Ga0068860_100459283
307 Ga0068862_100000234
308 Ga0068862_100133546
309 Ga0068862_100143432
310 Ga0081455_10087852
311 Ga0081539_10013574
312 Ga0075365_10004061
313 Ga0075365_10014001
314 Ga0075365_10030501
315 Ga0075365_10036106
316 Ga0075365_10117309
317 Ga0075365_10139915
318 Ga0075363_100001374
319 Ga0075363_100001404
320 Ga0075363_100002806
321 Ga0075363_100004448
322 Ga0075363_100006043
323 Ga0075363_100007936
324 Ga0075363_100012768
325 Ga0075363_100021537
326 Ga0075363_100071187
327 Ga0075364_10000301
328 Ga0075364_10000418
329 Ga0075364_10001595
330 Ga0075364_10002043
331 Ga0075364_10004162
332 Ga0075364_10004807
333 Ga0075364_10005202
334 Ga0075364_10033433
335 Ga0075364_10048776
336 Ga0075364_10050632
337 Ga0075364_10088854
338 Ga0075364_10095833
339 Ga0075367_10020204
340 Ga0075369_10000041
341 Ga0075369_10000107
342 Ga0075369_10000383
343 Ga0075369_10041194
344 Ga0075369_10045200
345 Ga0075370_10001860
346 Ga0075370_10003738
347 Ga0075370_10008973
348 Ga0075370_10009226
349 Ga0075370_10009290
350 Ga0075370_10010142
351 Ga0075370_10044293
352 Ga0075370_10083858
353 Ga0075428_100073058
354 Ga0075431_100119485
355 Ga0097620_100000081
356 Ga0097620_100034390
357 Ga0105250_10012107
358 Ga0111539_10002432
359 Ga0105245_10132576
360 Ga0105245_10169337
361 Ga0105247_10000007
362 Ga0105242_10052751
363 Ga0105248_10000172
364 Ga0105248_10000884
365 Ga0105248_10084529
366 Ga0105249_10000098
367 Ga0105249_10013181
368 Ga0105249_10017074
369 Ga0105249_10460908
370 Ga0105239_10138245
371 Ga0157378_10054546
372 Ga0163162_10014227
373 Ga0163162_10202578
374 Ga0163163_10004370
375 Ga0163163_10244374
376 Ga0157379_10006878
377 Ga0207696_1028996
378 Ga0207710_10000013
379 Ga0207693_10278751
380 Ga0207681_10000727
381 Ga0207687_10083296
382 Ga0207687_10085365
383 Ga0207644_10013985
384 Ga0207711_10000264
385 Ga0207711_10000667
386 Ga0207712_10000076
387 Ga0207712_10024977
388 Ga0207668_10115278
389 Ga0207640_10019558
390 Ga0207658_10000952
391 Ga0207658_10001055
392 Ga0207658_10023141
393 Ga0207658_10026335
394 Ga0207658_10026468
395 Ga0207658_10039437
396 Ga0207703_10012393
397 Ga0207678_10029347
398 Ga0207641_10002383
399 Ga0207641_10013088
400 Ga0207641_10027809
401 Ga0207641_10187978
402 Ga0207676_10112725
403 Ga0207675_100208469
404 Ga0207675_100250392
405 Ga0207428_10007590
406 Ga0268266_10043629
407 Ga0268265_10000245
408 Ga0268265_10113636
409 Ga0268264_10000017
410 Ga0268264_10000152
411 Ga0307413_10058384
412 Ga0307410_10012470
413 Ga0307409_100000569
414 Ga0307415_100001063
415 Ga0316584_0026212
416 Ga0436364_0691554
417 Ga0439461_0012797
418 Ga0439461_0018292
419 Ga0439465_0003129
420 Ga0439465_0003652
421 Ga0439465_0004564
422 Ga0439465_0018444
423 Ga0466969_0016799
424 Ga0466972_0056245
425 Ga0466972_0063700
426 Ga0466966_0005488
427 Ga0466961_0008658
428 Ga0466963_0039630
429 Ga0466968_0014358
430 Ga0466970_0068057
431 Ga0466959_0002142
432 Ga0466959_0027855
433 Ga0466958_0000569
434 Ga0466958_0068703
435 Ga0466967_0285388
436 Ga0495638_0010442
437 Ga0495630_0015580
438 Ga0495624_0054160
439 Ga0495581_0061045
440 Ga0495674_0173513
441 Ga0495593_0008397
442 Ga0496100_0032535
443 Ga0496100_0172945
444 Ga0496101_0002121
445 Ga0496101_0105200
446 Ga0496101_0108162
447 Ga0496102_0000169
448 Ga0496102_0000171
449 Ga0496102_0019639
450 Ga0496102_0029353
451 Ga0496102_0097782
452 Ga0496102_0180478
453 Ga0496103_0000260
454 Ga0496103_0000871
455 Ga0496103_0025810
456 Ga0496104_0017195
457 Ga0496105_0034779
458 Ga0496107_0020972
459 Ga0496108_0007333
460 Ga0496108_0062188
461 Ga0496108_0188584
462 Ga0496108_0195453
463 Ga0496109_0038022
464 Ga0496109_0053127
465 Ga0496109_0104994
466 Ga0496109_0114943
467 Ga0496110_0025355
468 Ga0496110_0099091
469 Ga0496110_0150121
470 Ga0496111_0102470
471 Ga0496112_0005840
472 Ga0496112_0006738
473 Ga0496112_0056150
474 Ga0496112_0126975
475 Ga0496112_0273975
476 Ga0496112_0375102
477 Ga0496114_0011801
478 Ga0496116_0003736
479 Ga0496116_0033942
480 Ga0496117_0000149
481 Ga0496118_0000049
482 Ga0496118_0000448
483 Ga0496119_0008616
484 Ga0496119_0028069
485 Ga0496120_0007759
486 Ga0496121_0000172
487 Ga0496124_0000330
488 Ga0496124_0109986
489 Ga0496125_0044600
490 Ga0496126_0000180
491 Ga0496126_0127011
492 Ga0501067_0031482
493 Ga0501070_0153230
494 nmdc:mga03n38_10379_c1
495 nmdc:mga03n38_33559_c1
496 nmdc:mga03n38_474_c1
497 nmdc:mga03n38_49806_c1
498 nmdc:mga03n38_56336_c1
499 nmdc:mga03n38_9122_c1
500 nmdc:mga00v17_1005_c1
501 nmdc:mga00v17_104641_c1
502 nmdc:mga00v17_1372_c1
503 nmdc:mga00v17_1408_c1
504 nmdc:mga00v17_21852_c1
505 nmdc:mga00v17_24189_c1
506 nmdc:mga00v17_2706_c1
507 nmdc:mga00v17_51965_c1
508 nmdc:mga00v17_5292_c1
509 nmdc:mga00v17_721_c1
510 nmdc:mga00v17_82228_c1
511 nmdc:mga00v17_915_c1
512 nmdc:mga0yw44_121875_c1
513 nmdc:mga0yw44_19731_c1
514 nmdc:mga0yw44_2770_c1
515 nmdc:mga0yw44_32918_c1
516 nmdc:mga0yw44_34556_c1
517 nmdc:mga0yw44_67778_c1
518 nmdc:mga06z11_83579_c1
519 nmdc:mga07m45_31561_c2
520 nmdc:mga07m45_34481_c1
521 nmdc:mga07m45_54436_c1
522 nmdc:mga07m45_9575_c1
523 nmdc:mga07m45_9822_c1
524 nmdc:mga08y16_251246_c1
525 nmdc:mga08y16_9636_c1
526 nmdc:mga08x19_188424_c1
527 nmdc:mga0sz30_15332_c1
528 nmdc:mga0sz30_20_c1
529 nmdc:mga0sz30_24376_c2
530 nmdc:mga0sz30_377_c1
531 nmdc:mga0sz30_400_c1
532 nmdc:mga0sz30_59502_c1
533 nmdc:mga0sz30_642_c1
534 Ga0500635_0000812
535 Ga0495655_0004784
536 Ga0495619_0102351
537 Ga0500652_000466
538 Ga0500652_001155
539 Ga0500559_0039221
540 Ga0500627_0001985
541 Ga0500645_000074
542 Ga0500645_003195
543 Ga0501082_0242933
544 2644633949
545 2738703818
546 2739330706
547 2744954960
548 2842137860

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00067

p450

Cytochrome P450

181

399

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5z9j-assembly2.cif.gz_B identification of the functions of unusual cytochrome p450-like monooxygenases involved in microbial secondary metablism 0.8994 32 398
5bv5-assembly2.cif.gz_B structure of cyp119 with t213a and c317h mutations 0.897 23 398
4rm4-assembly1.cif.gz_A the crystal structure of the versatile cytochrome p450 enzyme cyp109b1 from bacillus subtilis 0.8911 22 397
5bv5-assembly2.cif.gz_B structure of cyp119 with t213a and c317h mutations 0.8911 23 398
5l94-assembly2.cif.gz_B the 2.25 a crystal structure of cyp109e1 from bacillus megaterium in complex with testosterone 0.891 21 398
ID Description Score Start End Superfamily
af_P9WPP5_7_402_1.10.630.10 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.9073 8 397 1.10.630.10
5z9jB00 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.8994 32 398 1.10.630.10
5bv5B00 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.897 23 398 1.10.630.10
af_P9WPP5_7_402_1.10.630.10 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.8919 8 397 1.10.630.10
4rm4A00 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.8911 22 397 1.10.630.10
ID Description Score Start End GO Terms
AF-A0A1E3RZP7-F1-model_v4 Cytochrome 0.973 6 397 GO:0005506
GO:0006707
GO:0008395
GO:0020037
GO:0036199
AF-A0A1E3RZP7-F1-model_v4 Cytochrome 0.9658 6 397 GO:0005506
GO:0006707
GO:0008395
GO:0020037
GO:0036199
AF-A0A498PSF2-F1-model_v4 Steroid C26-monooxygenase (EC 1.14.13.221) 0.9598 128 391 GO:0005506
GO:0006707
GO:0008395
GO:0020037
GO:0036199
AF-A0A2S8LVL3-F1-model_v4 deleted 0.9542 58 398
AF-G4HSV4-F1-model_v4 deleted 0.9442 246 398

Map